ELF4t 4 (444  TTTĤ Ĥ  ??pH ??hhhDDPtd# <<QtdRtd ??/lib/ld-linux.so.2GNUGNUcJ NeN S$F0 &!N0ERPABdV AEJ$CH!D u"p 6FHAD@@ B0 i (j ( /I2@ ) $DJP`0 DA4` @IHd 00@@BH@D@% P20XDBD&0 .BA @(1`0 @@ bQh HIAT`!P [@5I`BhA0 R0@` A*P8@  1!! $)$H!$Lb#L0 4Q% L,P(A @B80(B@0  (P@&„08 `E@{BDp Yh8~ਉ!P!%) @HAbAQb€@@cl(."@FB 00` PPZ`@`$(@@p3 ! l E$9((@ @ ]B\( `Ё# `A0/ ( ET K"5cupp  ,@ IA @$d҉d@Aa 2`R D1c="ag !A8@\P [H$ @ 8AhMnIE! "( 0F" a H0(`c GB#6[$!.*ؠ PJ!@`@BD F%B"&NHA @P @@"$I(BAM DT L@0 A H@̂g  M( Q1` #D@B )p jc%@@*@ H, $E*$`@( A! !Q  < 2@&! QBvP$"p( 8Y  @@@h&B !\p$ M,4   "$` DH! `$` d#  ` 'P@A!Y @(#`̪И@S%PF4A`(`"'N P@ X#@@@`T (aABe,0X$NQL  H@'DP P@ !&( 8Ah &I#@A1K!P@@p@($ `@1+NWW $P$D HRQ6q@HQ -(F(c ( $`@X @ 20  #&BP$`c0DX DD$"&A$0 `@@@H40 @ &*pJ@` 3@JDPR   vM 4(     "#%&')-/2369<?ACDGJKLNRVWYZ[acdilmprsyz}    !"%)*-023489:>?CFGILPUWY[]`aefinstvyz|}    "$%'+./29;=>@ABFHKMNORTZ\bcdgioswy~  "#'),.09;=>@BCEFIJNORUWXY[\_`adeghmpvwy|    #$&(+,-.0459<?BEGIJKMSTUVWXY[_bcfhkmpstwz{|  #%&*,/024578<>@BCDGJLOPUWYZ\^_abegikmnqux~  !"&'()*+-145:<=>?ABDFIKLORTVW]^acfgmoprsuy}   &(+.23457:<@CFGJLNPRUWY[\^`acdefjoprtvyH J>?B JN։]Bz?X}IAk:d\nFĹ@6\YZ *I)vyd5> ,YkFk @h32|uF suk|{0$ёZZb7[ӪˈpRDF8uw"G)-q߼)6ϚyuS#%ɵ8!p睎d/ PW2ZE~n&QMpdx?kV[RBX#jbm`=hÛu 8`Hٳ\fٝZ) rcO?@ ] Bk:G 4bŞR Qp=9 AHΧ I1)u92 `ԵqhPDyQ/UBE[ \q{$-dK#a~JP;7cMu1$~dxB,_v֞MyيS4/B:.H B|$(yia1:IHiF8ȬK],JD47*Q/߁ _UG ߄t"?E';tv^ : ؓ* +4j=s8R+SwݍU"n hJ3ak\ho'>lL(5Q/ Yɼh^k_ұ'&%L ʵwp50Mr53BLgn` ++p/n@6=Mr_b^pt]WA#&46YU`Dp[`0TrsV8"ȣ N<+lh2C{:un a6FEt3N  rj,/Y\3?H't *?xy^JWBjǏpxOȪ3V++gF1FcxYp MI{ oهC R!ڸPgUap;F'쵛’qsCVWKZ`ODpG1zB<kKNRۯ~sŏ=a'#WJf֍/_Sw*־"$y+WҀr'&$$ws/6Gc' iN6ʦ؂Y1oU設'dԳ%͹U_5ajUfd3z;`} ?,XNQ4`R16hye WACP] #%<1 JLЀ}վzDC m mXD\l0zx>5.&LSe&wy}_X1$ ,ង_V~p˥D'cj{ٛ͊$3?S]jd~ Y앺̋h<6.{} {EXJ5%:-jS6E斮P16wbr Ͼ//Ze.@o`M!жLdYIsgҥa'ހTBo !w-`2.Y]?YcG/Hb;+ e cpaR'&6=g ڰ 7,zP-q PCIsJ4NG",沥Q>0oGLx,$pqX*;gn55gfxl ][1q^+NY} n;& "VM*֖&xߥ,mcL_ٳTϫc_ {Vf$)Nd>Hf}gsU'*2^- "+~r.WihtY~>YLB<#4=%-IlG}[|=!Ċ`b{5T*5êoJ^僝X@Vn[pE΃K&CVZsJ ؊tjEv* Z֚W\q)zkIhf_i{Zgmx[]VUgqNpóAV=[eAC!*:fVqL_wu;dq! ~(wn8(޽i\9 KӢ3)Yگ5儏gwʇE;\5ϱ% "p'*m_}쏢pj.h:Eb>2۝,1/; ]TYy 2v]%bAIa{頇̟(=J/֬$n@j*qsQbKu8D@6# NmDmЁfFUjttC[]XW⣼,!Y8[\>۲R.ZbSm/7tVرAX(R-w@]ay`ÏCSw,ʿjl&j~űJ6!@ZrFmN<]'$ ]oj)"(DP<w*ԲȠpKlFI7F<@*3Ջ9{wM1]|,"uB8T1BHW8;JPB;r_Alj:{5EwQ1j댏n%5A @?74 ;E8~0yv ymnǮDw2:{'(lR^D$2Rf~KxVr.,rX;,ԁuYE"Сy W6=*sKx-t%pxBJd#y Tw$rHu$>l2*s\I{?$M@#c{h00"j推r!]Ѵc‚GӳYj18c/5ר8z?5i VaGiwʼn͢I> $3[͒СJF6ű}=0Ɠ?mMl'09Ut^FMpBg]wlU&t. =߇tcV*Y*}!K@R nb*|TiG6&L 6(FƵW 򚾜m úJ<1tg2y | H0\%kybt [fh_A6 *BΉݣkZ3z`|+;/k-k~[vԜYY?@"mˆ]qolˊ\ €er(UanbR-;¯a8$FJt$ѣ&0}_MD*Ď 6%kͼ *Bҵ^2w5Ryv5 go7\'tw ūp7b-Xn"' 8{l$QTwܐ+{SOq83-c`ך>@y 9q&_ I٬#ki܊5:CbIˬϐ Mʝ\W_SZ)g^/$e")3k |>8^SGZU"B`@f:u`5 FCgQ3@z?P_sY(i \4Y9N'!7kP#7d )d"4Zm"w>/"2X )n=\v,6ŪA%\]*ӹyN'hjehC QƴrKx֍)h[(BqA*;m *:i)|t:qӣ;,G$tC.QzXKNӂޔs 'aWQ:ByPK"s(i OG:_K DE4^ 7ڱ qp<%oEC|ědl=I3sfn![ui*oGUjܿfoA,`1ۜ# vs3Vi{q;d.?'6l% ze(5={W2yD;4)ȟFk+ᳱW !VfkȌUA, I#l;BkqWKIy㻑 ڠ/ִZ9Gzk2 0E,2=؂Q>͠'yksz98# :YF߼SMrb$<@SPg".M~G1,W! DČˎ®.e.y=}3N7׊E]"yj'DNϷWudB_SYyʁiY_v=o/b&RE:{De _rR3:Nȟ-cK^浑㦜ĆlUayBcF&uƱ$x`i(Kdz4 bȻD3T Tn>oQ)XMNKOPA蠒J٦}9/4 Cez;aj?l#"|mԯߘ[|H}G;$ N@6Q+A+*GfY^ E^@2ir!9/On Y5vʓoMn YmǾkqa 4}e\;,MS|12˼ b|IeՌ/- =7- vn#|bv~,5'wiDZ/ͬZ[{ta`2BTOYL/J8}j+ZVnίۇXiPrFS$N}F/χd]F獔;>._+:;k &飞L-tv)*Gz^(m|}A@^jPrO5^q6N|{17>.H8)_1|D%I'Υ{ ;Ũh49 w9RU--Cj8EK|^ ?_+[YvGrUYgVp̈j zx䫐L|<ض Pnh^:ǁ6#ХD9)[jP%.t) Q]WР>o!ܙ9U xm!hI(G $|87q_ ~)7pfx%Yjʊߎ_ϾJih}ufy9x(3T|Li(!*^lok CT+V\o1U^KQ4sܿNbAY-j-ϞÑ׀{N-i$+sŚ^ry4𱑶7e2N^q5ΰw8,zZ/)lZsKnμ66ih2W-RH a֛[]j~R%5rZ'=>y?z=; Gy۬*Iv-w4&B8!w'c.sf?jߗ?'|=:qa~v8a 4 ~gݸtoȘw0SqnFثA`(^ "Om}sL!e .4E[E:1P sfPx,ZNiiDQHaHw2H`)qw|C?k{((}?X" =*mSx^-uW Yx+w3l4_R^N< $eEO' ,6hp_21_?1opJ SI{,I   F/`P 4@   @  m u 8& >K^P: KU 5 p  >` # F@ , z2`G 0P  : N @( > W"  gKiX60O  P W `@\  P@ t{lY=Up  @ 0  zX L eJl'QJ i  $z + P  % 8 j{`H |P M l   PěY|  o$Lp7z { ^lp = tpTF I4K6 4 ! ~ Eq  W0D Ju6 `^+  A * i ld]]   H{U 'e O@@ Q(5/$hF = I *Tg}` ( 4V  r14xp t(634G8p8 s@J h@IS0% < Gs+5;4hV{ G 90e L ;0  ( %C Y  j  O  w ` !sd  5 # s Q_  Pp 9= ^^GV  a M pBz N ~. 4 8yd x G g>7~ M  (@5`O to%N _  u@I6I  Y0 2 *0`  EzT{4H & o Bb N j[ SЩ U txWmI5$ &f@ $~  ,0  W@d W D { \5-l 1?\ :lx KG@p & z  ]50 H &pb 5*F q r  zZ _|bo q G~OS u !  M 05= d 4r O &,0 < 7M d sS  @ % % )- V >i`K.DJ`  NP  "  V%3Y% lnX  8! {`& br G}`     &@P3 S G  J3`kLv h@. @$ 63 ,a m ;"* I0]  a% s% d G>Ї/Ȝ)pU t}8 / @ PIH~  0G e  E2  ; <B{ @+9? Axk o `p  b4f0  0.o  З w ,Х  tPe ^R C %{p5*GP -PD o  @  d " 5 W<Xa 8 ZpI  # $S -h9$ v 0s) ,rW c] j5 Q . B\A ` [P  [y0 =P -  .8 .j  ZlJ0  niHG 5wJ8.N &6R  L̻VU C LT  <}pJ m6 p \ I'0 C TlEW0  t@  0 " .ЙA Mpxr & zL  t@ B тx0 3 @A  bq  -4<9s ( :s`O / _;&5 &hHCm[ w  { E/ ! W$@Fd T`R : NPI .(R   >pB ) ?ı`m  n  F0  o0 / 7p # p $\eB J X: fj\Jel`$   Y  J/ 3 {  e  g  $JL , rPu  e9`P bmp"3 7@C " Ae P<I  Ww ? ],`:C 0p0 :0V y_U P R470 P $  y C0c[$^I@9 .^PH  ;nP  5 = P9   { 8 Zm   M;\p G e  tfT/`  P7 `P  <P  wspi_   'P  |l@Mg x6Āo lr2 }xi VsD = E I 3*DГ Le; u\ cVh=Zh.0PPS lO uR C W@  n@ x UC@ ! T dw D  q<l#3 % pP s #0MPNa % ^W>p  Ru ,  |$? v0 OfP  |< #8G p  * @0 aI  1o 0m$ ;`t @m } &s| MHps \ Pn XEt mp $ ~W P U ܆p"p {;{ LNh `/pA  ?`c K  G;  O  9  E@v   Q+p[ W  DЇ @ B@ C ?  r < $W <a@J R`  CХ LJP] D  W? / D E 02  9 eR  i 6  pW XK " S>  >d  S!  U: XoP1 ~0GS@e Up  $` 7 -9 oe- goo' MK' # rV|P (0; n  D"&^ D@L Ep4 3 T` l' j   JBXt+!h /0 u /0I 35PO ;5u $ \`  H h cԻ"М:p I <  I ;2 i Y A0\ y # I 6r [t>& Iey $V} Z  2%()</z p \6" ]d"oP' -( Fa % %   /H 66K  QRl  @ F ~  H z  K0  C ; ]o  uty =  (r6ftp LDj7  d s |f p 1p  B3 a !\0  qe U y  Hp6  D  ff [!+4Np  Nb LO   dU  J2` 2  ;m  IEp 3;  LwWj8 N GE% U$ { Ii[p   - 5H0 v7 mE`   ]m? i  LQMkbq }t   d [ 50 kk3~ YC^\ !q|+0'  E(3"B0;  ID 9?p  R^P  ( . hp ;/ 3 E  Z[ s v| H }?F d_5( s \~p s)PC ?tS@) s  u5wX*9 ,5ˁ0 m ]Q $ e 4R _ n<5]Pc 0 M &@   y{ O Dra r"E d CP  a iy LP  z  0.  c<6 ?0 5 i6  )PV E 2 \[ _0s "  v3  :gМ . 0 C0 | pdEw". _D% HA $м 4 (` N ^  #85S5`( 6*0 71`  iSP\ J  PA[ s& ~ '2# 1Zp  0p 7 F`W ^ ] O< @B -   # G nX ? `  OgGgFv`> Z:;* lPM x 3v8<4e1 _^06 xT  "  J@ ) n0 7 =Cu @p  ,ENdP)  Sq1 y; ( $  j-@ fgL ( |̆! 95:  [g`~g0S \2 6U ) u0  xtKS`6V &v m0BLl_`% 7 q q  ,N $  P@D s sQJh G # 9|p"4 dd9eЖ O 7ض8 1Ip2  GJPZ| $OQ YPp a B o z vI *r6 x  |  8{ܜb  =`2 ~|  *i  { Ӏ`[f OYO  Be +>  B`Xn  (@P C T@  Y T=Q e 24t`G  $ 6 p ^  q@ .`_ c ` X; Gm  +4V4 E`  QDo`q% 0a $G < LК . C>U  \}o -pA 40  h + `J5 g6`X0@3T vA y%HN VLc Mg bv+  6F m0  in؜STHl  n@{`  43g@ %  I2X4" z -1 3 ЯC3!G AN I @ [ > 6H0 35R0Z b<p =&A ) =)Chx@  x  C` %PN Q R E*P0 3 8\G FPm u T  !Ap4F1'  % ~ c01 @  $tp  Yv`  h5^P(p p  ,02 3 ~" p`mX .0(   WpE, '  o = <`  V  dМ; d@  2>`! -MP3 3 u w  hwЁ f J ] dPp 1O H|t1 :Q, 8d&|  %Ip 0`0 & q3 I.Hfu3 #Ȇ `    6 E qpC & r  o (% _a c ^  M\p  w95!89 A   k  d  ]z] K )<m S ]  H/  ,p{  yu0 * f@wS RR P <#(  LPZ e l >F`<  EnW< CLK1Hԇ:Knc w4v@P 2p6Bp ; ;P  kNi E1 LG! ZG B .'"Jl^1  xIA  3 ZJ  w[` E :( Z ( ]U  WbPg R F _SE wE-d)Z&P vK / `8PQ  A0g bB 1 @@ < &@  S<&@ GH  #p] l406 (+ B k 0  oj  n~  I`=e PVF\ kG7 lW \p 6 m  O& e4 B q%yF@ S Nqp0  ]  )0 C "p j   1` ] 4Ф  HL^pNwT 'j O - { q/3   8Rp =@  ke   K S *WIc m= ~D@PiI n #  HP] -  A & 8  B\)m s ;!  mu0 t > +    ~2`P8C` n ;p  Nj* a  \dA'bt T  4 TT  M )?qp6= ^}  2 5 s  "gЕ  ( dV!K$eT4H  d  pDAUq  z  CK0E QN h  *  $: rtG 1Q 9:C @Od  `)  i_ (@  y   + ! 5Pv A >  Nf [1 3 5w` | > 4* J0S # %u` KR $ {V4d # E  @m  C\ p Cлm0   5 _P  ) k]y >F  n53T0g 4htЖ x O M ([ y m C HJl  _ f g5v_\AY0?O a <Pe*C] ``<c qp> X / E~>Hp o X`;   S1@ j= ~!+`.  qK  $B, @f ym%, _50 3 *@ + bB '@ j -g  020 Zp  t@0X) i@6 0 \ tK & ^ s R/H`Ei 5 3 8 ? MG w]TtkP `  1c 3 cO 7 n  u05 0&    (. ^9;0"4 x<}  l  E5p7 fІ7 r :"Lc0: x ,HR;8KPw !$B  4P  |!`r$ : ) n 3/  9j  q`m % `  mIfZR< yP/ 3   }14Q  p`   W~ a(q   {,`s, zG  4lP   \ < ~ S80 3  % 2Nm / |h  Q[nK@E  xC ?'p  L + : 8 s bK P  d[, T 7_d? v U y 1Л) 7N = u J  1k  6ܻp"wp  =F (]{  :bP V qgD7 /+ # c | e *l`G9R`1 w$yW F qP s@$ & ?/ Ch6_ C-  ]؆]  :tYe ?|# d [ ^  HO`4,PE :oW.C   8T# zrД3 G0"3 &41.s  8@5 W Un ?x} .7 y M  /DF   ,)|&0  S !P- yQ H A` S ]0` jl / 4_pX hS es $ J 3"  } P d @GoM !0 "V \   (p *t0 Ep \ cM glu v 5PUK   %$i  Q,Ks s '  2Y GQ4_'p$9 K0U  U@L -| [p { Zp vN3*p# <#  rZV? P0u M iwCu N > P   8J|Gf& ' BQ Y= _Xt$c! + s  |im  `u  E  g % o! y I F!ZO  -0 RB  PKU 6n* + 0P " T@&% 00 H = 1 P m EX@)  iv  P9  &k\E%^?4 a #  6|+~0 D ! jXw U0  Nxq@  sI  K  rЪ  SuTz* :  %R|  C(  Jy8 4 t!6oW\(rBPV4 a  0 !*63p8  0K< S0tx ^  6 l| 9] d Wrd O&x5GR q'55 1 [y ei5.`5^g` Ek5ԜU 7 _ / vw T `S 8@3 LTC=moP , _P  >`=h T  MLj `! \ap G h PR# U   Kq  # h8 l@ K BqbB wp ;8T XW ab5Nk ) ( R# \: + ^P  _ ? @ 1 =  V - F 2DP42 Х  2ON Gp  S@ 4 }%  K0ud n86Fr> p*P  Mpy^ ]N > `m %$F W]A;b V@ Z m:: b  R /p  W  \ \`Ad W@L  |@  0  DGTi' 8  U  WP   :@n ? G?܇ X p i OY  u` %  `WX D h2PW 7 {kH< {@ y P#l)   *3XE"30  := )J`WJ `_H6Lqpr :a   m68P lD@ @ J- ' &'x4S0 P eKp ` Pb I!Y {ED$ $ X@3 4 #G,o  J|*  f0x I  : '@1 g,G&jXcqzO P-* NP6 SXK{8 o  50 Q IT` b` sK D0   8Q   )e  06p ^ fh$Kxs 4 Zv  X= -{@  ]( Pp  U`# 4Bhl ^ 'n` c i; F` ^ hG:  VOR 6* 0d'  mT 0  Z&H G@HD7 4P 6 0( !0y 7@C 8 <p kl% `7  y&|țc  ^P z*@  }P- Yn @?@@@AABACAD AEAFAGAHAI AJ$AK(AL,AM0AN4AO8AP-VD$0-$[t$<1ۉ :uL$<|$ $uЉ xRD$8t$8L$4@  LD$8T$89Ut4r$1}$t$5T$$=$*D$-$i7!$  T$$u ==8|$u 1= =$ =$MD$4$=$t$a=؇$;Et =$$$$`D$44D9@ @< @0PXeVGL$4$T$D$T$@$]E$a9$D$D$u=8$X]DD$<T$D$ .D$$T$<1-T$D$$T$0D$D$$$-&x8$;Et ==$R$ ==܇/`D$($*$MD$4$=$t$u ='=/$$=s$Fe1t;euD$L$X=܇ Dž=܇>tAۿt;et!1ׅ=D$D$W$uÅtD$X4$u뤃$cfD$D$$袿$==TT $xw1ۃ= t!1ۃ=ЇuL=Hu[=Tt = uI=Їu5=8u,=u# P u$趟=TG=Ї= tuL=H=8=Lu)D$$|jpCD$$j4$qv{`D$HC$覧'$4HC=HC$~;dvD$R$=܇D$D$$D$$$臀袂f{==u=hu4>?1=L= 1ۃ=8=$eV=Ĝ~o1=<&t&=t P ^$苝 H[ D$$|hpCD$$h$p蜙F$W$)-1;et1D$$9h=8D$u8$h$7$~=,vND$D$$J\$$N땃|vD$(D$D$$D$D$ƣHC$0=D$4$4$HC\$D$4$D$D$8|$$1D$D$щ $IT$$T$$)Q8tVt$4$1~$7D$D$%$ T$t$T$$'$u4$T$(T$t;$D$zD$D$4$D$(;OC1^PTRhhPQVh@7US=ću?ȇ? ?9sȇ ?ȇ9rć[]Ít&'U?tt $?Ð$4Ї$܇l UWVSÃ,5D$D$X$;t$t$ 0D$$D$D$D$U$\$$$[t&D$ D$hD$$9FuD$D$o$\$$D$D$$~\$$DP1DPtO8suxeuxtuހxu؋j,$ED$D$$ l$$fD$[,$Dx-ptD$]4$tD$D$$t$ D$$D$D$D$,$ 5D$D$$@t$ D$$D$5D$D$4$t$ D$$D$^D$D$|$D$$D$.,[^_]D$D$($D$Ct$ D$$D$&'STD$$TX]T[ÍvW(D$D$$tEi~ vD$ |$D$$|$1D$#D$щ $tT$T$$TD$D$$|_(_ِt&UWVS91ې$z\$$9ut $貚ËD$0C01D$8D$щ $t$$`tD$9D$$C01D$:D$щ $Bt$$&D$`$-$ED$$,$+$s[^_]É'St8u[D$$NMt8uD$D$$D$$Zԍ&S\$ $ $$2uUu9kt = u t1$G=t -ލ&+1贄fyfȍ&D$ $ t$|$tt$|$fD$ $lƀ-t*1ruտt$|$Ðt&P D$ t$|$$ 1ҋ 8-Ѕu%1Ҁ8rtЋt$|$ÿu$<$p,$$t$ Ћ|$ÍvTC$`\C$TCXC\C`CÍt&'D$$I*aHCT$ u0~&$ĒHCfyЃÐ& dC\$t$t\$t$Í&TC$K04$D$lD$$t$$sdCt>uwD$oD$$c/bin@/sh[hC$D$pD$$+\$$lC\$t$zf4$@D$nD$$t$$끍&D$D$$$ãdCD$uD$$\$$nD$vD$$dC]/bin@/shhCD$wD$$/f/lCWS$=e$1 3As$赨 u = D$$W$;=a=u = tQ$Qu= u 1=$$e3$[_1=1=Q&$貱$襱\$D$$\x91D$D$щ $\$$yD$D$0$a$D$$c$v,莁 t2=t)$[迈tD$[$軧=t*c{t D$`D$,$ "lt#D$ D$jD$$$WI(ύ&,|$$\$t$ l$($=111ujıuYÉt*5t ~$0l$$؋t$ \$|$$l$(,f賠렐$s뇐$păc@tMD$ 1D$$9D$ $8<$11v'S8D$,D$u HZD$,tgD$,PC$4bıD$,tD$,$D$,DD$$@蹿tAD$>D$ \$D$$v̜t߷jGD=--8[Í&$L(D$@ $0v( TD$,t Мe$迠ıXݝNu t D$,랐D$,D$,$8D$,v$t tøÍD$J BÉ'1ɡ`+0z )‰Ít&'VStu Q&C3tD$cD$$C t`D$hD$$ut[^Í&'ST$~D$D$$#\$$$Mu&t| t\$D$$E$D$D$[Ð&D$$$*ÍD$D$ $踃Ít&tD u*$bt--ÍƸ߉'VSt4  'D$D$$5@G$Ё ~D‰$$L~u-Ё t\$$)tn$HD$ D$$ƍ@D$w0 D0  t& [^Íu@G\GD$$X1vD$@ $U&'SD$t t ZD[Ð& TSt 0u d[Ít&Z0D[Ð=t!~'=~h=)='fÐ)c(} t&tt1=u׋t1Í=}= |=~=uf}#{};u|t&=/ult&-zfSv- b=t&UWVSLeD$<1TH$D$4tD$SD$$D$D$TD$$|$D$4D$84L$4\$8L$, T\$0911E߹\$49\$ 0L$8kT$4L$0 TT$,<މD$,D$ )D$kL$$ttftNvqD$,1ɉߋT$09\$\$D$44T$8 0t&T$D$uoD$$;D$D$L$rtt=l$[^_Ít&D$$f0uf< t< t< {tfu t<tD$$t9t< t< t< u9u\$|$4$f$D$D$$\$D$$(D$D$$uvfD$D$$lCtID$D$$a\$D$$D$D$$T'$D$D$E$D$D$Ɖ t&Ív'tD$6D$$ÍSD$(\$,tD$ID$$^1t/$PD$JD$$\$$D$0D$ D$$[Ít&DÃ,=txu t xu,áD$ D$D$@D$$ ,Í&,D$0D$D$`$0D$D$4D$ ,Í',D$0D$D$$ D$D$4D$ ,Í'SD$D$$ D$$Í@D$蓇=CtCL$ Cxɉxt [ÍvxD$$|CfS(xxC D$CD$ CD$CD$C$=tECCtD$D$$$D$D$([Ðx0t<HC0x(CD$D$$S$T${Xt&([Ðx1L$t%9Ju&9Jt u1fÍ&D$D$$PPP Ív'D$t"PP@ Ít&{t&'S tR1ۍv T$$"%ңu[Ít&'lDt ,ttTt6D$ D$$T0X tD$ D$$n     fWVSD|$ t,71ݠDt":uD$<$u܃[^_Ív[^_fVSځu p lL5)=~ = E=4 t'1 v9u긓t&[^fpu=Eƒ[^Ðp[^Á=4P뱐=(4tDf4뉐= A0T  t&  t tiA|n4D/& vD$ D$$pL o{ft1;Ð|$E£ÐUWVS$l$Le$1D$L0D$D$$0(D$P…tj!{M Ї?{!T$$7‰D$Pt$$l$ D$XƋD$P…uh=p-lhlp\EuЇ GT$,4$L$0D$4D$D$a(4$D$D$W$ߋ$L$0D$4T$, Gh$e3-l=p [^_]Ív\tc\$PD$LK9}CD$PDs09}4$T$,D$LD$ D$D$\$PT$,KA F"$*$Rt$і$7PD$D$$D$ND$$=܇ =܇B B$V$輰D$VL$0D$D$$OL$0|$4a|$4et{|$4r EBXCй#\\BE؋!сကtDʍPDɃ)D$Z돉D$ D$$XD$T$<$蟴D$8y|$86D$8BNƄ$eD$.{$D$,GT$,f^G{$T$,D$ T$,=$eT$Xt8/kD$/$ $T$,T$,D$ $T$D$'fq\$XD$$Dم"!%tDQE)Q\@dD$ D$|D$ D$kD$ D$ZƄ$ \$$T$,׳T$,D$8rD$ D$D$$課D$8dCD$Y$Z,{x8$3{0f%t&OYL0=HT05`05IT;l5dth|'u d$D$D$iT5d9tYD$D$D$$D$T$t`X-T&X\=~/lth|h$t 8;S 8t/;u =\tS\$ D$ED$$¡=\t)`XJ9T D0T $xıuD$d,[^_]D$\D$,[^_]D$D$$~u$D$,L$$D$,t$$D$D8t&L$<9L$(9t$(+D$(D$ AD$D0@D$(D$D$,$D$,L$$D$,D$DT$D$HT$(D$ "D$+D$(D@D$(D$D$,$讽D$,D$,L$t[?=-=|v Ĭd@@< 0T$DT0T$0=T$KT$01 L$($‰T$:TL$(T$DL$KT$0 0~4|g(0~4| <1ۋ-=8L$4 T$D<Ȁ 8L$0)t5 r\$$*f)uˡ<tD$D$$mT$4%H=8<?L$Dۉ  t $4É$G$St }=81D$0@D$ht @<93=~D3([;l$$[tt$h3)D$D$,$膢D$Li"f Lt04|=<8N/D$0f0~ 4|1 螩|$0`<D$00S|$0"H L@|$0D$<=<D$@vL$(L$(([t {0~4|;(0~4|lpJ9 h(D$0L$h $()lD$=-l=@ D$h 8T9ʉ}=<0D0(|$$rt$hnD$YQ9})ʁ8D$<D$ TD$$Z<냍vD$0N=t.u&DT$,苧T$,/-'D$0"t |$00~4|lp=J9h D$0lD$D$h$-l=@ |$0D$hL$lL$|$ $D$D$D$D$D$蝞D$lD$<$D$赅D$D$<$kD$lD$l 8T09ʉ}X<\$$ot$lD$@tD$D$$t&D$0D$4v9})ʁ8D$<D$ D$$ <e0~4| { (lpJ9h(D$0T$hl-lǁ@&D$h 8T9ʉ}g<0T0|$$nt$hD$D$<$D$0D$8D$4&9})ʁ8D$<D$ ~D$$қ<V&D$0D$@D$4vt& pD$hD$ D$$Wlh&D$0vD$$<$h0<0 T$,$L$(cIT$,L$(  0~4|ND$0|$h][D$ <$=@1D$h 8T9ʉ}C<0[\$$lt$hD$D$$9})ʁ8D$<D$ D$$<zD$0D$<$50~4|D$D$$ 8V9ʉ@$$@}><\$$kD$D$$D$8v9})ȃ%8D$<D$ D$$<{^D$h]$D$0[D$5D$0 pD$hD$ 6D$$薘lh t0G0~4|1t u 蘠1 % *1 ;<8D$ D$D$$Ǘ<hD$0D$8D$4(=Ї7D$@ 0~4|t|$8 |$@f۟toDtf=<1DtJ8uD$<$T$,nnT$,uա4DBnwl$4D$WD$$(D$XD$ŋD$0$5<EEt$$h|$LtT$4|) 1 D$<$F5tuv<覞t1<D$$@ @5<t$0t$0->{E1ۃÁ= 0= } =hEhEd=&t =$0?4|)& pD$hD$ MD$$lhl$4D$WD$$?D$XD$ŋD$0$5<EEt$$fD$8tMD$@|$LMU|$4~4L$4|t$8 t$@T$,贜T$,Dyl$4 1DN 8uD$,$L$(2kL$(uѡl$4 4D   p W {B } wKU5=Ut.u&T$,衛T$,U<ƒ>俣T$,葸T$,9É&uNt 0A -4| 0 t&t 0 -4|  >u$t 0 -4| |u&t 0o =4|^ t%&u 0P 4|? t1|t$;u09 4|( )(3)¨ t$t 0~ 4|tߣЇuu (0+4|v5<t$0>t <0D$0$R<<D$E$`%5u0=t$uvT$,T$,t A5vD$hT$lT$ $D$D$~$D$D$Í<$sD$D$<$衍$^D$l0 pD$hD$ D$$跌lh*zI{D|,$*^=8P$M(趔0~ 4| $I@PD$($T$,]D$7 D$Ǎ@$FT$,T$Ɖ$$^D>L$(< t < t> >$Q踟&W$,-$V(= %=0裟ې$H݅ 0~ 4|/f;&(t&= D$d;D$d11趕C 6t&M @>0zoz=(pi 0~=4|/Ї^Fl$4znzuf PS u Ї$*H8D$D$`$X,$D$f1D$LD$@D$8D$0>9|<m-<#v5=Ї =0~ 4|dCԭ&tZ'!0) 4|0% 4| 0*z"p$(&P$F-t7+y(_110,= 4|,FT$d@2D$$IID$dWFT$dD$$H 5t==D$D$$UD$$$CcX=Mv[D$tFD$$Tt$D$$$bD$D$4$謅D$jv'UWVS$t$@D$(t$4T$ D$0D$$D$,T$,L$$W9f |$('D$('='FȍDL$($mu)D$|$,$Ut$(L$4D$Tu$T$L$UT$;|$ tD$D$<$胄T$t$(C\ELu9ˉt$, 4‰T$4|$$tT$$ 3tD=0wD=~w9T$$х҉T$@)Ѐ,ƋEmT$$l$8CL$$T$8)Ήt$$AQ )qL$ʃ=~  D$$t&D$0 |$0u3=~|3u f9tlC 3t~wf-u-t D$$D$0M UKu;|$ tD$8D$<$}[^_]ËL$$T t&f;  L$$1&lftJ tuA= utw謥ƀt%;u=00tJt&" |$0T$0VN D$$ք4f $1S(!nT$E uȋuT$fFD$F$iIFD$F$It&ffxqNhE$DL$,EBD$$BL$l$ L$D$F$C hE hE NhE$DL$,AD$$BL$l$ L$D$F$DC hE hENhE$DL$,yAD$$AL$l$ L$D$F؉$B hEM hE?NhE$DL$,AD$$SAL$l$ L$D$F؉$xB hE hEhEN,F؅ttL$$L$L$l$ D$F$B hE hEzhEN,F؅ttL$$L$L$l$ D$F$A hE) hEhED$ FD$D$Fȉ$tA hE hEhED$ FD$D$Fȉ$.A hE hED$FD$F؉$A hEf hEXD$FD$F؉$A hE/ hE!D$FD$F$A hE hED$FD$F$RA hE hENhE$DL$,>D$$>L$l$ L$D$F$l@ hE[ hEMNhE$DL$,!>D$$a>L$l$ L$D$F$@ hE hENhE$DL$,=D$$=L$l$ L$D$F؉$? hE hENhE$DL$,U=D$$=L$l$ L$D$F؉$:? hE) hEhEN,F؅ttL$$F L$L$l$ D$F$> hE hEhEN,F؅ttL$$ L$L$l$ D$F$|> hEk hE]hED$D$F$mA hE, hEhED$FD$F؉$/A hE hEhED$FD$F$@ hE hED$ D$D$F$IzD$ D$D$F$IRD$ D$D$F$I*#nT$E u vȋuT$F$JH$ID$CJHnT$E u t&ȋuT$l$$IJHD$F$IHbnT$E u fȋuT$l$F$IH $J$ID$yIHD$FD$F$@FD$FD$F؉$?FD$FD$F$?F$>$@FxD$D$F$?ZD$FD$F$u?=D$FD$F$X? ND$F$>D$F$>D$F$>D$F$>FFNFD$ D$ L$$ZE  \FD$ D$ L$$E  D$ D$D$$DFD$ D$$ L$DFD$ D$$ L$eD}D$ D$D$$/DGFD$ D$$ L$CFD$ D$$ L$CD$ D$D$$CFD$ D$$ L$fC~FD$ D$$ L$5CMD$ D$ D$$BFD$ D$ $ L$BFD$ D$ $ L$BD$ D$D$$gBFD$ D$$ L$6BNFD$ D$$ L$BD$ D$D$ $AFD$ D$D$ $AFD$ D$D$ $ZArD$ D$D$ $A5FD$ D$D$ $@FD$ D$D$ $@D$ D$ D$$y@D$ D$D$$C@[D$8LD$8=1T$80)nT$ȋuT$D$V$T$;FD$N$L$;FD$ D$$ L$?FD$ D$$ L$Q?iFD$ D$$ L$ ?8D$ D$D$$>FD$ D$$ L$>FD$ D$$ L$>D$ D$ D$$R>jFD$ D$ $ L$!>9FD$ D$ $ L$=D$ D$ D$$=FD$ D$ $ L$=FD$ D$ $ L$X=pD$ D$D$$"=  $FD$ D$ L$$<  FD$ D$ L$$<  D$ D$D$$H<  J1@Ì<`l1ۅ->5t dA5C95`/ [%CD$D$&$D;\$ 1D$D$$T8`  ʏ:D$$S. D$ D$D$$:FD$ D$$ L$:F1`@Mn}umD$ D$D$$1:T$D$   D$$D$2H>   ~D$|D$F$*`VD$;D$F$`*81 ';F8D$&$L$t~"*D$;D$F$*D$!D$F$)rRz11$9|9rt& z1$m8v88E E "D$< tt )f$]e&\$D$ $D$9.5(Bt&s(),D$ D$D$$- oD$D$!$m2t$D$$@D$D$4$`cuv4$%ǡt Ut , =wD$ D$$D$-\$|$$D$ ,t$ \(mD$tAD$ $\1\$4$D$?D$D$$TbiD$P$14$D$_?Df$i=<=D$}D$4$8a$1Z<$Y(]&8=x~x t&D$!!lD$D$ $r/t$D$$=D$cD$4$e`$1Y(Jt=zD$L!$.D$$%==uwD$ D$$D$)\$D$ $D$)D$ $].D$$<$D$+XD$jD$tFD$D $.\$D$$K<D$1D$$_D$| $-D$$ <t&Sg=( t [f\$D$$D$ (É[ÍS=(!t [f\$D$$D$ o(É[Í xjr1 Í'UWVS< ID$PT$X\$TL$-dD$T$ =85$L$, L$ \L$$nT$D$8T$$m\$(t  1ېs=0t7 \$$<=0u nL$D$(-d=8 IL$ 5 L$$ \t %H3tz\$P<[^_]:f82pt&T$,T$hDpT$ۉtJ$HyVt&<[^_]Ë-u =Їu$H$S\$ t|nC\C`C CCICdCC +C$\C(XC,C08C4[ÍD$D$$8Yt]S\$ Ct;PPP D$%D$$ZC\C `CCCICdC C$$*C(\C,XC0C48[ UWVS\|$|l$\$t,$@XMD$L @)D$ t$D$`$蕵,$mt  T$LB<)t(9s$< tx t&u Ѓ9ډT$LuD$x+L$p1u#)u'D$7D$$;X\[^_]Ã$T$D$ \[^_]Ðlt$`t$\$\|$d|$pl$hl$t4$I$<$ *D$ D$$W\$$*<$)D$ D$$W|$$c*D$l$$菮4$gD$\$$<OtD$ D$$cX=  u  \$\t$`|$dl$hlÍt&<$0)D$ D$$V|$$)D$l$$4$D$D$$<iUWVSD$ D$ "D$$VD$$,us5\C3 \C19uB9 t9|u9B39t%=1ҍCvŃ;HtF9u[^_]Í&~U3fL u5\C3 \C뜍t&u\C[^_]Í \Cd&'SL$ +-toB< v-uSQ10 w= $Åty$''D$[D$ "$T\$$'[Ív1+t[Ít&yu$"vfyo$ "Z1fT$t0W0GWÍ&WÍvU1W1VS\$(t1 t* tvKft uރu11҃[^_]Ít& t+1-11L$Nq11Ҁ wh t$$T$NtFލYЀ w<$k\$ D$ڃ0L$T$ ‹\$ $ $T$\$u$T$?؃[^_]À 1-1t$1G11fUWVStF/u+> Lu(<t/)9ՉsqڋL$\$v tZ98/uft&P/HuhPP.f9t&)E.)E.UE.t$D$$D5f'WVS\$ t$$tY$>9uP<:t_t[ &t :u9ljt?$D$|$'Ã[^_Ít& ;<:u ;렍v>9t>D$-D$ "$DÃ[^_Ít&1뗍PP$#Y"@\"@$#\"@$P#M@Y"@L$j#M@Ít&UWVS,\$@L$D|$HfP;~tlj$_&5=[^_Ðt&$HD$D$ "$A\$$뷍&PLfVS\$ ;~tr$D$D$ "$A\$$sÀ;/t4\$D$$$D$D$ "B[^É$D$p뫍S\$9\Ct19`Ct)t91~ t&9t9u1[Ðt&[Í;뺍v,t$$t$0\$ |$(tt\$ t$$|$(,Ëtf~R$ң~21ې<D$$9ډхt두t넍t&D$D$녍v,\$ \$0t$$|$(tt\$ t$$|$(,Ët^~JD$D$ "$?5~=1ҋ 9ut3뛍vt댍t&D$D$덐D$LD$"$?D$MD$"$<>< ~$@fD$UD$"$d>ft$t$ \$>u5D$gD$"$)>؋t$\$Í4$HD$dD$"$=t$$t$؋\$ÐUWV1ST$($D$~T$$BD$D$"$ T$(\$$D$E1<[^_]D$"델>D$ 3>>D$D$bD$"$a7T$ PD$$ Í,\$t$ t$4|$$|$0l$(l$8D$oD$"$7hxtt 4$Ɖs |$$\$4t$ D$0\$l$(,\$t$t$ D$~D$"$6tt 4$QƋD$$st$C C؋\$Ív'\$\$(t$t$$|$|$ D$D$"$ 6x|$pt$X \$D$$D$ :v'\$\$$t$t$ D$D$"$ 5pt$X\$D$$D$ '\$\$$t$t$ D$D$"$ A5pt$X\$D$$D$ y'SD$D$"$4D$D$"$ 4CPT$ P C C[Í&'D$D$"$q4PT$ PT$$P T$(PT$,PfS\$ D$D$"$41҅ۉX @ @tSP[Ít&SD$D$"$3D$D$"$3CP@@ C C[Í&\$\$(t$t$ |$|$$tYt5{G4$D$ %G؋t$\$|$Ít&u‹uCH x ͍v 딐t&UWVSLT$`T$8T$dT$$D$|$$QD$,D$4: ,P[ tt&D$,$D$D$4D$ D$,< D$( D$(8T$8BT$(L[^_]ÐVT$ t&D$,$T$D$D$4D$DT$N&D$,< 9놃D$D$#$[T$$T$dD$`L[^_]S vD$D$H#$$T$4T$T$<$T$l  D$SD$"$/T$8BD$D$"$/D$('<\$,t$0t$D|$4|$Hl$8D$D$"$Y/ËD$@{sC CD$LCv1D$D$#$5t$$Y Dt&$#D$D$$D$9T$<$(1 CD$C&؋t$0\$,|$4l$8t$>T$$̛T$$ět$T$$=ěut&ě̛D$Le3Z\[^_]S{dN%cfT$$D$D$%$*T$$҉T$$FsuuUT$(4$l$(D$/Dž|$/G&D$>%ED$>&EUT$(x=T$@T$D$ $T$yD$/4$l$(qD$@D$t$@D$ ($D$ D$$D$/WVSÃt2t&EƉD$C$B$D$u؃[^_É'ě~̛D< t<&t $uÐSÃfuiCtuC$4#C $LD$$4[t$+$Cu$n%Cb$.$[ÐCH$1$[tD$$0s$X$D$Ct$$_$D$vCt$$o$D$xkvC~$$D$TG&$$D$6)C.vtD$$0$R$D$&CvtD$$0$G$D$&CT$x$$D$CT$8$$D$fYCt$$$D$@3vCt$$$D$ vCT$t|$$D$t&D$$$vD$$x$vD$$h$vD$$$vD$$$xkvD$$$`SvD$$$H;vD$$$0#vD$$$ v$;$D$+$;$D$$;$D$$;$D$$;$D$s$;$D$~0'WVSÃЛC11t7ft0u {t4$4Cuˉ$Džu̅tH u{$4&i$L6uЛ$[^_ÍC *CQljB&5ԛ[^_Ít&'WVS\$ t$$t.EƉD$C$B$D$Vu؃[^_É'\$\$ t$t$$|$x $tqxB4$9t64$D$D$,&$|$\$$lE|$5\$t$Í&D$D$&$|t$\$$|$\$D$ pD$D$%$D\$t$|$D$ <$D$Ít&lExt2$b$UlEÐt&$pٍ&'lE9D$tÍvt&'\\$LeD$<1t$P|$Tl$X$%t8u+T$&,\$ \$4t$$t$8|$(|$0DD$t‰4$*4$Ƌt$ D$B$D$DʼnD$$D$ D$$4$But&$ D$D$@,[^_]nsu7t$ D$B$D$DʼnD$$!t&4$D$D$Ƌt$ D$B$D$DʼnD$$D$D$$4$hvT$$9Nt&S\$ C$0%D$C [4fS\$ DPT$$CD$0%D$D$ $D$C $[S\$ C$;%D$3C [42fS\$ DT$$.CD$;%D$D$ $hD$C $[ÃD$ @$I%D$ÃD%T$$D$ @D$U%D$D$ $Ðt&S\$ $%4 D$ a9[ S\$ $a%eD$ {9[t&<T$H\$,\$Lt$0t$@D|$4|$Pl$8l$DT$ě#T$$D$D$$a%D$ <tFD$D$$h%D$ \$,t$0|$4D$@l$8<;e%Dء$D$T$D$$cD$D$ $5?e%D<$D$Ft&D$D$$+$D$ CT$D$%cD$D$ $tG;e%Dء$D$3e%\e%e%뽐WVS \$0DNT$$D$D$$m%D$ gtD4 DljD$CD$B$D$D$ $uǡD$D$$q%D$ D$0 [^_S4\$ CC t$4C [s4$$i%pEܛFԛt pE)ܛfC@$%D$C؛@PvC$s$%؛F$%pEܛFԛt ~ pE)ܛtA%pEܛF ԛt pE)ܛt&CPEs4$Ev =pEܛt&.6 F%$pEܛFpE)ܛԛt F u뇐t&s$%A4FD$(F 4+$F4$a9%LpEܛF9ԛ&CP`sF$%D$D$$|ܛB$%fpEܛF $y8 贠pE)ܛ-:9x4$vC؛@OCp |hR&Y;xD$D$T&$t$$C@fԛt -+vs4$C@$"t&s$%2؛Fvԛt FQ$4$:9-t&C$ppE)ܛV$LpEܛ^t&D$D$D$ D$<&uS1R$4=C؛@vx @ @@s莞pE)ܛ-%Js~ v.$&$Lܛ+pEܛ_f tt!6$C@؛ԛt]5D t$LC@t1$$4C@uR=Лt Л$뙍VSӃL$$%c؛ԛt $%upEܛԛt pE)ܛ[^ D$Лěԛf̛ Í'D$ ě$D$L$D$Ít&'<ܛD$@\$,\$Dt$0t$HT$pE|$4l$8T$Лěԛt 8B$%Dug%ܛpE$$?8 tXcT$-ܛT$pE:9>tt&$LpEܛ%딍vx @ @@T$-ܛT$pEt%{ =̛u t`$u\$,t$0|$4l$8<Ðt&|$@\$,t$0|$4l$8<餿t&D$$%cvGD$G$댐S\$ tD$D$'$ 9}=CCCߋCCCCߡ[Ív$D$D$'[ÍvS\$ tECt$Ct$C t$7D$D$'$O[Ív'D$ 9}=@@@ߋ @@@@ߋfD$D$'$ÍVS\$ u>rCCCߋCCCCߡt8C3$89|D$D$'$Cuȃ[^É'WVS\$ ug{v{w>K/|u#t&D$@D$'C$C$D$TD$'$tC3tC$s뉐[^_É',\$\$0t$ |$$l$(tUC t$6vWD$ D$D$$'/&D$D$'$ \$t$ |$$l$(,Ít&$,'C@$bD$[D$'C$띐t&sF$F $F$F$D$LD$'4$Lt&C$8sF$D$D$'4$J t&C@$D$TD$'C$fC$UsF$bF$WD$D$'4$fsF$F $D$D$'4$ZfsF$F$F $D$D$'4$T&sF$F$D$D$'4$fkE$u u7F$+F$P>D$uD$'4$uD$wD$',$mt&sF$bF $F$D$>D$'4$d'&D$aD$'C@$:C@$D$cD$'C$S\$ C$C $RCtD$D$'$[Í&'S\$ $$D$D$'[ÐUWVSÃ,L$t$eD$1L$@T$D$Ⱥ l$$4 )k<)t&߸gfff_))ƅҍF0ֈD=uք$"1&uBD$ $mf$l$D$ gfff~))ҍA0шD5uք|$ t)f;>u<$L$tH$G4;.T$~el$D$D<*09}T$|<$D$t $<$s$T$e3u),[^_]Ít&$$1D$ &'SӃx$.x$"[Í'VSt$ t1~+19~F<t$F9[^Í\$Ét$D$D$h'$t$\$$\$t$É'S\$ CtD$:D${($$D$;D${([ÍDD$D$$<+`ÍvS\$ D$$\$ [t&'S\$ D$$\$ [t&',\$ t$$։|$($X4%ě$$$A蘁u[(tD$ D${($s=̛<$eD$ D${($ |$$({t@t711҅tD$T$$ID$T$\$ t$$|$(,Ðt$C$Đt&$ v11҅t\$ t$$|$(,Ív',t$ |$$lj\$l$(D$D$$tthD$ D${($ l$|$É$t$$\$D$ D${(\$t$ |$$l$(,Ít&1눍v'D$ D$$D$Í'{Yt&'UWVSÃ<(L$(t@tCtC?f,C P=?1=YD$,QCD$@ $T<-DžDtD$,t=I MCt$@ $ <t--4DpL$,|D$t$<$Xt D$$D$_ D${(<$DD$$t D$a D$$D${(4$D$$T$(t<[^_]ËC D$ -t$|$$â-XCD$@ $ ;v8CD$@ $:-ƅD4C t$$:D$) CvC L$(t$|$ D$CL$$ix=! t&1Ʉ~xD$,~&CpCcvCPލCD$@ $9vC L$(D$t$ D$CL$$ D$ D$D$$($虗'VSӃt D$$x~~4$Rt"t(D$$xd?t;[^Ðt&D$$\y݃[^4t&$[^f1҉tffSD$$(( u'[fD$$$[Ív$YD$D$'$\$$[Ív'$(賅T$(`[ t) t L$$(܆D$$Tȇ$BLxL$1TD$8&$(&uL$$(dL$̜tAL$D$$CL$u>EʼnD$$̜‰f$BwL$@=(4<$D$D${($o|$$S$` ljD$A|$$ 1$BmL$\$t$t$ D$(D${($É0u@t$؋\$É4$D$.D${(Ct$D$$i؋t$\$Ít&'tGu>Мu%t+ t, t' tÍvtҍ&fB@Ðt$,Í&'T$19EEDÍt&'S1ۃET$ t 8uT$$ED؃[É'D$@@ @@@@@Ít&S\$ EEE$EEEEE@D$D${($\$$ED$$EE[ÐS\$ Cx$CC x$sC CC[É'$EÍ'S\$ Cx;D$$t [Í$C[ÍS\$ C x;D$$t [Í$C [ÍD$PPP P D$PPPP E9D$tÍvD$EEEÍWVS \$0i$脿D$D${($)Ƌ$]rM@3CT$$WD$D$D$ljD$ $<$D$D${(C T$$D$D$D$ljD$ $;D$D${(<$D$ (D$D$D$4$CT$$艝D$4$ÉD$#D$D${($;D$D${(4$# [^_Ít&$v$ސ'\$\$ t$t$$$t$At$$ut$\$ \$SD$1ۋL$ Px9t*P x9ѐtu [@ D$[&@fD$ $ED$Ðt&VS$\$0tu$)D$D${($ƋD$ (D$D$D$4$V4$>$4D$D${(4$$[^ÍS\$ te$\tD$D${($~$vCC CCCCC[Ív'Et $EhÍt&$EQÍ'@Gu@D$$萍$oD$$p$oÁ$$$$$$$eD$|1t$|$$MXD$("$Ԟ|$蠵D$D$$_$Ҹt$\$$1~T$|e3M$$$$ĜÍv$舔t\ tWtRD$$蚵x<|$,D$P|$$|4$D$|$~|$,#fD$($Ct&$賌D$$xT$,T$T$D$P$,$D$lL$1T$~BL$$;t2D$D$$k\$$o~`hqG,HWf蛵fܜ@t@ܜ${=l|М_4$K4$Pō@T$D$t DuT$^8-6= =tV=~0D$D${($J9աD$D${($%$T$5=CD$$&|$-!T$t&  9u‰T$<$D$Jz$萷NjD$(|> D$D$($9t$\$$ D$D${(4$1~P k9D$h ‹t$u(Zt&  I @ 79u+t&諴D$\$$w~G4$D$ D${(D$D8^8MD8ĸD$+$r$XUWVS-@$$=< Ht&ı&eKtTtK mCǃ|$<9 w0t$$$ C@<H$藇ı资C@$?$5$譴D$ID${($Rl$$6t$$2"$$訤1$ļ[^_]Ðt& T$Xt$\w$੯tS 1t$ܱC D$$DSD$fD$Pt.$^D$P$D$PD$fD$<D$Tt.$D$T$Il$TD$<L$< L$fL$g|$<tD$T$ D$t1C…T$HFı/ D$ 1D$D$$)f|$ft D$PD$$D$P$|$<t D$T$v|$gT$Xt 1҅‰׋ w<$=aļ[^_]Ív|$Nl$HtCC8:1D$HtCk=D$E|$8$smEDD$@E $1$D$4hD$4$ D$LhEtEHD$4Mt$4fıEě,$4$A8Zud u[(tD$ D${($ =̛<$D$ D${($|$$腦(SXK6%$0xT$Hsҋt DL$4tFHМN% tt +F$1L$0&$L$0͋F $-L$4 $ j Cı~F$6ǡRı;@"<t <u)F$-U$5L$4-D ;$؋$$$|$%$(dEs$iv$(e|$f\D$P$pD$IeC$< !D$FT$@$D$y@@E$5 ɉ!ı@u<2<"T$8D$4-D$$]csrv0,$胺vG$B1=VT$4D~$uD$0T$,T$,D$0| r$tqxq $tt&|$4=F$,ơ4  >p 4$8uǍ$D$<$-D$8FT$@;8tD$ D${(<$f4$$D$8 D$@҉ vD$0$O$D$0>1$貉$‰uE`t<$9HGt-L$\D$ $#D$\` D$xt"D$HuD$Xu$u T$X T$Hf-Їt u u-$:T-%=kIǣ$BS1ɅL$x{$U P@ 0D$D$)$Tt$$Xv$BSl$HD$E$gt{@tuEHGP6K$$$D$|$T$ D$$$B~R_l$HD$4Ol$D\$Lt$hMUt $(ED$Dt-pD$DX$)]`4tD$DD$$EЇL$DA$(TD$LD$hNjD$D$ D$_t $lpıtmD$DЋu@T$DL$`ɉD$|Bu'%=@GtL$l u L$D9D$pD$lCD$$$$?`D$$+`D$`WO tEE$U D$D$DL$L$Lt$ D$D$<$k-T$DB$T$,yT$,$ $TZ腍L$DL$$ōD$D$D$T$DBu]ıuMT$Lt+X\D$LX|$l/|$ptΡ$D$Lk묡$@n딉$F8=(<$胛D$D${($(|$$ UD$ht @? |$Dыm @L$pGl$l( T$,D$/,$ T$,D$D$'$輘l$$D$pD$`$薠((D‹X$\L$D $XЉNjD$|D$D$T$Lt$$$)Z5D$L1D$h D$`} Et$Dt1ҋHʅuut$$'L1D$<$ʖ$V $訙D$DT$DB$D$Lu=1D$hE $і t&vD$h1T$,$֘D$>D${(${L$hL$$[t$$T$,-Мt$`tD$`D$D${($RD$|L$hD$hD$D${($!T$,,$PuT$,D$`tOuD$`$cT$,D$pT$,jfJT$,ti $t$<$6t |$ltL$lD$ $貔 t|$`e $L)YM $L)c|$D|$$裈$D$W$&DŽ$z4$˲$$|$DE=1+ɍt&A8%D$`\&<$=E$HG$D$E$BR@HEHg&l$X$=D$l|$1$TT$X2$>D$@F81Y$dL$8@ t=u =Їu)D$4$&$U-D$hdMu L$`蹄D$l$$&D$4$ԑ:|$L0o 5 t$<)cVt$$pU|$LL$`T$DD$L$ǡ$g$$mt $l|$L) t5$<)hTt$W訃9D$l}$,$D$D$D${(,$g|$LtX~%1w<*|$ht(|$ht=Їt=̜t{<$荒tQMہ=X0o t44$褼$<)dS듡$L$`T$DD$$D$& K4$'5$D$D${(,$ ~eU$؋$$$|$z$貗1D$`1<$HG$@$$$$$$$$؉|$á$|$o$|$4]$SD$4$ D$RL$`tAHD$H\$lD$pT$tL$`A${):GD$h(ED$hD$ht $cıt2`$)F¸Pt :t$41ۣF69L؅u|$H D$@~T|$HcD$@~C|$HD$@~/|$H'D$@~|$H҃ T$@؅D$LueD$D$h$聉$ı$Nl*$ QE8|$L1۹D$H|$H؃E |$DD$DLD$8D$\t$\1ۍt&T$8ۉET$@F|$4u t?uO D$T$ T$,L$D$%D$)D$$ÉGt$DT$,9t$H~l$LD9}h(t&$ Ԓ ډ)9}:59D$$ 臒9|Ɖ$ D$eL$DD$\9L$\x]&1$.`$T$$ai$$L=;\$t<f| ;L$H.D$4 ω$$u(t& uꉌ$$@t $q_ıt\>L$|D$\$ $sb@@|$`G$ǡı@@<t҉<$ Q1Bm8]cD$8D$8'D$81ɁL$8t&D$H1ۉo,&K[$ ^D$ D$$謈DŽ$DŽ$@1$ D$赏)\$l@L$xD$4-D $'$K\$lt=u =ЇD$4$$KKL$x-D <$m\$lk\$lbz|$l<$"fw,$裩t,$D$D$6D$D$e)$؇l$$ܔ$ЏD$DD$ D$D$$|T$D$D$`$$芏y$*Y} $ )?tFetLsuD$2)$҃L$DT$A$uvT$DBD$,)$褎҃뻉<$D$"š$s=GE=D$,$)IX($(\T$,D$$XDžH_fUWVSÃLx~|99$;D$8D$,t @$:D$0t @$:D$4t @C$臉D$(t tHD$h̜T$hD$T$$/j̜$$3=$A:D$<$B1:Y$C1:#D$Fx |$H $^uD$D$(*$Un$-|hl$D$${r @\[^_]Í&|$,D$0 HGL$8tK$I*2 tD$0D$,$pRT$4 @GBD$D$$>QD$,~Z誧D$,$D$!1,D$$$D$D$*$D$K$D$dD$ [KvD$$k[ÍvD$L$D$nK$D$ [Kt&$D$i[Ít&'S\$ u"ft@u$ 獴&[Ít&'VSt$ tBtt(~ft~ft4$(CǍXv1}t}t}t,$CÉ$D$zD$*pt$߉$Cl$<$zCnt&D$hD$*$dpf,$BD$D$*$5pl$$C f4$D$_D$*p|$Ɖ$B1&',\$ \$0t$$T$8|$(t$4Ccu~D$D$D$ t$$ЋCtD$# D$*$pC\CtCt E؋t$$\$ |$(,Ít&T$t$$D$D$D$ $ljD$Sg9_D$ D$*<$pB&T$t$$8S҉tD$ D$*$os ,|$$|$0\$t$ t$4l$(<$@tD${ D$*$toCCt$jtZ4$2BCS \Ѓ E‰€St E$8KgJ؋t$ \$|$$l$(,ÐC먍&<$؜?D$v D$*$m|$$k@\$D$$ʼnÉE't&,t$ t$0\$\$4|$$l$(4$t/$_mt$ |$4l$(\$0|$$\$,?F&k C $Fk Ԝ4$?D$ D$*$lt$$?\$D$$\$t$ l$(x|$$,ÐS\$ tbStqCtD$U D$*$mD$W D$*$pmCu"D$\ D$*$Rm[Ðt&Eҍt&C녍&'[t&'S؜D$D$D$ $?tq$8K-HCt@uH$D$ D$*C$lD$ D$*$l1[ÍE믍&ސSԜD$D$D$ $tI@t$kD$ D$*C$lD$ D$*$l1[ø'D$ D$$ Ðt&SܜtМt&Ct9St [u[ËStu C[Ð$C$ލvU1WVS,\$D|$@th1퍴&r1ɅtNRͅu1tBƍt&C[uD$ D$*4$D$jD$,[^_]Ít&'؜\$t$tL@1t1nT$ É؜\3D$ D$*$j\$t$Ít&1ꍶS\$ $H$D$ 0D$D$$6[ Sܜ$T$t$[Ðt&1̍S$t$b[Ít&'S$t$2[Ít&'V Fp6WVS5ܜtМvVt9Ft3vuD$1D$-$7$DUt&FtS@1tAt<ËF;D$y D$*$ht<$G[^_1v'fUWVS,\$@D$t T$@:D$t&Tu1$8FD$Et{l$t&T$@8tOl$0uދD$4$,8D$ D$*$~ft$$b9Eul$D$8D$ D$*,$gD$,[^_]ÍvzD$zD$$D8D$vD$t$$D$<)&̜D$t t&1Ðt&UWVS,D$@D$$T$@|( =T$@1ۋ=D$* 948uD$t$T$L$D$D$@$;T$L$uT$D$D$*4$%fT$|$DӅt;D$@$7D$D$*$dT$@T$$7D$@D$@,[^_]ÍvP9|&<$D$C ǣt$DtCD$@L$$s6D$D$*$dT$@T$$6L$D$@D$@ ,[^_]Ít+P8D71ҋ0&WVStz_0t&ރ Ct=H9ɃD$$B룍D$*D$*<$8d[^_Ð,\$\$8|$$|$4l$(l$0t$ 1;t{t {ujfD8D$D$*$bl$$t5\$<$h54$D$\$t$ |$$l$(,Í&$4뎍D$D$*<$bl$Ɖ$4땍'D$ D$$?+D$Í'VSt$ D$D$*$a1t/4$3D$D$*$at$$d4МCC CCD$$C[^ÍSܜt3؜tbԜt [Ít&$Ԝ[fD$$@ãܜ$mC$\؜닐t&\$Ét$|$(ơܜt]$2D$D$*$j`\$$N3|$D$$\$|$pt$Ðt&뜉'LD$P\$<Ӊt$@Ɖ|$D|$Tl$HtNʉED$\$ʼn$_EE\tEEfʉL$,L$,tH@tD$D$*$`EE@u}ED$tN,$D$D$ t$Љ9tD$D$*4$O`\$D$D$$ "EHD$9D$*$TD$D$$"xH[^Ív5 vD$ D$D$/$:N$Z}D$\$$ "EHk&4$ }Wt&'VS4eD$,1$X+t 8VD$1D$\$@ۉĜN ctwغQD$ D$ )B0kdD$')Ӊ$t$\$t$=D$ D$ $t$0D$(a>D$*0D$)D$'D$D$$X+EHD$,e34[^Ít&غgfffD$))B0D$')Ã0\$(댐Ĝ0\$'D$(nvT$T$$p\$&D$D$,.$,!\$1${.Ĝz%0널t&ܜ\$\$ t$t$$tL$t\$t$Ít&t$HD$$\$D$ \t&3뭐WVS E"t $0ܜ1tvZ1ɅtKR΅u ؜1҅tQ ̜\1҅tQ;̜ܜt&D$$á̜CܜC\$$@nt*D$ D$*4$Pt;ܜtD$D$*$P t=E [^_Ít&T$$.&$ \tQD$ D$*$D$PD$t(끍D$ $1tBtE$Ít&'D$ $uÐS\$ tD$D$*$zOCt${C$萵$D$D$*HO[ÍvD$$\$t$t$(D$D$ $ Épt1ɺKܜt$ܜCX ؋\$ÍvSܜCt8Cta@ ܜCtD$$ֳ$[ÐD$D$X.$\$d*[Í&D$D$.$,$4*fSD$ 9ut&؋X${9uB$ܜ[Í&D$$$D$D$ D$Í'VSܜt$ CCt@ ܜtD$D$*$vMCtuKD$P$苲C$耳$D$D$*8MD$ *[^D$$@볍D$D$.$D$ [^(&'\$t$Z9}34t$\$Í D$D$ D$*$KZ떍t& D$\$\$t$t$uPt$t$\$\$МD$ 't u ÍD$$dp$Eot&-М$* Ít't$oEÉ'U1WVS,\$@$^+t @$h+D$t@u{11t(vCD$,$D$uۉ4$|$D$ÉD$D$$U$D$D$*]J,[^_]Ðt&@D$yt&hO&VS1ۃ$$^+t @$h+1҅t @D$D$$tuD$D$F$t^|$|gD$D$$$D$T$D$T$|#w4$$[^D$D$4$$[^fPEX!|$vtt&WVS |$ t\EtJ71v<Et.)u|$$u׉|$ E[^_t&[^_ÐD$ D$D$"$El q'S\$ C%0=0t$/\$ [fܜcSHD$$9ܜSt P\$ [7&Sސt&VS\$ Ctd ЇtS5ܜFNtctSD$$6ܜ;tHJS P\$ [^ u$?\$ [^u듍SSf$脦FܜHet&SÃ̜tB$$@̜\$$̜$@̜E~#1ۍ$U9@塈$0%@[Í&̜t@t&Í ̜t Rf ÍUWVS\$4|$0uv[D$C<$D$t؋ht!EtE tМ9U<$xD$ D$*$D|$$D$ D$*ËF$4ED$ D$*4$E,$T$D$ D$*$D1[^_]f[^_]Ívu1@E tD$ D$*$DfEE%= EEtD$ D$*$_DE{]$JD$ D$*$B\$$|$D$$?hE$D$ D$*F$C4$D$ D$*C1[^_]ËE$$@&ܜD$D$ $Ít&UWVS\\$peD$L1ڋ*t:t&t&p˅t=uމˉ=[*u`$<D$cD$@/$<D$R$=-] D$+$%D$D$L$*h$"D$+$+\D$K$+HD$C$+4$+D$=t)5Їv+r+$+D‰D$H$D$D$>$+H$oGD$D$>$*= W$+XǡGD$ ,$D$D$.,$d tl$ D$D$$t$ t$@D$D$$lGD$ t$T$$D$D$$D$ .GD$ t$L$$D$D$$D$ |GD$D$$D$ D$ CD$D$$OtD$D$$+J$n`@ ItOЇy+D$Һ+D‰$-$6+ÉD$D$D$*$?NTCD$ t$D$$$A,GXC;TCtD$ t$$D$q$@,$E,ot@t $$S,O1tD$C$$,CD$D$$S,@ @PD$D$$[,@ @D$D$$h,@ @ЂD$D$$v,cH@ p@D$D$$5H@ @D$D$$},H@ @ЀD$D$$,H@ @@D$D$$,@@ @,$,$@h+$`^+$`q$`V$`;$,$, $D$Le3O\[^_]Í)L$L$t$tL$u Hu x(\$T$D$,$NT$,$(T$thKD$E=C,$T$2 D$D$*$9l$$ T$C&K떍&L$=+߹2$T$ L$D$XD$*D$\9l$Ɖ$> D$D \$$' 4$D$l$SL$T$t >)T$,$bT$#HE>)JL$={/Z$ "q$ ǡ$ D$D$*D$T8t$É$4 <$D$ dE$]D$6`E$aD$!t$,0@ I$,8$&,j$1,Ї;/6hC$ D$D$*$M7\$$1 +$蠽$=hC.D$D$$p,&$$zhCo$ D$Y$@ @HPD$\$$@,H7$覻= v$D$D$\$$A,+H$,@ 0@PH$,@ @ H$t&&1hC L$D 8(D 8(\T$ "6D$$á8.&D$$E $D$D$*A6$,0 v0hCT$D$D$/$l$$T$$D$!D$$D$tZ0hCv'UWV1S,D$@D$$$WD$ D$*$3\$$Í88=Z̜-#@tD$ D$*$4МOwGGtD$ D$*$4G$1>DT$D$N D$*$/3\$ʼn$T$D=>7Dol$DE=4$D$ D$* 4,[^_]Í~]~Q4$T$T$D5t[T$,D$D$1$T$,t$\$ l$T$|$$D$$@뜽뜀 Rn'UWVSlƄuP t t Gƃu؄T$55NT$ʀ_D$$ HD$4L$D$uTD$?D$4vHu_t[KD$Lܝt)T$L$D$D$0$L$T$T$L$$D$D$0$:\$$L$T$-5D$ L$T$$D$(FܝT$, D$4F T$0FD$8FT$<FD$@T$HFT$D=L$T$$D$(5T$,D$-T$0ܝD$4 T$|$$<|$$--=F|$L]FFFFGFGFGF GD$L$$豛L$ƅtFtO<tE|$L]D$$F获$|$L]D$XD$\L$4$kL$11҅t ;\$5F|$\t$XFFF5F=F&D$(@L$8\$<vQD$D$0$m@>>mҳ??^ىTt&>w|$8D$<D$8D$(xfX11fL$0\$4t$0=-^|$8l$<뾡ܝ$D$D$0$L$=-}!fp2f;-QD$XD$ D$L$D$D$$L$F L$YXqr؉L$L$RF^D$($|$~= - N- vt~= - N- D$D$D$$É$X D$D$0$h|$&u&-)|$||$*u*- -D$(+t|$(t 8T$|$$-مt%upਫ਼_D$D$1$t&|-U2D$D$0$3L$|$$1:"L$8=- -tevωt7t$4D$< t < t< D$tWGt|$׉t$41D$4Dxu$<_t1Ҁ|$-‰׃u|$(ft$40D$D$0$@HD$D$1$t$47\t& =,u&C=,t ÐWVSt)u Bt< t< t< uуu11[^_Ít&:t=9|2 D$ D$0T$$D$D$0$< PH XPP PܝP P FP$FP(FP,FP0FP4FP84$D$D$0$:t$$FFܝFFGFFFF GFFGGơׅ>ܝtD$D$0$~tD$D$0$]BJZ BB BBܝB B$FB(FB,FB0FB4FB8FD$$D$0 [^_D$D$2$gD$D$61$FD$D$1$%UWVSLD$D$!t ~tq-tT+u~I!u9 1ƋD$L$D$L[^ω_]Ít&\$T$\$냍t&^Ɖ묍t&CD(C@5=t l ܝT$4FD$uf)d19ֹ |9wv11ۉωދ t4+t1 v9t)Š3u[^Ðt&1auؐŤ3tۃ+u}1҃-ƒH*w$2-ut$룃+u6뗋tH끉$Z[^Ã-h"^-uK&V1SD$.D$X4$ca1ҍt&դ3t 0 ՠ3uދ ut0s0[^Ð0cۍ&PT\DHL8<@,04 $(0G8GX4G,G Íva1GGŠ3uDoD;DÐlH1ʋ9uÐt&UWVSÃ=G $~D-l1t&Lt8q 9t*9Yut y tyu$t$ [^_]Ð9u[^_]Ít&VS˃t5dt9t$ t& 9t"9Auty t yu名t&[^Ét$ L$ #t1ɃtދlH[^flSX&<t9tB~[Íl Q9txu@ 9uA  G=0ZtD$$!G0ZÍvUWVSÁl$$,$_,$D$<$Gl$|$$.x"lvt9p t4u|$D$$[^_]fՍ G9t[GG lt tz t.R tHt GuGG Í G9u. lR uu̡GlR 뛉Љo& GtGtltz t^Gtltz tAMu0G9uGG Ít& $ "}tÐTt (uD$$¸h4ҺE&'Spu!؋D$D$r4$utpx[Í'VSÃ5p1t9^u 9Ztыu1[^Ív9։t{;tt`xxu7tpD$D$r4$[^Ãuءpt̍& t똋p덋UW1VSÃS3tD$=D$r4$D$>D$r4$9u[^_]Ít&u$Xt= tÍXt= tIııu#ıtݔÍ&$苗ΐ$|xt$ l= u$vD$$衿ƒ<~ f1΀EÍUWVS,lx9tfv9u95-|>1؋@|D9uDt$,$},[^_]Ðt&D$T$D$ E D$r4$T$5ţlxslS tX1ڐt&JE9u[ËH‹9uB[Ít&'SÃ($bt([ÐD$D$4$\$D$@D$$D$ X([Í&'UWVSӃ\D$(L$(L$8T$(+9Gt9G- E‰D$D$(D$4D$4$D$ 製lL$8xuŋE9uT$(D$44!ЅۈD$?4ED$4T$@D$(D$4l$,|$(&t$$ @|$?|$(D$D$4$s~L$8l@ ЇtT$,B<D$D$4$-L$,L$0ţ9t|$(L$0G 9A tkt$,$}t}t }0D$T$ D$4D$4$L$0A<t=t Jf9Ct t$$腺9\$,|$(t1Xt t$$ 9RT$4D$4$T$||$(ACD$4D$4$D$ Rt&|$@uAh\f|$(-t$ D$D$$%eKL$8¡lx $L$L$$1L$$t $AD$D$4$D$$1T$$D$4$T$ D$腺? T$8\$0l@ T$0B<ƒЇD$ D$4$脼l$D$D$D$ $-6t&t$ D$D$$54$螼lL$8H\[^_]Íţt&@kT$$t$ D$D$$4芿lL$8T$$2t&,$T$$贽T$$)t&D$4v.W9QUOfD$D$4$,D$4$D$舸vD$D$4$ţl0ۋT$(@Uv$aD$D$4$蕺l$D$D$D$ $T$,-T$0?t&D$D$4$<ţţt&D$D$4$-,$D$躼t&T$(l@@D$e5D$ $D$ "L$,L$0 D$tT$9B t 1 Ðt&D$T$ 1 Í&UW1VSÁt$4$蔵D$4$T$$u$D$t$$ZG~<1&ltt$ l$\$$8u ;5G|1$D$D$$[^_]É'lH1t9u9tЅufÍ&'UWVS\$$舴D$$H$$i$T$\$$N5G1~:=l11 9t!tx u؃9ut&G%9G1ۋ=l X;G}M4t~ uuDG9Pt͉N);-G~N;G|t&$D$D$$a[^_]Í G~1ۋ=lt&;G}4t~ utN؉)DG9Pučt&$D$T$$ٺ[^_]G 9G 뫍vUWVS< l%G\$0$$ZD$$D$$ 4$2t$\$$G1ۅD$(y;G}ml4l<0=D茻D$D$5$莱|$l$ D$D$$ݮ غl<0o 1҉D$(D$(YfD$D$5$D$D$$[i7GGG7G7G7G7G7G7G7G8G8G8G 8G8G8G8GÐt&`Ðt&VSt$$4$U4$D$$=t$\$$)5dD$d\$$t[^Í'd|D$t d`É'|dd`T$uÐtt&kt&'dth$LGY @GuÍv$LG輵uD$D$F5$軮$蓼`tÐt&`qtpEt&-GJ G9]M9uKvu9t69t/9͉1119ʉ=Gt GEG1GG΍GtlT$tHÐVSD$~D$r4$/T$$t$,PT$(@ PT$ GPl4Z &ы9uR[^É'ht-;\Gt%D$$̬hD$$跬ÍvVS G~i1t&9G~Ul4tx uD$@$^lD$0@$C9Gv[^fVSG~q1t&9G~]l4t@uD$@$l0x uD$@$轫9Gt&[^Ív'`a$$$$$ $u+11hƉ$$$Í|$$<$eD$<$%$M\$|$$911҉D$\$$y ,$$$0$ $$(|$ <$ˣD$<$苬$賣\$|$$蟫11҉dt_D$ t$D$`5D$$臤\$D$$O$ $$$(,ÍvD$D$H6$Ħt$$럍 T$D$'D$$YzD$$EzD$$1zÍ'D$$ zD$$yD$$yÍ',`GtSD$$ӤxW1u ,Í&D$D$D$$D$,á$su1,ø뮐\$`Gt$|$tnD$1D$$lx\$t$|$Í tً=Ĝ膡\$ $j5|$D$β봍t&$ˠz1딍D$GBfD$7ƒ1OÐL$<$P$D$T$@$H|C$X$|$pÉ؋$@$<$D$HLÐ۽T$,$$T$JT$D$$4$.T$t$$T$1҉؍$,VD$$,l aitf;-\G,$|$膦l$t$,lz D$t$$芧t&1;-\GfuY{t 9Yt={ u|$C$%C u tAt<$,l 9Yu1t$|$ĥ[t&D$C$ũ믍vtCt9&l$,BBfD$B$E$,lJ WVSd|$ $(D$a D$r4$\$$豤$5fD$$fD$$fD$$HGfD$$fD$$fD$$dfD$$wft$$` et$$P ddN~`1ۍ4$D$z D$r4$t$$茣D$D$5$'9uD$ 5[^_d'UWVSlD$(l$(D$,D$HD$D$@t&=@G1tu 5Gu|$t|$(D$Xt$D$$苢ljtGt8V~ t|$Xt D$,-GL$\ u6;^vuD$X$D$D$X=FF )|$\|$47|$L$@t|$HD$H\@G=Xt D$,l[^_]Ít&D$X$D$D$Xt<tt&G|$iadt&$ s|$(= /#D$D$h6$$_f|$\G|$4G5l1T$LD$$ t$f{8 1J$5螌<$趃藄|GGEu 9@GChD$$:~D$`D$r4$=d$@8X@@ Pdu vы9utDG=G~g1҉؍$tPlx aD$D$7$}|$\$$$t@Gx;Gt$HGD$$GG老,[^_]Ívh\Ght&$5ԊdtQ~NG8t&GE0y$2D$D$@$ր@Ghu5h9\G\h4$D$6|Hhu;\Gt 9PGx$PGLGx|$vLGD$t$${uRw8ftDt&؍+Jh=vhu \Gh8$LG`,[^_]GD$<$v9G,D$$hk=hD$D$5$z|$t$$褈 UWVS,\$ $vD$$$$v$D$\$$~$LG__5G41ۅt#lltt&|uut 9d1tD$/D$r4$ 蝩ǡd9u vы9u(1҅t $G<G ыu @GhdhɉWG \$1D$1ۉ1z  1z 9uɸ\$\$G $ "1n$zD$D$r4$蛨l$${$D GGGl<5GGG=G$@G G=Gl$D$D$$`c|,[^_]ÍG1ۍPE9l u9u@GOkw`S`G-\G$Lyj9u9&D$4$t&|$?G͍s1GEƣGD$G9أG~fD9ul9t.T$L$D$D$r4$اL$T$-lGt Gt Gt G9|9~螰$D$D$$zGu lt5G9;CGD$lD$ #D$r4$l5G9ޣl l9ut&GD$D$r4$ rGңll9uGGGGƒHHщT$Ѓ)Ѓd$uD$$ $5qD$$y$$q$D$\$$xG;D$-lt&D$D$D$r4$[šGGGy=l1ۉ1t&;5Gt;5GD;5G=lDx uáGT$L$GD$ܪL$T$D$G$D$D$$`wG,[^_]Guf5GG$64D$D$r4$ yհ tf3o85XGGDG1ۺ1fWVS|$$ $<$nD$<$w4$nt$|$$v=GGG~B1fx t9=G~+ltu߉<$D$9=GՅt8t$D$$@v[^_Íu͐t&lD$rD$r4$ӢGGGG覬yWVS|$$ $<$mD$<$mv4$mt$|$$u Gt6~4=l1 fJ9tttz t9u萍t&t$D$$(u[^_Í&'WVS\$$$l$D$u4$l\$1ۉt$$t G~&=l1t&t z Ӄ9ut$D$$~t[^_fÐt&Ðt&T$@G@G9tt hÍ'`$LGU$@GÐ&u$TGxD$$[oÍ&TGxD$$뼃`Gt$r$Ít&'D$pG$BÐt&$LGATÍ'D$LGPGPD$tPGLGÍ'D$LG@PGÐ<\$,Ét$0։l$8l$@|$4<@t6<*u:u6{u0tE\$,t$0|$4l$8‰Ћ\$t$|$Í'UW1V1S<\$PeD$,1D$$D$($^D$9|$vEv<;\tzYov! ;to,:909|$wT$,e33<[^_]Í&;39뿐t&D;<\t<`t <$qvfD$$T$($D$D$T$T$$T$ )D$;D$Z@wD$T$D$$T$(@80_v'U1WVS\|$tt$peD$L1D$<D$@_>$E]d$xD$ D$D$$D><tADX1봍&\L$tG1҃`‰T$WVT$xƒ`tJ[]'ƒ"T$$K tD$1fft&&WD$ &D$RPwT$0L$4T$TL$XN{83Pv>M7D$(ut&7D$ t&|7{mD$(7t&l$(1$MT$,2f=I)f\$<ZrOM[D$LL$LD$ D$8\$Pl$L$)D$$PL$PL$L\$P7$t&NMփ|$$%L$,+7D$$@vL$PD$8T$Ll$L$L$L)T$L$ D$$PPJT$L$7D$T$LL$PN|7($t$H<$D$D$HD$ D$HpD&|$$%#to/utL$,+t&^,IZ|$$n\$$ M7D$$rftL$,+w$T$Ht$H$D$HpDvT$8NL$HFvL$PD$8T$Ll$L$4L$L)T$0L$ D$$fN@T$0L$4T$LL$PL$,+fT$,t$<$D$T$,+\$$ L70D$$#=7RD$D$8$_N|$D$:9${Z7&UW1VSKPbD$1T$D$$T$(҉t$ u#T$ $t$ T$ D$T$,$ Pt&'UWVST$\$$L$@D$lT$HT$\D$PD$peD$|144$YMl$@D$L؅D$Dt+D$@8t"xD$LtxD$L,fL$PD$Xt0T$P:t'zD$XtzD$X&T$HD$Tt D$H8$D$ D$(D$4ftYD$ 41҃ ‰T$ Gu5cT$\1T$|e3CČ[^_]Ít&D$(D$4#u~tztL t !L t_GD$ 6t&t&\tu^D$(fF2D$(mt&t $3D$L@D$@8 D$Xt D$P8OD$TKD$H8`'"\$h8T$Dى+D$lT$pt$$D$8D$lD$ D$DT$<)؉D$NGPT$<D$8T$pD$l~D$(\Ut&D$ FP D$(T$,D$lT$pD$(fD$lT$pt$$D$ D$lD$ D$DT$$)؉D$EPD$ T$$D$lT$pD$ D$TT$H4$D$T$LD$T1T$\\++D$T$PT$hu?D$ED$8$uT$\ƋD$hD$:4$|$CD$hT$\&xD$T+xD$T$GD$Tv|($T$h\$hT$<$D$pD$hXT&Bl$tD$tD$xt&4<'t>t:eBft%Ӎ4<'uÐ1҄NBfD$tT$xl$ t$D$8D$DT$<$)؉D$C@wD$8T$T$ J‰ҋt]1D59ʉrD$ MD5L$4T$Le3{\[^_]Ðt&T$DL$HD$<+D$ T$(T$ L$,L$DL$ D$T$$@@T$(L$,T$DL$HT$ <\L$$t1ɀ`T5L$$`tk$Xt"D$0)t$8ND5؃D$ D$ t&D5`D$$ T$((€{X҉\$@T$@$‹L$(D5$t$D5t +D$D$(\5\0uD$@D5D$@;u'uDDfZD5΅TT$ f$D$D$yD$8oD$L$@D$L$<$%0Ct&UWVSl$$$eT$\1D$L<<$D$tt||(uu<\$Dt12858DЍD$DD$T$4$e\$D<T$\e3l[^_]Å(f$-tx|(uqT$L$|$$88i{T$L$tL<\$DtT$IL$IT$DD$J(D$KD$D$/$$-8g-ftT$<|$$z/7D$LT$ D$ D$4|$Ll$PT$)؉D$$8P(|$Ll$PD$|f|$8DuQ<{=<\$D|.(t>1ɉT$D$(^v1҄t&<(u&몹,8T$DD$ D$/$$-8G =='U1WVS1ۃL|$`eD$<1D$,D$0<$:D$D$d4t19\$dkT$t:4tӍ4<'uōv<D$4T$8t$$D$D$T$T$4T$ )؉D$5@wD$T$D$4T$8Tt&ut&@3v~t fD$,T$0t$$D$D$T$T$,T$ )؉D$^5@wD$T$D$,T$0Du9\$d>D$,T$0t$$D$D$T$T$,T$ )؉D$4P D$1T$9\$dD$,T$0 9'UWVS1ۃ\t$p|$xe-l$L1D$<4$|$ D$@f7<$1D$$X7D$D$D$tx9\$t2D$T$Le3D$\[^_]Ðt&D$,$T$D$D$ D$l;T$'"uOt&uOT$$ىo;\$t&,U\D$txD$ :t'"t5D$DD$H|$'1 <tx븸+D$\$D$9\$t;1v. 1뾅u1벐맍l$HD$$|$DT$l$,l$D)؉|$(l$ D$$2Pw|$(l$,|$Dl$H8."0Mt|t&D$<|$D$L$TL$ \$$D$a0ƍ@T$(L$,T$TL$X1< 1<  uL$ T$8 L$ \$$l$;jD$8L$ D$El$$q1!< t < ft< u(<JD$,$quʄ,$L$8|$@D$$D$KD$JD$DD$(D$4L$Dl$\$4$L$ 9ÉD$ u|$Kt  |$ D$ \$4$D$$D$5#L$$L$$u#T$D$D$8$D$$`T$4D$ 9$T$09$LT$(T$(|$(u6|$Jt/T$0C;$T$(t;$D$(\$ 0&D$u< t< t< u(<D$,$puT$0T$4t&D$>ڄxD$,$nuʉڋ\$0|$ dD$$$ \$$ T$$L$0L$(T$4T$0|$JD$ 9$}$;$D$($D< tT$0< T$($ L$$L$$] D$0T$0D$$T$(Rׄ\$0׋\$ l$Ll$8f<tLD$,$smu߉\$ l$L\$0ID$$-D$D$8g\$ l$L\$0|$ \$0a0UWVS,T$@T$D$T$DT$hT$D$1t T$:u|$$l$(wSt&q tBt&D$\$$p!I#t&UWVS<\$PeD$,1;)$D$$D$(x D$ D$8,D$N9D$sU&Љ<t<19w9wT$,e3D$<[^_]fD$$T$(\$$D$)؉T$T$$T$ D$PweD$T$D$$T$(ovF9$mD$ D$8$ MD$@Dt몐t&{!t&'UWVStCÐ{74$SC>uHHD$3D$84$Mu[^_]ÍUWVS1t4 u+ DՃtJtu߉Ճul$hd\;SD$v 4$6D$L$hD$0D$L$$t&T$L$0|$$<moD$ uED$0< t9< t5< t1D$+T$JD$$D$D$fD$ D$8,$pDD$0|$tD$0t $D$T$T$0T$0zT$4L$8$T$(T$L$,L$4L$ )T$D$@w\T$(L$,T$4T$0L$8T$0D$0$D$5{ { 1Ҁ{‰T$ ND$0t&'S\$ t!t&C$C`u[Í&'ST$ D$$L$(*t@t.uAD$ [Tt&uCu^D$ [tL$$D$ [fkD$ [SÉ$9\$ [t&3É$\$ [UWVS1ۃ,T$tN1CT$ثt[*t$$}ۉuͅtËt 4$qËD$D\$D$D$@$$9,[^_]ÍvD$VD$8$D$@>ŋT$wfįT$ t u1tÍ&tD$D$8$=T$$T$f1Í'įÍv'S\$ <t$e-į[Sįt9~&1;}$įuį[Ðt&WVS|$ t$$te1ۅ~"v<u9}<u2f9u9}v$-9[^_Í$[^_.&'UWVS$e$1҅D$0< ؇i-̯5D$< D$T$HG5hT$L/[DG$D$lDGD$4赜[\$45h蹜D$X$]L$TL$@ D$HD$8tKL$8\$HL$vP1ɀ t$‰ ӃuҋD$\$HD$8D$@1D$D$11D$(L$T$,ftC;D$(|C+D$(L$(T$$D$ ;D$L$(D$8L$$;T$$D$D$,D$8D$D$D D$^T$@D$\D$D$$|$\/t&=hD$D$ D$8$2D$ g |$(0 D$ \$$$|$ T$<$|t&D$xD$D$8$3$D$pL$(D$D$l$…T$l)ڍD9|5)t@D$ T$D$ JD$8t$$2T$D$ <D$(\$p\$N;\$lT$9D'$CB$L$xD$ $T$D$|D$D$t\$$D$4T$xL$|D$@T$,T$tL$HL$,T$0*D$$t \ tT$,D$8z(}T$8 T$@T$,L$$L$|$$u!T$,z(4T$,|*T$$ D$PD$8$0L$,D$$*D$$L$,*2L$,t$8fQqut$8z*o* T$0Ѓ D$D$$T$$T$$9T$,t D$D$^D$8$*1D$1҃SD$4L$,T$D$ $T$|$(D$$p|$(e11|$(l$Xʼn\$\ˉt$P|$TD$@T$0 1T$,9 t$$|$$Dt$49t$49D$0T$0\$Ll$8؉ō#|$$;;t$8s;T$,+L$0=l$L$<Ѓ D$$跦uډL$LT$Ht$Pl$X\$\ L$<|$TD$l D$pD$xT$D$D$8$/D$tD$D$8$/D$|D$D$8$p/T$&?1҃[‰T$@D$ T$T$\$$T$ׅD$ $l$T$$D$(\$ptdt&9|7)t@D$ T$D$ fD$8t$$-T$D$ L$ D$p D$ 8D$ Č[^_]Ðyfyf $Dt&$$y=6Ht&z\t&~t&y(B 4v&v?t&?|$$4+D$8Y!P@D$8>v|$$L$4+L$$ʉ|$<|$,l$@l$0\$LӉt$8|$$9\$4=4<$Ѓ D$D5D$赣uT$HL$4|$9<1<~)<\<' <"D tl֍\5zt D$(,$D$ D$8$$l$$T$8$-D$4$$DŽ$DŽ$9H9$~ D$4D$`D$hD$\D$@# T$@x?t - $<}G!t$$U8,t$<}"D$4P:$T!Lt;$D$`D$hD$\D$@-t&}wD$`D$hD$\D$@D$4#! A< T$41RT$8D$8ʈD$p|$puʿ!LuG1tAD$41xu0Ї |$p?t |$p# &#@ T$4t$|} 0< ; S  l$HD$4L$Tl$l$X,$j (l$Ph$l$pmT$P1ŋD$4$d D$@D$ltD$ltL$P19D$l}t $#D$@D$8T$<|$@D$h D$\ D$`q}h%_D$h D$p1\$P$L$4׉D$ D$4$T$P|$ $L$$L$L$TL$L$8$l$D$84$O$!v<! Їu?#@ *t&vD$t~D$`D$hD$\D$@vDBЃt$$_Cfu <O D$\D$p1L$P$L$4׋-D$ D$4$T$P $L$$L$L$Tl$@|$L$D$X(D$81$$DŽ$$|$\1l$hDŽ$D$<D$H\$8݄]<(<)tE~;D$T0H$&t& t&D$4$ddD$41#vt&T$4Bj$D$PD$8|} ۸DD$D$x8$(\$$Lt$8tD$8D$nD$8$\$Ptl$PD$oD$8,$D$4D$pD$8$$e3? [^_]f# fT$,L$0T$,L$0NjD$4?@D$8D$pDG|$8_D$8xЉ< Ї|$8?t |$8#t&l$<1AD$4xD$XtD$TuD$HL$HT$Xٍt&$T$,TT$,$T$,dT$,$@D$PD$8pv<(<)<'<\<"uf tT׍v9||$0l$8\$<D$4D$$D$D$8ƋD$4$L$`T$\)D$\$L$,L$\T$(L$ $虮@NT$(L$,T$\L$`[D$0O`>_:T$$D$dD$h><'=| t뻍vL$hT$d)D$\$L$,L$dT$(L$ $谭@wT$(L$,T$dL$hfufX<^l$0|$0l$8\$w]<=Jt$0ND$X=YPN==<&`~t&\| 6 D$8P$Tu L$8ك@}l$<* LT$$豦T$$-$ ҋ+D$PD$DD$ D$8$\|$`$1ɋ|$D1ݍ&\9\$rt&l$P|$`._t&$'T$<'$$DŽ$DŽ$詥$k4+4$ND$D<'tAt=x  Ս4+<'uf$l$$D$l>D$H$$9D$ D$8 $r$D$HZD$H?$1҅|$Ht$G<$虘HD$$谚D$8Kf$$$$O=p =e L$4t t$4D$0@$$D$$D$4kƅtD$D$8,$f$< $H$|($]t&D$4t t$4D$0t$4DŽ$P14$@EL$8D$$D$ $D$$D$$==l$@t$t @0$$(11>t~L$,l$(+L$(9 D$(T$t$$/D$D$84$$l$(l$0Mu t$0Ƚ~߉FD$XP=>D$<Qt&T$<"1ɉ$$$a$D$H t"} D$q D$8,$1Ƀ|$HD$0D$H@P$D$0@ $$ҡ84D$<$D‰D$耎‰T$$D$!D$8<$bT$$Ћ$e3ļ[^_]Ðt&L$Xu€$l$4$荍t 8~0D$D$84$f$$% $L$$茁L$$D$ D$8 $D$,D ))D$,L$,<$T$$D$ D$8L$%T$$f,$1BT$8,$T$ޒ$0$\&$Zt$<It$0F8 Ї*58<$28E$l$D$$T$$[$$D$P 8 ؇ D$|$褥T$$>ҋD|T$`+T$`T|D$@D$$T$D=D$ID$8$?/dev@/fd/@$L$D$ D$,$(D$F$t ;-T$h脚=v9|ED$D$ D$8$L$hD$£+D$hT$$ $D$T$$į*8h HG\G$T$hL$lhD$$a D$$.D$$L$h h[$l$l-HG-T$D$薠D$PD$BD$8$$o <$|$HD$8 L$0QtHQƀtt$0HV t l$0H U@tH@$tHD$$Ώ&T$$gT$$v$T$$LT$$$ ҋD$PD$DD$ D$8$l$11l$D|$`f9\$rl$P|$`.f$$9W $`v$$$T$P$T$ T$\L$T)؉T$D$D$D T$PL$TD$D$$D$~D$84$Hy&4+-t&$D$D$t$L$L$)T$HL$ D$$E@wT$HL$L4+$$f<$`L$0QtHQƀtt$0HV t l$0H U@tH@D$8SHJfD$8T$$ԖT$$$ ҋD$PD$DD$ D$8$|$`$1ɋ|$D1f\9\$r'& $L$$$L$$v$$$T$P$T$ T$\L$T)؉T$D$諗D$D2T$PL$TD$PD$D$$vT$$菕T$$$ ҋMD$PD$DD$ D$8$|$`$1ɋ|$D1ݐt&\9Lj\$w&$t$(;t$,|?L$,+D$,<$T$$D$,D$  D$8D$T$$NjL$(t$(T7$$<փt$H<+<+Ճl$H/D$D4+D$0 H$$$T$P$T$ T$\L$T)؉T$D$袕D$DdT$PL$T$$D$ D$8$D$PD$DL\71ɺ(ƍ$$DŽ$D$==4$訿],$~Et@t DŽ$$t,L$@$t t$@T$4t t$4u$t#D$,$xƉ,$t&x$jܽ$Q$$$T$P$T$ T$\L$T)؉T$D$D$D T$PL$TD$PD$D$$$$$T$P$T$ T$\L$T)؉T$D$gD$DT$PL$T$$D$ D$8$D$PD$D~1D$D$8$D$D$8<$YD$D$8$D$D$8<$04$sD$ D$8$t$$ƋE@L$$,$D$DrL$$D$D$$$T$P$T$ T$\L$T)؉T$D$D$DT$PL$T$$D$ D$8$TD$PD$D\n1$1Ʌ\$$'>~D$4$D$D$84$,$~D$D$87&D$D$L:$貑t$$֝D$D$8$D$D$8<$E 9uL$$4$zL$$1cl$DD$D$8$D$PD$DvD$DD$ !D$8$D$D#kaFE $!jL$h h[9$ \$`T$D\$$x:9\$Dt L$D $pt$p,$(D$PD$D$8$$L$DL$DL$Pf~|T$$D$C D$8<$D$D D$8$4$}T$$FT$DuFD$ D$8$@D$PD$DL$DL$PL$DL$PD$D$$:$ \$t$$ڜ$D$1D$9$Ў$訜t$D'L$DL$PD$D$9$膎$^4$D$D$8膿,$t$D4$1uT$D.L$DL$PD$D$9$$0t$DCv'V1S$\$0;D$8$D$D$ D$8$艽\$$mT$41D$$D$D$a=tV=tOD$tD$ D$8$Wt#Ft$vF`4$u$[^É$~D$$蠀$[Ɖ^ÍSÃD$ D$$=t =t[!D$ \$1ۉt$t$$|$tj:teH@11$htKt^1ۃÉ$a\$Ɖ$9TD$c D$84$<$W؋t$\$|$Ðt&$t<$a͍VS1ۃ$t$0>4$D$認D$ D$8$Ot$$3T$41$D$D$iËD$tD$ D$8$Gt#Ct$tC`$s$[^Í&'D$ t$1\$t-8t(T$$$T$t$X`$\$t$VSÃ41t|;tw$D$,茌D$ D$8$1\$$1ɉ$D$(D$(MT$(t D$D$ D$8$)D$4[^ S1ۃD$ tK8tFT$$:t#@t$YsC`$wr[ÃD$ t$1\$t-8t(T$$$T$vt$_$讴\$t$ÃD$ =T$$Hu@H1$(tD$ q1fD$ =Pu@1ɉPT$$$Ív'UWVSӃFt$,DD$T=lIT$a\$1$iH|$$kNju݅nD$<$D$:T$t$D$Jf4$`l$(D$"vl$t$T$B@ut&PBuT$G=LtDt>= tZCuۉ֋u=̯D$&T$ }t>l$ fl$D$$D$#D$8$踧T$,l$,UT$ u‹D$,|$tL$, $͡|$|$<$ 9D$-9D$D$D$L$Ї D$6#D$8$蠥D$F$ZD$>#D$8ËF$誦VL$`=uD$t$T$t$D$D$1D$1lL$A$;-̯u뢍t:Cuߋ59f$D$L$2R FD$D$8$1t\$$U t&'1ɋT$$D$ \$t$$x$>tt$ \$t$\1\$t$fD$"fD$fD$S\$ D$6D$\<$~$D$7D$\<f[ÐЯt$@ЯÍt&'ЯtD$ m $D S1҃ 8GtpЯtgD$D$ D$$/tD@t$%D$PD$\<C$誣D$QD$\<$蒣1҃[É'\$8Gt$t$$|$|$ ЯD$D$<$jË@D$kD$\<${4$tD$qD$\<$譡t$$tS|$(ЃB>/tJD$,C\$t$|$Ðt&<$sD$nD$\<$E|$$)tCD$oD$\<$ljC@ЯWVS1ۃ=8Gt$ ЯtyD$D$4$9ta@8@E>.tS4$rD$D$\<$舠.@/@t$$`s$LtL[^_Ív~/u4$rD$D$\<$/t$$s믍&D$D$\<$@?.t;<$3rD$D$\<$؟|$$rÉ[^_ÐD$/<$nt0D$ D$|$$/R/1ۅ<$qD$zVSt$ D$4D$n<$ ;D$9D$n<t=$sC~1f9|[^$@מC@C뿐t&T$1tBÐUWVS,T$@l$DD$T$@B$"T$@D$BOD$&D$T$D$‰T$T$@T$41D$]D$n<$ Ë~<$=pD$aD$n<$|$$p~C1t <$tSՉCF C F6CtfvD$XD$n<$肝ÉD$o&oD$bD$n<$P|$$4pfD$T$D$T$@D$9BT$@BT$BD$,[^_]ÍSL$1tfiؓQ1؄u[Ð&S\$1 t$1i“K1„uD$ @![ÍUWVS,|$DD$HD$L$@11҉u!iޓA1ބYuo!tBu 9t29s uC8uL$@$T$L$sT$uуCTvD$1ۅtGD$D$n<$ʛ,L$@ËE]CKs CG,[^_]Ðt&G1ۅ1ލ'UWVS,l$DL$@U1҉T$1t*ЉiC1{uE!ED$1tVl$1t&tB߉9s uC8ul$$T$rT$uхl$tD$Eؐ,[^_]1T$ߍ,t$ t$4|$$|$0\$l$(D$811ۉu_t&D$D$n<$4.UE@xX @F\$t$ |$$l$(,Íi˓B1˄Jun!냍vD$t$<$,uQv$D0'UWVS,L$@|$DD$@P@1퐍t&ЉT$T$@uHwt&C$D$2D$n<C$UD$3D$n<$=t)3uD$1D$n<C$뤍t&T$@D$D$@9hXT$@B,[^_]Í'S\$ D$@D$n<$讙$D$AD$n<薙[ÐUWVS|$0t$4t,ot%_~1u ft$օy[^_]Ð9o퐐SÃxD$D$د$谊دt,@ @@@@x[Ít&T$P\$@L$tۋh D$ D$4$T$LD$P;l$hد8hl$D$t$$<9د8PT$PT$T$ T$$耄T$;T$Pد8P@ 9D$D$<$\aD$bv&& u4د8x|&T$`PT$hH@P @دT$ 8xT$$螃^|$PSY;|$`B؃D$D$<$`t$$D$@^9ܯ t&l$l$D$$<<8,$D$D$<TČ[^_]ÐT$;T$Lnد8P@ 91ɅiD$D$$ t$eD$D$<,$א2t&$<MČ[^_]ÐxVq|$Lv$ D$f6D$D$<$_D$ S\$ $D$2$[Ð&,($ Ё  Ё AuD$$2$$D$1$D$$=$E$ $1$D$1D$$=Er1$D$]1=EtGD$$"1$D$ 1=EÍt&'VST$(D$ @ =Ё D$$D$ 1ۃ߉T$$$^D$D$<$YL$$L$$9_D$<$3FFCt4$ЃD$ Dt&D$ T$D$ D$CRD$C$aC뙐t&D$<$8 &s t&vt&'SD$ $$HHu t[4[Ð4[ÐÐt&WVS0ȱt 0[^_Ív|$ ID$ DŽ$<$,$$,v <$D$G5Iu獴$|$ f It}$ut$|$$50$C$(Cu{tN;uCtt D$t$$/Iuȱ0[^_Ë|$t$$/$X딍VS ȱuĤ[^Ðt&D$ IDŽ$t$$`+ It$u$uًCD$t$D$C$$ /밐& ltt&Klu |@<D Í&'D$ $D$I+'S1ۃıtııı-JMʀ lt[lu\GD$$MD$D$@$1|rۡ|@<DuVuu1t$t $$t&uؐt&[Ívt$-$ D$1$,mv[ıT$u ıı uf<$D$0$@$4t$$8$D$E‰$D$$($$(|$t$$+$$0$4$8<Ívб$D$HÍt&D$ $)бS̱\$ ̱gb|@<DGD$$w'\$$1[Ðn~iu $S*It&$fD$Pv uG&u[hD$tttt tt t9u랍v ttu܇uxuyt&Í&'$@%D$@D$$h-D$$@+D$$ t-D$@ $D$$YafT$$uD$$%vD$D$C$Q(1v'VS˃=$D$փ =у L$1҅…u1҅ƒ[^Ð$l$ $Ӊ$Ή$D$l$$$T$T$$T$t+9ǹ40Ʌu.$19D$hfD$T$ l$\$$( ȋ$$$$Ð1ɃY͍v1ɃtÃp9ǹ|0Ʌu$19D$h뙍&1뎍t&LD$P\$<Ét$@։|$Dωl$Ht8l$,1ۉl$$YT$T$,D$uV؋t$@\$<|$Dl$HLÍD$D$$hED$ D$4$P41ۃw$Dl$4$,YD$ D$,T$$ufT$$9T$D$s;D$ gt&1[T$$9T$D$C|;D$ 7t&΍T$$9T$D$;D$ t&랍T$D$3T$ 3D$$ vT$D$3T$ 3D$$ vT$$9T$D$;;D$ +p.i.'<|$4|$LL$@\$,T$Ht$0\$Dl$8D$T$<=<>q<t$1ɅHL$1 8 oT$$T$+Rf=Ikc뫐T$ɉ$T$=X+<=6.L$T$8T$$T$+lKg1vfqu|$@1ɋT$؋t$0\$,|$4l$8<ntSouT$؋t$0\$,|$4l$8<T$؋t$0\$,|$4l$8 ^D$(1%= FD$1ۉD$$ &D$(1%=`D$1ۉD$$ t&D$1ۉD$$ D$(1%=D$1ۉD$$v D$019XCfD$1ۉD$$F fD$`19D$XTt&1ۀ:ED$D$T$$%D$(1%= t&D$1ۉD$$ D$419`CfL$=>u#yt!t#=t1-t/Ðt&t$g6S &D8[Í&',t$ 5\$l$(|$$n<<$S<-tT !(T:)\$t$ |$$l$(,Í&uWaoucug:uD8뤍v뚐t&yu:;--}Owof,1:KD$D$D$-X&UWVS, =&9B4!ud~C9 þfzu9)֋:!t߅ty,[^_]À(uW~uQ9ى ;){뜉C9~DT$$ T$uE-t1,[^_]À~u4$ts,[^_],[^_]D$D$JD$/D$D$=D$ 1eD$D$!D$BfSá;}:-t [Ívzauzu1҅1ۅ!ːt&Sá;}:-t [Ívzouzu Ӎ'D$$t Ít&D$$‹t 8[D$ D$ N L$ 9T$ D$D$mD$b1vuL$$A8!uxu|$ &T$ y[D$$xl$ L$ t8]xu|$ ~ZD$ T$$L$ B 8vCT$ D$$PD$D$aD$1]<=uLD$ FD$D$ D$FD$ FD$ D$D$ $H< SD$D$-F$YD$ C\$$D$D$ D$D$HF$$D$D$|F$$D$D$F$$D$}D$D$G$$D$Q[ÐS\$ D$D$GC$}CD$D$G$cC$D$D$GKC[ÍSD$D$ )u\$ L$[&[Í&'t$DÍt&'S1ۃtD$D$ D$$٤tX[Ít&'S1ۃtD$ $tX[ÍWVS |$ t$$<$lD${D$G@$B4$D$|D$G$@t$${CC4$D t uC[^_ÍvD$D$G$ O@<$D$D$G$*@|$$4$TD$D$G$?t$$CC4$D td t_<$5D$D$G$?|$$t$D$$XD$ L[^_C뛍v'St{D$D$ D$$ˣt]@$D$D$GC$O@D$D$G$7@$L{@[Ít3$D$ $$$L!Í'VS@1ۅD$D$G$B> qÅ~?11&t#&H u ;q|̅t$$D$ D$$D$ [^1SD$ $ 1t2Z$D$D$G$=\$$f[ÐUWV1S<|$P<$D$D$GH $L$:=L$D$D$G $D$=D$ D$$D$D$$L$EL$(f1ɉl$D$U< < <\<"tD<'t@T$u D$$GMtzfڄtdt1vtN\t@8u<t? TP%\$믍&D$랍<ul$99D$$5)։D$D9D$(7L$(R2f9}D$L$(D$ D$GL$$><D$l$l$l$t$,$ D50T$D$L$ 0< < \$,"f'tK7Մto< tk< D$$GMLM\"uv7t&<\t8u:u7:u͋\$,Չ)u1Ҁ}t ,7L$D$$T$T$L$$T$D$$D$\$KL$1 L$ D$$Dр8u D$$T$$i@$D$R D$D$$B L$T$D$ D9D$(BˋL$(2v9}D$T$L$(D$ ,D$GL$$B:T$D$L$D$D$ T$L$$~ D$T$T$\$D< t< D$ t&D$$ESD$$D$D$G$W:D$<[^_]Ív7:7t&TT$ T$ҋDPD$;vD$$ )ډT$T9T$(D$ ~vD$D$,T$L$D$D$ T$L$$~D$\$,D$ t& L$D$1ҍ,L$ L$ˉL$,L$(2 &9э~D$L$(D$ ;D$GL$$c8D$tt$0[^_]t&1[^_]Ít&UWVS\$4l$0t*11Ct$|$,$D$ /uۃ[^_]É'S1\$ t\$$[ÍUWVS,l$@E 1҅tt1$‹EX 9tTvs1t74$T$D$D$G$()t$$ T$[ 9]u:,[^_]1fUW1VSLT$`e L$<1Ʌ҉T$'B D$PD$G$(T$(BH 9ȉL$L$D$&1D$ D$QT$$qL$‹AtT$$T$Ņҹt):t$z tz t$T$HT$H1t2}t,}t$}t,$T$L$L$T$t&D927[7T$T$$T$1t:tztzt $7]D7=t87l$$G1}t}t}t,$w&ƋT$JT$9J t7 tD$hD$G,$;(T$L$R 9QT$kn9|))؃D<$D$ jD$GD$E'NjD$d7)/uLT$Wt@G~01ft&C$Cu9wԃ[^_Ã1[^_UWVS,|$@D$vT$@rgD$D$H$T$@(ZD$D$D$t&T$@T$,vE$M%uE1t $1Džt&>t!~ t~ t4$yP1t*?t%tt<$T$IT$t&DD$9pD$T$[ЉT$t$$1T$t%>t ~t~t4$T$t&‹D$]D=t<ЉT$|$$h1T$?ttt <$T$‹D$ 9uT$ttD$D$H4$^tD$D$H<$BmoT$@D$D$9BAt$|$9|/)؃DD$D$D$ D$H$7D$L$DD$8)0uQD$,[^_]Ív9}D$D$ D$H\$$D$aE$$vD$D$HËD$$X\$D$,[^_]Ð&D$1t&UWV1ST$ D$;D$`|$|$({KL$T) yD$ 1|$"t|$t|$`HD$t|$|/{|$'D$|$T$ t&D$t&D${_}uRt$ tJl$ ػo T$4t$4|$8T$ |$`}ƒ,t|$u1.u/މuD$|(}y|$nD$(D$ \D$$L$4t$4|$8L$ )D$\$$޼Pt$4|$8D$fT$|*(L$0l$0L$$D$Zzl$0D$,D$H$[.D$ v|$T/   lL$T) f v m}5_& t&'UWVS$e$1DŽ$DŽ$<$rDŽ$ƍ$${t8$$$}$u $f$D$D$H$|$ŋ$,$D$襹$DD$D$H$m{D$,(@t#$e3D$,^ ļ[^_]Ë$$$}$p$\$<$D$$1DŽ$DŽ$DŽ$)ىL$@ƉL$8vtZ\,^$ ʉ$uD$/4$V)\$D$4$L$@4$L$D$TCD$~D$PD$T8PD$P8C$D$D$T$S D$HD$<D$PDŽ$AD$0u!-t +uT$PBDAb$D$D$PD$ D$ $@$ɉL$0T$DʉD$\8 a<. D$X1;L$<W |$HL D |$<D$8$$D$@)؃T$`L$d~2L$T0DˉL$@EL$<L$<$D$L D$6ID$"D$+D$D$W D$6ID$t$lj$螗D$D$,$D$芗$D$[ D$6I<[^_]át T$,$Ѕubl3tD$D$,$$D$t D$6IfD$,D$u D$6I$Hv$D$n D$6I(\$,',L$4t$ t$0\$|$$ɉl$(t9J \$t$ |$$l$(,ÍtD$ D$6I$ 9t!tD$" D$6I$b tD$# D$6I$AD$4$1|҉É$D$) D$6I$\$$袕$D$+ D$6Iō@$\$ǣ $e/*D/9tD$4 D$6I$ $S^=ltG1vcD$1 D$6I$\$$ 1f1A'UWVS,L$D\$@ɉL$t!9tD$D$6I$tD$D$6I$1$x+5$_I|1Ҁ8o4t"D$D$6I$5$%;~ $D$D$6I$\$$莓ƣl5t t4$賒tD$-D$6I$54$zD$/D$6I$t$$-&ض$[ض=lE = x̳t 1=Ȼ t{1ҹ ̳uG9D$D$6I$̳̳$ont;~5l,[^_]f$8v*$8D$?D$6I$ݾ\$$$ƣ=lt t $<oGȳ̳ijгtD$OD$6I$苿UгԳtD$UD$6I$`Գr=̳ts5V$D$D$6I$蠽\$DD$@,[^_]|t&1̳@P9DP4\$D$4&;|$=̳ZntFtۡt$ V8u‰D$L$$躓u]=̳$"D$"t&1҉t&5D$҉4$D$wJ1ۅÀ?~w4$貎D$D$6I$Wt$$;ƅt#ۉ$GZhHD$FD$6I4$JD$GD$6I$,T$$(.$rD$/$裊tp-4$D$D$$P4$茍D$,D$6I$1t$$胐1ۅÀ?~V&#jD$?D$6I$,[^_]Ð:1$q[ 1ij12ȳ<"D$ȳ$t~!.tD$D$6I$<$D$D$s<$D$D$6It&5̳f(vD$N 4$>({(~t&,,܆1?$(UWVS<e$,1D$b$րD$$,l$,T$D$D$,$D$SD$,1ۄuӍDt< t< t< ft< t<#tt&tt}I  T,Du xP@t< uЍP@uщC< tމ &     t t tʍJRt t݃0< D,w,< t < t< t< tD< uuD< t< t< t< ft<#fyDt< 9t)ꍄ$,t$T$D$ $W}t|Ƅ4,r9x<$, !%tDJD+T$D$D$6I$蝯$,T$$z5txD,t&<  < <  P ȃ))¡x|T$$蠎trxD$$血$,e3u<[^_]Éc t&$,7txtÍt&$Id7IDː&UWVS<5dD$T\$P dtD$D$6I$r1dh@lv;\$,T$,1$!¡t~~11t$1ۉ։L$ &t&xT$,8 ;t}7,uӋD$ 9xT$(;t|Ʌt$t5dpTp1ۋtV$jD$D$6I$5páldD$h؉$5p<[^_]fL$ D$L$ L$$2D$%t$D$$Xv&1n&fhG뻍vt$耋 t1~xt&9u5dp1 t&VSD$$t$ \`1ۋti$}D$D$6I$茫áP T\5`؋\$T$<~5`[^ÍLtD$D$6I$W11P$T;{$%}D$D$6I$ʪ\$$}$ãL|X\t$詊L$;C`\&5`\$D$F}؉5`[^Ðt&;{P:ZP*&5`\C{D$C$|$'|f}뉍&1$JF JtD$ I 91Ív$$$$$+D$$,$襺D$ D$l$$%y5t,$D$8ED$ D$6I,$A;(?.u $I<$D$D$'`T$D$ D$6I$D$,$qD$-,$z|/zT$8F D$ D$6I<$茩D$D$ D$6I,$n$$$$ĜÐ,$@zD$ D$6I$l$$zD$D$D$${<$vM8UtdD$ D$6I,$ĨD$D$ D$6I$訨<$;Z|$,$<1҅‰%D$,$넋D$<$D$vD$$4yo@D$D$T$D$ D$6I$RT$D$/D2t&D$`,$طS,$xD$,$D$A/ &uD$ D$6I,$ fD$D$ D$6I$WD$ D$6I,$?D$ D$6I$,$谌q,$D$D$ D$6IT$D$$nT$ՉD$L$ ƅvUWVS,\$Ht$@|$D<"<'1D$>~D$4$Kb<$迌9tD$g D$6I<$$wD$u D$6IǍ@$褤\$Ɖ$wtD>$D${ D$6I賥,[^_]ÐD$ 4$蘵;"WD$!<$Y%f|$<$=vD$ D$6ID$D$t$t*<\uL\GFtGx@uۍv$D$n D$6Iͤ\$t&D$Ļ$謴t\9tvf<$֌R&4Gt'dtfD$&D$搀;~u$Xu\jnD$!4$tbt&S(D$_D$D$D$$-at<8t7$tD$D$6I$O\$$3u$(1[Ít&UWVSÃ|=xT$$|$$)tD$jD$6I$Ρ$\$D$ ID$T$D$Ɖ$Mx$I!]D$,8oȆtЍ\$8$FIcE‰4$D$D$v$LĞt T$,$С8=xXTO|[^_]Ðt&38$$h3$$rD$zD$6I$茠$T$$isfxn1Ҁx‰T$,t&D$T$D$Mt$D$$t$ \$D$4$衮9t;$CrD$ D$6I$t$\$$\$D$ r\$t$Ít&<Ի=tp \$,Іt$05|$4=l$8-лԻq лf І0teD$DT$D$D$@$e,T$-лl$8=|$45t$0І\$,0tp Ի<Ívt 돍UWVS,D$DT$@T$0t -D452D$81ǍG4u|$L$T$$#EtLtFHXƍt&DJ9@ՉʋރH KuD$" D$6I<$ l$|$q0L$ $ 8o<5@&4S4<D$8T$$ tuNj$|oD$B D$6I$!\$DD$@,[^_]ot& DD$@$o|-HU@,1[^_]áHD$ D$D$@$i@$|@DH70D$=t t \$t$5л|$=ػлػq f t5$ )2=ػ|$5лt$\$Í&$?1f\$t$5л|$=ػ$ػл1=ػ|$5лt$\$Ðt&L ?딍t&L *넍t&N ?qd ?ab ?Q` ?A<ػ\$,Ļt$05|$4=l$8-лT$$ػ| лf ĻI0T$-лl$8=|$45t$0Ļ\$,ػ<Ít&'?FS=^u |؆$0v ؆} ML C؆[Ð&,t$$5T;5X\$ \$4|$(|$0}80 ~^D$B$Tt$5TD$8$.t$$StWD$ D$6I4$觚*=\ftV\$4t$$D$0\$ |$(,4|띍t& FD0< uN5T/D$\<$$D$D$D$D$\$ t$$|$(,< tD$E$p5T뒺L *럍&\$ L ?t$$|$(,f$ x N tt&$@x ad Tt&$`x Ab 4t&$x !` t&$x 'H$LTl$ D$wnl$*h1Ív'SD$$$D$H* 2t;} 9}T,JTpy 1[Ã,JxD$)‰$',JT1fSltD$tD$ D$$5j8D$D$$jt;8ttD$D$6I$萗l$ D$m[钁fSÃ8$D$ nXD$ D$D$T$T$D$PXT$D$ D$D$$[ WVS`eD$\1^ @91&<u;LuTD$t\$׍@l$ D$iD$J D$4$hl$\e81D$$ID$D$e D$6I<$薑9tZ1;X}8T< u1\$t$ |$$l$(,Ðt&< tD$$ˍX1Tf멍t&D$[ D$6I$輏=f\$T|$=Xt$^D$D$6I4$趐9tZ;X}8T< u\$t$|$Í&< tD$$\$t$|$áX\$t$|$TÍ&'8\$t$t=$]QD$ D$6I$t1\$t$f\$t$f8$Qt 1Ðf 8Ct1 Ít&[ fD$$\$Tt$5XD$D$ $u u0TD$ $n 1҉Ћ\$t$ÍX)ƍ&'UWVS<=@;|&(f@ :ĻÍt&$ "@'@><@=;|&f@ (:@ĻÍ'WVS =J\$0tlJ&J5Ļu;5D$@4$Q…t,t( [^_Í&J,f4$T$|UD$PD$6ID$ T$҉Ļt&<@tBuĻD$dD$6I$ Ļ [^_Ðt&8 [^_Í&tdD$DD$6I$耂 "@'@><@=;|&f@ (:@Ļ@ĻD$C$1USt&D$FD$6I$ "@'><=@;|&(f@ :Ļ&S(t ([Í$= )JD$D$ $.JHpl-D$D$0 $@J-D$D$` $TJ-D$D$ $`J-D$D$ $sJm-D$D$ $JQ-D$D$P $J5-D$D$ $J-D$D$ $J,D$D$G$J,D$D$y $J,D$D$x $J,D$D$0p $K,D$D$6 $'Kq,D$D$x $u |E${2v=t''uw8D$t$$nu5LT$(l$t$<$T$ T$hT$L[^_]ËT$h8D$T$$tt&D$0[ <$PL[^_]Ã>x<o\$$ [8<`A?` T$hD$$T$< 3+o9tD$ID$6I$t81t&<t)X$D$ D$vI\$89}ыD$h$\$,D$ D$vID$8 | t tL$$\$D$ D$L$p\$D$8$L$$;L$,?D$<tD$UD$6I$sD$<$D$gD$C <$JT$<u ̻ y< &;L$,gL$$D$$"L$$GT$,D$&Bã-س:T$:tysu뾍^FtƉ:uT$l$\$$2Gu։$BD$=D$6I$Kp\$DD$@,[^_]'C&T$l$D$$Fkk<,1[^_]ÐVSD$$\$ ugtD$TD$6I$q$BD$UD$6I$o\$$B$AA3Cãtht# 58u؉D$L$4$Fuċ$AD$gD$6I$'o\$$D$ [^Bt&KG1[^ÍvUWVS<\$Pc8t$,1ҹ4$ʼnD$D$,T$$D$T$<:ut&<:tu<:uj1Ƀ؉4$螦xHD$D$,$D$A|$$T$ D$s!l$D${ <$#1Ƀ<[^_]D$D$L$>\$$t&V1SEtD$D$ $ZD$| Ɖ$D$bD$6I4$ntt PH [^ÃD$ 'uʉL$$Í1ɀ"tL$$ՠÐT$11Ʌufщ‹ uËT$1tuÐt&S\$D$ ۉu &ыu[ÐUWVS|$4t$0l$8tK_t&8tI߃St)tD$ t$$u0߃Su׸[^_]Í&T$4$DuG[^_]Í'SD$$T$ uLt&XtA9Pu$!>D$XD$M$k\$$D$ [>t&1[É'UWVS|$4t$0l$8tb18tA߅t'tD$ t$$u*߅uك[^_]ÐD$4$Cu[^_]Í\$\$(|$|$$t$D$D$M)C$j|$ \$|$Ɖ$8\$t$|$U1W1V1S1ۃLT$`T$(T$dT$4T$hT$,T$lT$8T$4$<\)E9|Őt&9}<$D$ D$M\$hfD$tD$L)D$9} T$H,$T$:l$ht&9}<$D$ D$M\$&hfF;D$DMvE,[^_]fzD$D$zD$D$$l9D$D$&T$H$uT$HD$\$4 T$H$0$D$9D$9|&f9}<$D$ D$M\$6gNjD$,$D$9D$l$D$D$M$g'VSD$L$ t$xt&t< tD[^Ít& uu׻D[^f uσu␋D$T$D$T$ 8VS P~J 71ۉ& L 9 P~"Xuu$ L9 Pރ[^f\$$Lvt΋ L߉ L롍SD$$7ãt4$e7D$ID$M$ e\$$7D$M$4$:[Ít&S$-X$-t$"-x$.-d$9-P$`-D$$Z5)t&+8"D$$*5 t&t8u)D$ $3t8ut8DƒfÍ&8D$$41҅$-q$D$4$-U$D$e4$"-9$D$I4$.-$D$-4$9-$D$4|ЃÐD0&S\$$tD$D$M$GbtS$;3D$D$M$`\$$3t8u [1[ÐD$ D$M$`뻍v',\$ \$0t$$t$4|$(,ǀ;TtOCD$D$N$T-\$$:vt 8$.-$D$/t&t8$-U$D$e/D$D$v$h)$D$D$N$,t$1|$ \$$95t&t8$"-$D$.3$(D$D$DN$ ,|$\$$\9D&$-$-D$1$-$-D$eÐ,\$\$0l$(l$8t$ |$$t;u$1tE\$t$ |$$l$(,Ð$"-tptiCtTP߅t 8D$4D$D$M$Z|$Ɖ$-uKzxt&uD$4D$xD$M$Z\$Ɖ$-4D$4E(& NIfD$\$$t*9É;$,D$D$MÍ@$%Z|$Ɖ$-]&UWVSt$0\$4t>0&׃t$Bt<\t<"ty< Eω׃u܃ $D$D$MY"PȅuFt&"B[^_]Í&\t"u\tFȅt u\BnB"B B"tD$D$M$X"Po UWVSL\$h|$dt$`D$)D$M$X1҉|$819~)f9ډT$8u)DtDucT$,l$D$ٓ$&T$,\$pt/D$pL[^_]Ív}T$pt T$pL[^_]fD$<NT$,D$<D$,$|$<ƸDiL$lt$\$D$NL$ $D$z%D$D$M4$XT$,>D$8T$,$D$,$D$D$MXL$p݅8D$8T$pL[^_]ÐT$$qt8tÍt&$D$"D$N(XD$#D$N$Vf.ÍvVS1ۃt$D$D$$t$Z$xGD$ %=@t5D$4$t*D$4$_*ڃ@Dڃt[^Í&VSÃ$o1tAu t4t/$L(D$D$N$U\$$([^ <\$,Ét$0։|$4ωl$8Հ:~ u }.X\$D$,$4É$9t D$D$N,$D$VT$SuS@ud tite tuXtD$D$N$@V؋t$0\$,|$4l$8uC<$s%D$8D$N$S|$$%Ĝ[^_]Ðt&l$,l$D$/$ 1<DŽ$v3ı$pL$‰,$D$KD$N$D$ST$tZ$T$u2+T$D$WD$N$YST$D$QD$N$8S$</D$ $6D$dD$N$R1f$KT$Ĝ[^_]‰ÍVSÃD$$<t @t8u;$K#D$D$N$P\$$#[^͉[^X&D$ $Ðt&D$$RfD$@Bf$,D$ D$D$ $$H 1ÍUWVSÃ, T$QM‰D$D$$"D$D$$_"$D$ D$D$ 4$CH lj$ۉ5$D$ t$D$$D$T$H L$H u~ ~ L$(H 8|$ t ~uz~u1@ tD$D$4$p!,[^_]ÍD$$D$X T$8H t4$1D$D$!,[^_]Ít&5$D$ t$D$$H "D$ D$$ 'D$D$O$=$(уT$L$$&t@%@Ѓøt&VSD$ $ЇtHD$$q Ɖ$ 4$1Dt$tD[^Ðt&#$⍶UWVSÁ,s{eE1SC DFvNtItDv1Dž&Ue3me[^_]f$4P$-8-u x/$C{"C{$ D$ D$ <$$D$}D$D$O$'Iq  A‰A yC $CDžC jD$D$<$I 0<$vDžAC 9D$D$<$6} nfCt Їt Q $Їt   t5 C;2 )  S $D$D$0J8 Dž $D$#D$O $FmCC tC;)D$D$<$<$C;t|$$ TK~%tD$D$<$t&;tF$v  ` DžxD$$WDžEt&[.DžED$D$$OQ   BD$ $}&=$# D$߅$ B$ ׉fD$\$$D$ $V ?KG$9t$ D$1뇍&{$D$ D$D$ <$ t&<$V<$&<$<$DžEЋ{D$$Džt&EЉ9UԺDUЉ$ \x WD$ D$<$D$.$<$iED$D$$M $E$6H ED$D$O$AC ; D$D$<$yPC $E'&<$CX;t|$$ |$$~%tD$D$<$t&;Dž$&<$8C|$$\SJD$D$$T~C ((u ( Dž$#$b$TS $D$ D$ y" 8D$#D$O $@?pv T$T$D$A$A$)čD$q6$t$qAC^B<$8w&BfB Bt& D$ D$<$T$] $L$‰D$$ 9DЋv$DE$D$ED$O$~= DžKD$ D$$]FD$D$O$ $$DžDCl<$J$<Y&sD$D$<$o9f@{ $D$T$;fD$ D$$ NjD$D$O$ $nvE$D$D$O};D$D$O$R;Dž3v Dž vrvC$ Dž@$'8U؉T$$}؅t&vvD$ D$$"D$D$O$' $Ff $D$.Dž1tJ9tEyDžt3yDžt! $ &D$L$$9ɋt$D$DD$O $Z99ҸD{D$ D$<$T$Af|$$D$ D$<$D$|& txL$D$$ %= $D$D$l"pT$D$$ uIE%=t: %=t(T$ L$ $T$[$? D$#D$O $v7DžW&y$ y&D$D$O $ 7DžC<$ $ t&\D$D$<$ |$$MC4$ k$$$6$$^$6DЋ$$/Džz<$"D$D$L$oDž<$$E$"ED$D$O$4$iF$:D$&,\$\$0t$ t$4|$$l$(CC` uz{@$T$GʼnǍF4$|$$$_D$vtD$D$O,$3\$t$ |$$l$(,Ã{K| ЇCt$všЇtuCx?C85$P1$DD$vD$O$1\$$C1OK@ C18t&D$D$0O$||$$vD$D$TO΍ $D$D$|O$%\$$)0<9uݍXT$0B1 [^_]Í&'\$\$ t$$G$G F1st$ \$Ív'\$\$ t$$><$ F1st$ \$Í'\$\$ t$$un$d F1st$ \$Í'\$t$t$ $%>1҅t $ ‰S1S^\$0t$f\$t$t$ |$~$8@<$ |$C1^\$ t$ÍUWVS,T1ۅ,uD$C1T$$BT$\$ŋ]81t7<$T$D$lD$P$L+|$$0T$;t$u\$T$T$@YYJ,[^_]Ít&T$@1B,[^_]$D$먍v$Pa$PU$PI$P=$P1$P%D$ t E UWVSӃ<|$TeT$,1D$D$$P<D$t |$ft$ D$ t$$D$$PD$et |$FȻD$ t$T$$$PD$$t |$pD$ t$T$$$PD$t/|$t(HED$,e3<[^_]Ðu$P`PtPD$l$$]`D$PD$ t$$T$$PD$5fH&H&H&$ rv$PGv'UWVSӃ,t$@$D$$G$D$$E$D$mD$$T$É~@9t1?u$/D$$o,[^_]ÍvGtΉ$qЍ&$[$D$$EƉ$D$$Éjt&VS(\$$t$ uBtD$D$P$.(y@t5t,t4$T$У(\$$D$ [^4$D$D$P$&t$$q(벍v'UWVS,$tP&J*4$D$,$<&$K4$D$,$&8KL4$D$,$&`Ke4$D$^,$J&tK$4$D$&,$\ &K4$D$,$$&Kl4$D$,$&K4a4$D$~,$F&K 4$D$F,$|&LD$$ ,$B'UWVS$B$$i D$8tm$$D$ËB $F=l t$CCD$8\$$g$D$8$Z;$$D$D$D$D$ D$D$Ze$r$D$DD$D$0$$$D$0貨1҅D$D$8Ĝ[^_]ËD$8$3D$8D$8Ĝ[^_]Z$%D$@$D$D$P,$A $%[1D$D$Q$\$$loG$D$HD$LA &L\$<Ӊt$@t$X|$D|$`l$HL$,$9t$E/,$I-\$T$(t$ǣD$T<$D$D$PD$ D$,D$T$(-ËD$\t1t T$\t  W<$}؋t$@\$<|$Dl$HLÍ&1ߍD$T$ttfD$T$tL$ u !PÍ PÍt&uÍ'UWV!SL\$`|$4D$4l$0-`"fˀ 5dD$ Àf %1@jtF$諶6uD$ D$ ${cwvvD$D$e:$L$&j<$踱$XD$D$;$|$1$D$DtJTD$D$;$Һb:DуT$ bu}t $/Z,$1pvL$ KT$ $RD$T$$D$ &!$|À$g $$$$,$芿$.D$D$:$`\$l$$@vT$$T$$D$$ȬnD$D$%;$L$$L$$UfL$(!T$($`t+%<$1D$跣T$,$膇D$fD$:$L$(L$$_D$D$:$N|$$-tD$:$$|$$D$BD$D$:$L$ L$$Du Їt ÍD$D$;$$|DÍv,\$$\$0t$(1҅uЋ\$$t$(,ÍD$D$D$$ D$T$~;5D9|9w@1҉Ћ\$$t$(,É@1t&|wD$D$<$D$C$D@J,\$$\$0t$(1҅uЋ\$$t$(,ÍD$D$D$$PD$T$~;5D9|9w<1҉Ћ\$$t$(,É<1t&|wD$D$<$D$C$D@JD$ \$t$$y¸t\$t$fdt.C04$$t%5\$t$T$ t&1붍t&4$8룐Lt$@1\$<|$Dl$H$_xt@um$1Gxt@uM$1xt@txto t tK u)Ћ\$w4$D$D$0<u ЇucD։$TZ D$D$0<4$R\$,t$0|$4l$8<Ðt=$D$u |$~t |$tD$D$0<4$1뚍&D$$谸$D$諻(lj$t[/1D$D$D$0<4$kD$f4$Xv,$1D$D$0<6TZtz$D$ D$0< yD$D$0<4$1$_<tD$D$0<$T4$,t$ \$ÉEÉ|$$=El$(1D$D$$ "tK@fu@f1u9Et/t+Dމ\$D$$h<ފEt&\$t$ |$$l$(,Ív',\$t$ |$$ljl$($Tۉ-E$ "5vD$$"ljD$Kt @Eu -EuMDt;TtD$D$0<$'\$t$ |$$l$(,Ð@t|$D$$e<‰E뉍$D$" LE딍v$TZ\t&L\$< t$@t$P|$Dl$HuwL(1D$m<4$-tePt(et3Lt& \$;t9D$D$<$\$ D$D$$dD$@$D$ԱD$ED$D$ $#$&[ÐT$ uD$D$mD$u$]踂$,&D$ D$$"1҃t ЃÍ'D$D$$T$ T$$Í'D$D$<$豰T$ T$$Í'D$D$=$qT$ T$$QÍ'D$D$$1T$ T$$Í'D$D$=$T$ T$$Í'D$D$$"$豯T$ T$$Í'S\$ ;0t;D$D$0$g\$D$$$_C[ÍcSʋDHu#xuD$D$A=$D$D$,=$fD$D$>$ѮT$ T$$Í'D$D$8>$葮T$ T$$qÍ'D$D$50$QT$ T$$1Í't$t$ \$\$$tAtuD$D$T=$\$t$$\$t$Ðt&t\D$D$X=$踭t$\$$\$D$ D$D$M$脭ht&D$D$M$\널&D$D$h=$1T$ T$$Í'S\$ D$t,D$x=$\$$[Í&D$|=$輬D$ [ S\$ D$t,D$=$x\$$\[Í&D$=$LD$ [/ D$D$=$T$ T$$Í'S$荨D$D$=$迫\$$[Í&'SL$ uD迧$5D$D$>$g\$$K[Í{$D$D$\>뺍'S\$ $苫$螲t$$$膭[ D$$D$D$D$ D$ $yÍ'`Ív'`Ðt&Мu=X0 t `Ív `à `UWVS,D$Dt$@`t,D$D$D$=$ D$`t_F8<$D$D$=$|$$q`6 t!pf11 u߄uu,[^_]áȜ$4$賫ңȜt؃,[^_]VSD$(\$ t$$t @Sҋt:-txtTD$$u)C=D‰$t:uot&z$[^Í=$uƃ1[^Í&zuz-xt Sh[^y$zt&S(\$0ttCt8-tFt:T$T$$u^C=D‰$([Ðt&=␀xux-utC롍&([Í$D$ V1St$ 1 YЀwɃD=~[^ÍvtɺE[^Í&,(t$$t$0\$ |$(TtD$&D$=$TD$$qãTtV$ިD$:D$=$\$$g\$ t$$|$(,Í&Tu돍t&蛢$D$$ǡ"D$Bt>uD$D$>$|$\$t$ D$D$$_1Q&ST\$ tD$BD$=$$ϧD$CD$=$t\$$XT[Í&'UWVSƹBU&=L$TD$c|$UЇ|$S@4EщT$ D$D$B$$膞At,$=GST$uuAuԉ|$D$$ hD$kv>t.vD$ \$D$ >$D$|$H$ A&ƹ=֍PT$8DD$t&$ ĝD$-Ї!0t&UW1VS,5@PxcD$@1DPD$&s9|>\5[<‹+D$uD$@ $T$D$T$tk9}1,[^_]Í&_tGƒu܃ D$DD,[^_]ÍvD$ D$$9t@Ð1t&D$ D$$ t@Ð1t&D$ D$$£1t BtB @PD$ , D$D$DP$'ÐUW1VSÃ|D$lt$hD$h:D$4D$HfD$>$8O=\+2A7vq|[^_]Ít&$? E럍&9 uL$l념t&ɀ v fUt&9 CL$l6 &9ED$4D$4 v 9 L$l D$H @ L$lT$lv5dD$@D$LfF$kD$D$>$\$$D$É$|D$<D$0tTD8+T$0CD$[$賙El$DD$8-Їu l$hu$tzl$hL$4Мu=@ l$8$p…l$hV$XSPD$lt  !GD$D$>$6nL$@ T$L1t&1҅njt D$lIJD$S@eD$@D$D$>$X6c$W$@D$@D$5D$>$6빍&$D$@D$GD$>$6뉍&|$8u D$hDu|$SD$XD$\D$08D$0D$XtyD$0D$Txt/xD$Tt!$T$(L$,YL$,T$(D$Tt&<(D$XD$\u"D$T|$0|)D$XD$\|$ltu@tT@tLD$D$P?$谘\$$D$LD$D$>$6JD$hD$Tt @D$T@LM@D$\ l$T!jD$XD$XZ@7T$(D$ D$>$f0T$(L$<|$0D$$L$|$ \$蓮T$(fD$8D$DvD$<+oBt&1ۋ|$H6t+|$F$tF$6u1$|[^_]DD$XD$\'mf|$8sDf$‹hL$H=$茜D$L$D$L&D$4$lK…@ l$8TD$D$$9nf$m$D$LD$D$>$+6t&D$L$xvD$D$)$ĕ\$$D$LD$|D$>$6^JjD$hL$HD$$L$ $|$SL$<|$0$T$(L$|$cT$(D$Tt Bf$|D$2D$>$6D$G$D$|$StL$<|$0$T$(L$|$TT$(냅FD$$elhhD$D$?$F\$$*D$LD$D$>$=6[tÍ&$EuD$D$>4$D$D$,?$讓$D$oD$>$$$<6$ h‹hxD$D$ H$\$$D$LD$D$>$6D$T$b‹hTT$($\T$(zB<$苔D$%D$>$0|$$T$(D$|$T$($jT$(Bi% AA~ AT$(D$*D$><$T$(J L$<|$0T$(D$L$|$ D$$IT$(5$$ItxPT$@D$ D$>$D$fT$H$T$T$(D$%D$>$NjT$($ɖ t&D$1t&МD$ u/D$D$?$賐$fsUWVSL5Ї\$`-d!D$($t&CD$<D$801t>t~t~t4$ T$D$\A$qD$$D$ t$(D$,8&D$ VPVPV P VPVPC(,$RD$HD$\Aƍ@$l$$Ջ_strFuctD$|$$t~D$UD$\A<$FT$(҉FtFD$FD$,$$T$$D$,4T$$4$D$6D$D$A$AT$t$ |$T$$D$QD$\A<$1,$dfDP=@PD$ DP L$L$<$D$l$‰L$T$D$D$A$虇T$$T$$yD$$C$3D$T$$ T$ D$$D$,D$D$\A$@D$DPD$ T$$$k菋D$D$!A$цT$$t$T$$/|$$=@PD$qD$\AD$oá@P$@D$DPD$ml$,1ɉ|$|$$&T@P2ȃ@9É0rprpr p rpRP|Ƌ|$@@DP=`PtD$~D$\A$DP=@P{D$,D$gD$\A$ʶD$$D$%,D$D$8A$nT$\$T$$JD$D$ $tЃfdf1҅t$ZD$D$$ ‰ÐU1WVSӁlD$$9D$t @x$9D$ t @F$9D$$t @$^+9D$(t @$h+^9D$,t @D$D$$TB$D$t$$ٸ- DЋ$L$0%=@ÀtT=tMD$D$BT$$荃L$T$L$$҃|$0҃l[^_]Ðt&$$$ O97$XT$D$D$4$蘲D$4?lj4$L$迆D$4L$T$i$XD$D$ueD$$`#=t t um[^_ÍD$$I?tD$$d>z$(D$t=`&[^_t&D$$>&\$$` (=8v u_>u-lÐt&$ ) 3>t$[B<Í&'U[BWVSL\$ht$`߉ډl<$Ϻu-D$d D$44$1D$8D$\$,8D$<ıD$$=t@D$4HHD$ t$D$$|BҧT$,uu1Ht(D$8$[8t&D$<#$ [$qB;\$$M;D$<$0 D$9;t =D$<\$D$ D$D$$D$8D$<$蔣$L$qB9gvD$D$,D$$ztU@D$(w%D$,t D$,$AD$(5_D$ \$D$$B萂Kuo$=0t ;B5D$D$LtD$L0$B5D$(u2+D$@4[^ÍvD$H@uD$(5띉$fC$\$t$sD$[D$B$耡-Í@t$$\t؋t$\$Í&'U1W1V1S,\$@D$C$t;ctlt!at$,[^_]þ빐=`밋d$ݜ N$D$ D$D$莂Ë$WFD$D$D$$^t0T$;D$D$D$B$pD$D$D$D$B$F<$6rD$D$B$۟|$$rlj;<$rD$D$B$訟|$$r1t *$D$|$\$$stZD$$fKuyk~$kD$D$C$oT$\$T$$D$1D$D$B$ -5u }t$~$WEu @GnKd$HǐnD$ $MvcD$D$BNj$7;Y$KoM=G$J|NTD$$]z1$StX$Wj3D$D$C$m|$~t$$bx&$輼]<$蟖 tpPpu tÍt&D$$C D$$,CÍt&UWVS5u5/= m$[>v\=u t=0u t= t5G~=l11!t&ut t 1ۃy Ã9t t݃y u׃9utvHD$D$[C$kD$D$$@i t $\u Xu [^_]ÐD$D$BC둉,$N& D$ t&D$D$tC$4k$ÍvS\$ t5 Cu8D$D$$Wh$Zk[&D$D$C$j몐UWVSÃ,1tt&,u5Iu0)+5`9ۉtp+<-ٺ0< $7lD$T$u7&tx:uT$D$$T$ypuՉv,[^_]Ë I1҉ƅ)+5`9[,Xt& Gu퐍t&,[^_]ÍvT$D$ D$ $hT$Ѓ|1p+<9N`كCDH4t&U1W1V1S\\$p*D$(D$$؅dt#@1ҋ8-D$Љ$FuvD$C$taevD\[^_]Ðt&$DD$(뇐D$$捶ِ-`Ѕdt }-D$(1 t$$t&hD$D$xD$ 趗NjC04$iD$D$xD$膗t$$jjG,$iD$D$xD$Tl$$8jl$$GtD$$|$$D$=C$e4t$$t>t 4$)*1tCtWD$D$C$f$軳u >t&ދFtD$D$xD$赗FtD$D$xD$薗D$D$xD4$~u)1҅D$(T$(1 t  u I `L$,)+L$,9CT$(L$ 7L$ D$0@T$(`L$ T$,D$4u D$,D$0T$4D$49D$0~D$0T$4D$4T$0D$8\$4D\$0|$,|$8l$<;\$0ıD$$cD$,7-ЇD$(,ExD$CD$*D$ <$bED$ED$<$D$ aK;\$4F&}:A!$[fD$8D$xD$\$$fÉD$$nD$$$fD$uD$xD$赓T$$T$$fD$ CD$C<$D$(D$xD$xD<$覔uD$$D$D$xD$脔fދFtD$D$xD$]FtD$D$xD$>D$D$xD4$&ul$ D$ED$$Q`t);t"$dD8 L$$D$D$C\[^_]‰ÉD$ D$ED$$_0K I1҅9L$0ȃD$0cL$4D$(t& uD$D$C$a$D$虳jt&|$$ @fD$(,t&;\$4p<D$0D$<$؉D$ ^uS3v\v$ 6:|$,l$<HD$8$aD$8$hND$8$b,$cËD$L$cD$D$xDD$誐l$ËD$LD$D$ CD$D$$,gD$D$C$2I$C$D$L$` D$"$D$L$D$$D$$8Z%D$L8$$CD$ #T$ |;;)f$輴VD$0`T$,D$0D$4D$LD$D$$CeD$$D$88[$ \\$LD$D$C$ۉƸDD_t$\$$$D$LT$ D$}D$xD$'T$ D$D$C$^$D$蜰CͲD$8$1`(L$ .L$ 9L$4D$49D$0D$(l$4D$4L$4‰L$0!1HD$L$`D$LD$D$xD$B Ї@DDDD$L$`D$D$xD8$輍t$ËD$LD$ D$0<$,É$4|$ $8$T$<$$0Y<$D$b,$Y|$l$$a$;G|WC$ʯD$l$$Ma؋$0$,$4$8<ált@L$u@5DGDGD$<$D$Lx>D$l$$`T$DnvE+fD$f05DG%&D$D$D$\|$$D$D$D$[&@GD$ tO$wtЃádft"uGvыuQ:&t&$dÐzӉ& @G\$t$|$tWD$ $֩t\$t$|$Ëdf1t1҉ADuÐt&$迭뫐D$ PT$ @D$E$D$UX1 D$ PT$ @D$E$D$X1 ut+4$3uD$ D$t$,$빐D$,$tOXt,$謦D$뒋|$$WG$FE)9Q,$A,$,$6D$t$2,$D$D$D$tE$谇DD$D$vt$ t9T$1$|$wC$该D$D$D$IE$V$D$SЯ 돡 ,$1D$ D$D$D$w&\$t$Ɖ|$D$$Rt؋t$\$|$Q$7RD$D$E$iU|$t$$I믍&UWVS$e$1kD$DD$<D$HD$F$cthmt9stTdt>詢$e3 [^_]Ðt&D$D룍D$<듍D$H냋d҉T$LT$LB$#tdT$L:D$D$GD$ D$G$P$D$QT$LD$b:$f$DUY5DPD$,t&T$L1B$D$0UۉD$8ıD$8T$0\$D$$;Zt+=T$0\$Ѓ D$$$D$fT$L҉T$L.D$,:$P1"DPD$D($D$O\$D$VF$D$ ML$H5DPus\. ta8/_fD$D$$}OD$ 4D$D$*F$D$Mu&5DP>Gǡc$#ıV L&DPt( t 8/@D$X1\$D$F$zLD$XtBt;11t&t,݄t$T$:UD$X<( uС$ND$T$4D$D$$ND$ 4D$D$*F$D$KuRfRT$44$D$D$XD$4}4$lQD$@&n6,$D$D$XD$|,$Q181cS[4$D$D${4$P5DPSD$D$,H$LT$0T$ T$$T$蜙$(9D$D$`F$uL$D$%J$)t 8@P1҉T$,IV1T$0V1T$4T$\T$T$4D\D$D$L$(I@P?9T$,9L$\!%tDYE+\$<9~$ D$Q9uT$8^DDPPD$҃  T$\@$D$JD$ \$D$D$]$GT$0D$\D4Y>D\$GP;|$,e1Kh$ I$ 8H1MD$ D$$IvfN(NUWV1S\|$pD$uH<$tsavf\[^_]Í&$I뻍v볍v뫍v 룍v뛍v΀`f@냍vx=dv8t3t.D$D$H$I$W@l15pu3`u~!tIt31<$1?D$É$MpD$ZD$H${y fp1\$HYt&D$D$H$D$ D$ND$HtD$uD$H$x?\$G$; yG0D$D$H$Gt$$u덍v軠1ƀOGj1v=l5< l$D$D$: A xңly1D$8D$$$<t$<|$89|9-ʼn9}z)lj<$ɟ 9~$ 1$$F|`蛟X 9t&wD$D$H$E$D$荗$D$@D$D$<$aT$DD$@-1Ʌ/1t 4ȅuT$D11l$@x"9|9)$1,1ɋۉ^D$,$G<$(>|$l$$F$<cC$VD$뉍&T$1,[^_]Åtof6tcF8%u4$x;G}܋l,tD$D$IF$JrE~$T$S"$I3<Ƌx$aCGF@ N  t$$0 4$E4$D$Im$I}D$D$D$pI$@$ptt(14$z1z4$蛨1k4$輨1\t&UW1V1S<$PVD$D$I$^tIht$rt6at)褍<[^_]fD$븍뫐룐dh1t$($uvl;G T$$返&D$|$$CI?4$f;D$4$&D<$N;|$t$$:Ct1$(D$C$t$(9$,tE$-tHC$>AD$$+vD$ $뱍D$D$D$<> \$4$t 1ZD$($F9D$(D$$B$$#9$D$D$(D$$A$,;Gl@@p$D$D$$@D$|$4$贗D$t&T$1<[^_]fzu1Jl5ns-2? orf|$4$.DM&,$fi$(D$,$t$(9$,#C(E<%D0u1~u &f|$4$AfD$t&tvC$S$D$D$$>&p$D$<[^_]6tjB1D$|$,$蕕H6t2 et&軇4$D$$.艇1$誈NjGVS$\$0tkCt$t8-uE&ۍt&t&Ct$$mlL$uݸ$[^f $[^Àxuˀx-uŋuD$D$1$ 9$뭐UWVSl$t$PD$8D$4D$<D$@D$0D$,t&D$J$C2v:l[^_]Ív$K`t$$_L$Tl$P9щl$,,$.vA4$4D$D$$K$7\$l$$ĄZ& `t$$|$TD$PD$<`t$$|$TD$PD$0`t$$OtxD$TT$P|k~dueT$4t&{v`t$$|$TD$PD$@>`D$8*fw`D$D$J$6\$$考l[^_]Íd@0>4$-u4$1Tu4$`D$XD$\D$4$fMD$D@@fFD$,D$ D$D$$t=D$HS/l$x-4t6D$YC$wt<[^_]Í&$9bLD$D$L$W%t&\$P1t&C$(D$*D$L$`V\$$D)Ë;$1$D$-D$L<$AWD$D$L$%$rVl$͍DD$D$ۋD$x Lul tl$ˋl$1D$(D$,t5T$D$D$L$VL$L$D$뾉 T$$}4VS$D$0-+uiunT$1ۉT$$t?D$T$$D$D$T$t9x; t!$[^Äɾt됃uڍv$ "$É[^f\$\$ t$t$$L$(|$|$,؉$Qu t;~\$t$|$Ít&D$~D$L$T<$%D$D$L$S|$$k&t$|$\$É'UW1VS,~Nl$@11ۃ%$|$$9~0tЉ$ ƍ$L{$ 9؉t4D$D$L$T4$<|$$,[^_]É$ |$$d4$D$D$LD$SD$,[^_]Ít&/띐ܵ$D$HD$$TWà PhPlЋP Í&S1ۃtЉË1t($T [Í\$Ét$։$?D$t$$u&qt@@E‹\$t$fH؉'D$ PT$$XÍt&D$$@I'лtÐt&tлÐU1WVS$$e$1  D$XD$dD$PD$\D$TD$lD$(D$,D$0D$hD$@vD$M$谑N'v/m$e3e[^_]Ít&$M `t$$t+$ $x9щD$(D$T$\`$ppt& `L$X1D$,#v` `D$df`t$$W$ $q9щ|$0`<$ 3$D$D$$K$\$|$$k$D$`$T$$Q$$D$TT$\D$hfD$lvD$@v`T$PD$hdt$l\$P$t |$Tt 70DŽ$D$pD$tT$tҋT$tDЅD‰D$t$$t?11t&1< <J ʼn$$Buى|$p$D$CD$`M$p:M$ D$h $Mhu'-HCxL$0 $t HC$D$0$<DŽ$$ $ML$,tD$$` D$,T$Tu D$\cL$0$D$$L$"<$%=%D$TD$$@%$x$M$ D$|D$d-- D$d$ L$dD$ $#3b@$D$tD$D$$ $t0D$|$De D$\$<$3$F$ D$D$`M$ZLt&D$TD$\D$(t D$,$1& $ $` D$D$(D$L^ D$Pt D$, D$D1pD$8$D$HD$<D$|D$4t&D$,L$8L$8T$DT$D$.F9$.X< C$ t$`2D$(nI"$ $0$ $.DŽ$DŽ$$$$$|$\$$$D$ $($$l$$$D$L$%T$0$/D$D$$$/Q$$L$`9t>D$4L$(9L$4D$,1AD$bfD$41 t&T$0$.D$$$t&: L$pu<t$<$ D$|0$.L$0$/D$ $Y$ t&$ =L$@1ED$<$‰؉L$$L$$D$D$`M $D$$\AD$$1҉zT$d$I`D${$ D$`M$A`D$D$=  D$L$1ɅL$LvL$0 $d=  L$l?t&D$D$P$ $^/|$,O$$$B$~$ 1;T$|$$ËBڋD$D$`M$a?$B$%etD$%D$`M<$"?$D$&D$`M $?D$=D$0$0\$$$$0T$l$$l$4҉$p$8$t$<$x$@$|$D$$H$$L$$P$$T$$X$$\$$`$$d$$h$$lD$t`T$0$ƅ$D$$P jav$ڋA&L$0 $D$9D$|$ $D$$ QÉD$D$D$`M$=g$ D$D$`M$<$$D$D$tD$$ $Nj$ 8$  $A$j)$B$[D$)$ D$$ QD$&D$0$0\$$$$0T$0$$l$4$p$8$t$<$x$@$|$D$$H$$L$$P$$T$$X$$\$$`$$d$$h$$lD$$xX$D$$P l$E^/L$|D$t$L$D$(É$ 6%$ ^뚐D$ $AXtЃfd$Ca u/D$D$4N$I $1VD$$R1|$ -Їt2D$D$$$21Ít&$L܍v'1|$ -$,d"du!$, $,!1ÍvD$D$>$,L͍v' |$-tI`+I I`hu`ѐ&|$ -D$$tB=^t8vt+܇Ðt&8eu uI܇1ÐD$$ptH܇Í&D$$3I렐u1ҹhNDʉL$ D$D$lN$f҃-D$ T$D$vN$Í'D$8et ܇u ^1Ð܇u1=^ÐUNWV1S4Pl$0}vCtC8uD$,$Auݍ$Pu*0Pt7l$0[^_]⍶[^_]É$;:¸tዀ(PfUWVNS$P,|$@l$D(t&C tq4$ЃD$tS9tOst=tD$$91҅tt9uω:suƍv,[^_]ɉ뤍vC덐S4P$N1ҍt& Ku[Ít&UNWV1S4Pl$4}vCtK8uD$,$ uݍ$Pu:,PtXD$0l$$҃1[^_]Ít&,$T[^_]ËD$0$D$81u߉,$rTЋ(P1҃|$0-‰1뺐t&UNWVS$PL|$ eD$<1D$@vC },$Ѕt,$/T$TT$kt+t$7tދuku؍vD$4PND$D$O$3v3t9?t*T$t$$A4$T$*:3uDžEE2T$$NRT$tH˃XÉT$T$D$$NT$HۉHt\t tHD$D$O$3D$<$1FtD$[f<$D$<$ L<$4„LҋHt tM۸,0uRDD$D$N$l$|$$I6D$1DD$D$N$s|$$WI6D$v<$L6D$t&D$D$N믍T$|vL$T$$L$T$t"sft&<$TvD$7ۍt&D$D$O$$HiUWVS<|$TeD$,1t$Pl$XtЇF1ۨtD$a@tDAƒtDftDitDrtDttDxtDctDlD Їu2D$FD$$"$TЇtkfD$D$ D$]R$D$ Ftat&D$4$vDuDOu۸$@D$D$PR$Fu@…F$RÉD$ D$MU$D$BD$D$R$*SV1tD$a@tDADfct&jЇtg$1T$,e3<[^_]fD$FD$$ $|$ftD$D$FD$$ $g뀐t&ЇDnD$%c$D$lD$4$p&t&'WVS|$ t$$%1ۅtqtS vtw X t 1 $t$D$9$LtD$ND$R<$([^_Ív諾qt&1ȍD$ D$$蹫¸t5Bu/ X t 1 L$$D$$L$1Ðt&<|$4|$Hl$8l$@t$0t$D\$,,$tBt"H!ʉP փtE\$,t$0|$4l$8<Ív@h,$D$D$R$1&l$$D$l$$S PSH ɉSt H S SD$$D$D$R,$&D$D$,$0tLhHt H Pt&D$D$R$\%/fD$D$,$HHwU1WV1SL\$`ljD$$D$D$eR$lftWA/vBL[^_]Ðt&$RD$뺍뭐D$$뢍땐dtD$dt EL$tD$dD$dDD$dD$dT$d t$$D$(D$0҉t$L$,=tD>+D$<4D$$T$8$~R‰$T$\$&$D$zbT$D$8\$($@L$D$D$R $T$D$ T$,tD>L$T$d4$L$T$t$(\$01t&T$4!Pt&4$Bt D$(fD$0yD$ $Rt&4$@T$(/vD$D$kR$Dt$$(?D$0D$d J|$dt*d$dD$dD$dD$$|$dDD$dD$d1tzl$d|$|$$BttQt@tIvtB X t 1 L$h$D$L$$PFuiu|$1D$D$1D$R<$a"D$CSǐD$d@9D$d࿃|$d@DD$dD$d|$뛐&D$ D$D$$Í'D$ D$D$$aÐWVS t$0D$D$D$4$NGtuD$0҉ L$tgx$\$L$9}]t?D$D$|S$1҅tV$D$A& [^_Í&9rfȉڃD$T$dtD$TD$S$ &` \u5Ȝt`F8<$D$\D$S$(|$$ ȜȜ4$}L$\$8t&| 8 1[^_Ð Мu NDu"t ?D&sܐD$ \$t$|$$0=t؋t$\$|$f5dF t$D$/$t$A뭐=ЇD$/$$D$D$S$\$$Å$g8\$$` }t8D$$ ^D$$LCB$A1$D$q$g8ð$ WWFҋuSD$D$S$\$$9Їtu P.f$D$D$S$e\$$If$AD=$<$YD$D$S$|$$$` ljD$Я|$$0 $A脘&D$D$S$$8o9.f$*F$D$F$$$D$Ít&VS1ۃt$ P`D$ c4$`\t#ft8[^Íˍv@GdtKu$9 ueD$` $耾D$\G$1[^D$D$T$b$J=[^D$D$*T$3$75,D$0\$$t$(tMT$T$$=?ÉD$D$$D$D$HT$\$$t$(,Ív8[uxuD$fD$aD$$s6밐$$$$ 8tЋ$$ĬÐt&t$\$Xt$$\$$pt$$$ D$D$D$$$ D$\$$$ D$ZD$`D$$$ D$0$D= /L$,|$(t$$D$D$v$B&D$D$<$D$?D$D$U$t$ |$$D$Dx&<$谘OeD$ #Zt&D$pD$U4$8\$$11t&4$v<$D$ <$<$HD$ D$D$}U$T|$$D$SvD$D$U$t$ |$$D$o&$uR&$1O&$D&$Bt&@$|$D$GU$ƉD$ /D$D$U4$wf<$[vD$D$kU$$|$$D$D$F<$D$$t&D$D$TU$|$$D$xv$6t&<$`Av<$PJvpD$D$0U$Yt$ |$$D$t&$BD$ D&D$D$U$|$ |$$D$D$ &UWVS,l$@E:-uS萍JL$Jt-p2auzluzlEt&t P:-tQD$U,$MP$),[^_]Í&t$0uBtPB뇍&t$Ut؋t$Ut$UBBaPB0$U7t&'t&@0t&t$UBpPBzt5d1tc1v6Džt@\$F$Wuۅu׋VD$$>*D$6Džuf1D$@,[^_]/,1[^_]Ð<DX\$0t$4|$8=~X=t!\$0t$4|$8<Ð1\$0At$4|$8B<Ít&\$ T$L$\$$pT$L$x,t$ |$$D$(\$02t$4zT$,|$81Q<øe&'$eD$|1$4HX$ω$Ճ $ttPX@XT$T$<$T$,D$D$ VD$@D$T$,LXT$ D$V$D$!D$L$\$ t$D$ ,$|$L$,L$,\$ L$$T$蘵D$|e3$$$$ĜÍt&=ЇT$<$T$,D$D$ VD$@D$T$,v$V_bfUWVSl= $u? aTXc!S#"Ht&Q@;HP11LD$ 4$HStR@?t&tVHtIPH9L `ЃPH랃auʃ딍뉍v끍v$l[^_]ÍHD$ND$ X$L#D$LHD$ iD$ X$PLBvdETXD$X1T$PT$9T$XL$\tT$PL$T$fCT$htt҉$D$C$VD$"뱋=PL1ɅftR HfP1cTXu lt&9ta D$D$V$O\$$3"l[^_]$ *7,L놐9~yL$XT$PD$$L$,T$l$(t&L$$ȋh11ۃcƸTXut&9tT$(҉T$ u ɃL$ L$؋T$,uHD$ T$PL$TtT$XL$\1$D$$=P;|$$+LHE,$"$$D$D$VƍLXFT$@T$4$xeD$0#D$4uXCD$ D$ tT$0L$4T$@L$DtD$0T$4D$HT$LT$@T$4$vvD$D$8$,$D$p# ЇD$8D$<D$8D$<D$ D$0D$4&T$LD$H9T$DT$4D$0wr9D$@v1D$0D$411D$$D:tGT$Le3\$\t$`|$dl$hlÍcfȐt&D$4D$d$l$4<p1҃@>:D$(‰T$$uWWT$,)G$D$Z9`D$_Wt$D$,$6_D$ L$$t T$,W  0L$Jt$D>\$,t$0|$4l$8hf@Q |"~@" Ð=w| =s案@ Ít&'\$Ét$։$D$t$$tA\$t$Ðt&\$t$ SÃxB;s!| D J x[Ív|AT$D$ D$a$x|몍&'UWVSÃ<0T$L$<%1-^D|$$+_u׉މȉˉ*TF< D$Pq<.L$L$TD$P1+D$TI؅ۋL$T~a1|$l$Tt&D$.9tAp7҈D$.D$/uˋ$T$9uuvSD$.t&[t;pD$. D$/u͡$ D$uš$获<[^_]Í&"&D$.t&5pD$. D$/uȡ$ D$;뾐s0C|$PÍVЀ sL$Pt&ҍ LJPXB< v։<.L$PGC<*tUL$PЀ L$T30D$TCPЀ w+T$TvTPCKXЀ vT$TL$9L$T|$TfT$Pxpt&sB\$PpfUWVS<$Pe$,1hlpm#t&D$2_$xvt*$,e3 <[^_]Ð`t$讌t"|pxt뀡t$u͡t$d҉T$@dL$@AD$D\$D1ST$D:F$L$4L$\T$Dtsv$CtS<\G<%=p$Ƅ$uD$E$V륡$'t T$@;Dht l p=g=|t-$般$蛳¡l &uML$<<%k\$<މ&^FIÉD$$+_lu؉؉<*M Ѓ0< T$Rv&CKPЀ vL$8D$RD$TD$H|$R.D$XD$LuaD$8@<*D$R |$R-D$8 T$R0 vpȍH@PЀ vL$8D$RD$XD$L|$R\t$R\$8މv^F9|$$5_\u؉؉L$8ƋD$8@AD$SFT$Tt6pD$Lt$D$ D$Hl$$D$¥D$TD$X p D$Lt$,$D$P2t > 4$!4$ƅt+4$蓩 D$/D$a4$svL$8kT$RD$SAFP2tȀ>tÉ4$,4$T$D$aT$<‰9T$<D <_ǡ$\D$X^l$T pT$D$3fD$XpD$L|$4$D$D$LT$u1Ҁ:1Ʌ ʅ҉W?\$,t$0|$4l$8<Í&~L$D:-uZ-tr5vx:otk8tfDL$DD$D$\b$Ə|$\$ D$D$$9t/L$D농-Wu>L$H1=W9:ƍt:@z|L$DD$D$xb$|$\$ D$D$$Nz' tD$Ð<1ҋD$D\$,\$@t$0|$4l$88+ƒ;{dK9-L$t+w|$-t$L$5\ W /:5ht$$T$L$裋T$L$@<:tB<;t><#|/E#`\$,t$0|$4l$8<Ív|/?ۉ\$t9<:A\${/]-\$t&+}<; W?$W`_ W$W~P |Zt^?`d v=`t&f돐t&-* df{T$`s-K9T/t0< '`t"D$@L$$iL$ux W?$W`dL$` &P`a`dCt&dÐWVS1ۃ0bt&݀et"8uD$<$(u܃[^_Ív[^_Ív'U1WV1SÃGtB$/D$[cD$Tc$ƉD$ 譂D$(D$c4$GtB$D$^cD$Tc$ƉD$ dD$)D$c4$謵GtB$蝛D$YD$Tc$ƉD$ D$*D$c4$cG(tB$TD$acD$Tc$ƉD$ ҁD$+D$c4$G tB$ D$dcD$Tc$ƉD$ 艁D$-D$c4$ѴGt D$ D$gcD$Tc$J;_$I1[^_D$bD$b$D$bD$b$uD$bD$b$ĀYD$bD$b$蜀=D$bD$b$t@!D$bD$b$OwD$cD$%c$$D$cD$%c$D$D$%c$ D$cD$%c$D$ID$%c$yD$ cD$%c$\]D$ cD$%c$4@AD$cD$%c$ %D$cD$%c$~ D$uZD$%c$~@D$xZD$%c$~D$cD$%c$l~D$cD$"c$D~D$D$"c$~@}D$6ED$"c$}ƀaD$v:D$"c$}ED$uRD$"c$})D$)cD$"c$|}  D$KD$"c$T}D$3cD$"c$,}D$;cD$"c$}D$9D$"c$|D$BcD$"c$| D$IcD$"c$|`&L t(Q $b`v$bL&D$P@qV1SteK‹TtNC$Au݋C0D$D$c$ ~t$$ut&4$[^fV1StTtIC$muC0D$D$c$}t$$wu[^É't$։\$É|$D$jc$ {6D$b D$b$zD$bD$sc$zD$bD$b$zD$bD$b$gzD$bD$b$?z@D$bD$b$z;_$\$t$|$ÐD$b$yD$b-D$sc$yD$b-D$sc$yD$b-D$sc$ly@D$b-D$sc$Gy;_-L tFQ  $bD$sc$x&$b&LD$P\$nt&5d|$1y@t$(|$,ut$D$$ID$|$$54$1D$D$<$ $QcD$$"e„Q19&D$D$<$輖D$l$<$訖C$!tcD$(l$,uuKW~D$D$pd$p$賽;3t&PvC0D$D$c$pt$$fID$$P$LSD$P<[^_]S1ۄҍHt!v[wM(f)t%t&Ht9vtH1ۃu1 [^_]Í]t+r|uĉ u|$|ufHftL$;$H$xh`XtHLt&u,Hp^t!4$u$H.t:t =l$H;L$JHD$H$ UWVSL$t_9s]1111$u:[M()t&Ht9vtƋH1ۃuf1[^_]Í]t+||uĉ u|$|ufH멍vt $9H1낍t&ph`tHTu$Hp^t!uh)vH.t:t = f $t& $9H[H$HŃ'UWVS&L$9L$0.u $t9L$<t$@L$ t$T$AVT$r1ɋl$,^1! L$Dtrj\$(?&D$(ZD$Z$ZZmL]l$[E$D$4\u|$4t]D$ t$Ut $ TÅD$ MuL$t4$VUt 4$Sƃ/-9\$(*9|$(t,D$(=ZD$Z$ZZK$\$(T$B]$J5]\uuQQу[QuċI:t =t.ufˍvE=D:;.[}]\u |$4i[u-D$ t<$ T9l$trZ=ZD$Z$ZjJ]\$ 4$S4$5R} \t&MFփv?t!t @L$$$T$L$L$,9T$<D$ $L$0D$MmEMD$\L$ f:Cu]u)$ehL$D$<$L$Q|$`$t[Lt$`D$$i4$O1҅‰T$4u D$`8i8iT$d4$T$D$dD$hUIHƃ$ eƋD$`$2ID$LyHT$4$D$LT$ D$D$`D$M4$KD$GD$w4$D${T$t8D$4T$D$($|P¸u1|$(_&D$\uD$\t&k \$D$pD$w<$f{D$\Bu_]]L$DT$VIL$,19L$$\$7|$.u$s?*}$|$/uL$8{ty;(D$D$9D$0L$D$IL$t&t t;(ti9\$$3?*|$/%u?ufT$9T$<M$z/0vT$9T$0D$(ֈD$,|$0$ 9T$$*l$$T$u1t&D$D$&|$ T$,Bvy/<$M4$MT$t&|$(l$,T$$C11<&.T$\|$\0T$\\$(ŋD$\Et&|$KN[T$,`D$ i4$KD$($H1f\u$t$D$ t D$$NtD$$LD$ST$(T$9T$0D$8$[D$,D$,ωމl$Ӌl$0!dt&D$8t(>(t#F$hD$Eu |$,u:t&L$D$$L$L$($9tD$ t$T$%MT$t $K9T$u뛋D$1T$9T$0"ߋt$0Ӌ$t&9L$$ڸ?l$<$L$u1D$Dnt&[KD$Wt&C?ыDPtT$|CT$<VT$4t$?ӋDPtT$BCT$/-N]\u |$$[t-L$>L$ыDPtT$BT$ L$|$$L$r]4>DxoB[<=<:%<.m[nvt$4҉T$$T$$D$D$4\$\t$XD8f y8uD$D$4$@uӃ\$\n1D$<t&D$ls\$$D$4D$pD$w$i|$lt~\$$C$S6f<]`<\ufu zZti<[ZuR:t =t.ufʍv5]txt$$&z/1v9\$,\Dz6=t&#=D$Rt&\$$&|$,l$$$C1w1_T$lL$RyƋD$lEt&|$SnP\$,&]\$qD$Dt%T$7T$Dxt 7<9l$0KL$,D$8҉T$ [t$0D$$L$$$!σD$(߉ID$D7UDQtT$;T$9D$ tr9OuD$8t[?(tVG$tD$3u>|$$t7D$Dt_ 7MDJtL$B;L$돍&$T$( $L$,T$1g1fEO&|$4t$XD$l9l$0uދ$\$0 9U$ى|$4$D$?u1YD$ll$@pL$LbL$RB|$Sot&Vt&et&k&v&$`x'{5L$T1҃|$<_ bU5L$TDG:5L$TD ,5L$T5L$TD@4L$TD4L$T4L$TD4L$T4L$Tyl4L$TD^Q4L$TD74L$TD)U&UWVS1<\$PT$TL$|$X;(1D$F߃v<[^_]Ív$x?\$L$$T$T|D$nD$(D$T9D$r;l$T$(T$ v9t$L$ 9\$$|$ $L$Cu΋D$TL$T$\$$u1<[^_]Ã*CD$T$$\$,T$T|D$;l$D$(aD$ 8v9t$T$TL$,\$$T$ t9t$L$ |$ $L$u׋D$T9\$$L$T$$C߉\$u1+;l$\$ T$$Ml$ǐt&t$ fދT$T|l$Í@$D$MtQ;\$u1T$$9|$CՅt9|$st&T$T$TL$$T$u1}v밐D$9D$(D$(D$D$9D$(D$(D$dL$D$T90l$$,L$TL$?t$L$TT$|$ $L$W1 T$TL$|$$T$,1t&',\$\$4t$ t$0|$$|$8l$(u\$t$ |$$l$(,Ít&t߉$T14$J1+|$4l$(|$$t$ D$0؋\$,,\$\$4|$$|$0l$(l$8t$ u\$t$ |$$l$(,Ít&t߉$,<$4,l$4t$ l$(|$$D$0؋\$, WVS0\$Dt$@|$H$n+D$(t$D$$D$,\$D$$vdD$,|$D$D$($T$(D$D$w$D$^T$,D$D$w$^D$0[^_Ðt&D$(D$D$w$^|$\$4$0[^_Ðt&4$mҐUWVS\9T$4l$,\t$LvD$4T$8&ЋT$4D$$CBtLT$,D$4T$0KD$, D$,$.BD$4$"BT$8T$4$BT$8b $AD$4$A%,SD$ L$1tC߃;v 19[Ít&$\y[Ð1;Q[Íy(u͍t&'U1WVSL$tBY1$1&!;w$Lzy(tمҍYuf[^_]ÍvQt]\[:uuK[.uevt^]%=fu$uoڃ˃]Kt(u[^_]f]uQY1K]u؃SJt&[u=uQ]$]uYQ$끐qQ&_QYEL:YQt&.Q]t't&YQ1YQYQ$&SD$ L$1tC<;v 18[Ív$<{[Ð1:Q[Íy(uƍvU1WVSL$tIY1$1!;w$,|y(tلҍYu[^_]ÍvQt\\[:uuJ[).ulth]?=u $ڃˀ]Kt0u[^_]f]uQY1K]u׍&SBt&[u=uQ]$&]xYQ$iyQ&9HQY-4:YQv.Q]t.vYQ1&YQYQ$,t$ t$0\$1ۉ|$$l$(>to4$t|tD$=D$}$sSw1ۅt14$b$D$?D$}$Rt$$$É؋t$ \$|$$l$(,Ðt&ܜ4$tt@tʋX#š8tf8t;t(u\$Ǎo $qD$/,$q KP1D, r1tD$4D$LD$ D$,D$T$,$T$\$LtUC D$CD$C$xYSC4$T$D$c ygCtn4$[uD$7D$}<$>\[^_]Í&[u$}xD$L$ fD$L$ ($~E4$D$L$\ +lt1$l$$$_D$4O 6$sT$$$_T$D$D$D$}$ \$$ST$\$ D$ R+S+ ҉Px[Í@BɉPy@[Í&ST$ \$D$ RS ?BP~@BP[ÍUWVSL$T$ D$9IJ:?B~ @B(p   )¸C=T$>'D$0D$?.D$49t/.C.F\$(x/L$0@1۽&EǃD$D$HT$ $9^Ѓ[^_]WVSt$ |$$t$F~1 v9^~$ׅy[^_ÍvD$tPtt D$bfÍ&'Lt$@t$P|$D|$\l$Hl$X\$10T$+#D$$\$$|9tҍLVFrЉv\$$l$XD$XD$$tjl$X1uňT$,?T$1ɉ|$$\$,T$+ʋt&ɍAƒD_K?A<v΍YɍAɃ0Gl$XXl$X@L$\D$XH l$XH\ut x\PDʉL$\L$Dpt=wL$<ȉl$X l$X l$X tl$X \l$X DD$XPt {IT$1T$\$,ʋ(LMt;t3z҃W<VLMuD$X\$,ɉtDҍBVFD]t ƍB<vۍZҍBɃ0G͉σd$X}l$XO|$$1ы\$,T$+u9wql$XωʉZWɃ0Gt댃L$XpP\xxdT\$ $^ÉeT$\l$ T$`vUW1VS,t$@l$H>4$D$D$$W$@'XBvV1St$t-t&u^FtDZ@u[^Í1[^UWVS<\$X|$Tt$PD$))D$$ 1҉19~)9u)D}u#\$\t T$\<[^_]Í&T$\,$D$ D$T$D$,$D$1D$D$,xD$,<[^_]ÐLA$D$P\+D$Cafȃ0uD$P{{0t 0D$t-,C[^_]Í&D$P cVك\+D$-CTvȃ0uX&D$D$$UT$$D$+,[^_]à /D$P$gfff#))ȃ0 C~x0Sf tk_v011҉ v݃#wHW֍vD$PC0 Xx ws0 7=wK뉍T$P&ȃu ލ&>@E3x4gfff&))0 ҉uȺ)0 뭐UWVSD$d\D$,C0 uD$d{0t 0D$,t- Ѓ_L$$T$ 4$L$ |$T$щ :D$ T$$4$|$D$T$ w #=w딍t&D$dC0 Xw v^͉4$l$D$ D$ L04$l$D$ D$ Ɖ uj0Z0WT$d$& u ؐ4$|$D$ D$ |04$|$D$ D$ FƉWVS$\$$e$1t&|6D$\$<$x"D$\$4$Vu1 t&$e3u Ġ[^_U@W1VS$e$1D$8D$T$$@D$\v492)D$D$ LD$l$$eD$|$T$,\$<$T$T$,T$$D$$XuG9|0)D$D$D$ QD$$D$T$D$8tdT$$e3ujļ[^_]Ðt&D$D$FD$$?L$dT$UD$D$WD$$Q,`G\$$\$8t$(t$4x3T$T$D$T$suD$ft T$fuv\$$t$(,Ít&T$$D$D$D$$``tD$tD$밡$gD$ $A1ÐUWVS,|$HL$D T$D21&T$@L$D$L$$L~xS9w=u~L$DD$ \D$8l$$T$D/D$|$ tXD$LuT$@L$L$$褰~u0C,[^_]Ðt&,9wL$DDӍvf뺍&묋t뼐UWVSD$|$$Y-€+$ÃtHh.A< vzfKt$.YЀ w_ӉɍDAuԋ\$ t $T$ t[^_]Ív҉$v$[vt$ t $T$ 1u뻉1fZ11ɉ݉T$vT ttZЀ wvҍtZu݋T$R4@T$ t $T$ V7[^_]Í&$1f94X멋L$ t $T$ 171%x Ð xP>%x É'Sd\$ t$tK$ $\$$褾dEЉ$,`1[Ívd1Аt&Sp<lTtСhu =tp dt \uT^t(PtСt $[fD$i$$*f몐dt\u$á$D$ʶ$-$egVS9~5 t{$艼$\$$"D$$05}D$t$$=$v\$$Լ$$ur t,D$${T$ 1u%$׻$L\$$p[^f$;x뇉'^u=^`fLt;X~Ct"<tt =tptD0̍D$ $0`fTuXu *Z&'8PXTÍt&8Ðt&$ 0@@@P@*ft&'0tt&P$00uf,t$ t$0\$\$4l$(l$8|$$Fw=]y<<&<uzG=^^ x @t$$ЋL%xuG=ttr^1uZ1\$t$ |$$l$(,f#yt $f/Xt$0D$4\$t$ |$$l$(,v<4$%/<Ggu^=xXH6 HpP XP x 0f_$1$h\$$茸$D-&3I1v=^`f4$P^4$D$^D$i@^$3GD$4D$0t&HXpP 1҅&u 1҅‰T$H$T$ډl$0\$t$ |$$l$(,t&$|9t/\$4|$0uTt24$0XcDpt襹<빍%x?4$=0#t&'D$$D$D$HD$ $Ð&,\$ t$$|$(t4t\$0\$ t$$|$(,ÍHu t D$$P\$ t$$|$(,Í;sC D$ $!swt&T$ $$/T$HRT$ $/T$H29tˉT$$T$譳T$DXtT$Ƀ,D$D$$,L x 4xx};^tZt]^$T$Lt H1,fD$;u9t Xux,Í&1z0uLclXt&$LIQ Xɹ Et&'VS\$ tZstKS$ơubto0tC0tpt$@[^ËC xLST$S $T$v 뀍&$u"%x[^K딍t&8PXT%xll^t,uD$$q1Íp xl& 8<]H8$H<]1e$Ducf~`f=8g@^k0ubĻtaxxt&4t-)뀍v^$>LkB뗐Ļ듍t&p&lD$`fD$$t*&$=ڍt&0늍v' x@,%xawT1 Í&c>鍶0뚍v'SÃE t4$?u[e t&D$$P-…ңH~7LT$ D$PD$D$ 0$\Í&'\$Ét$$$TPX\$pt$@@@ @P@  VSÃtqt,D$$L %x[^Ðt&C s$D$PTD$1ۉ$Q밍&C $D$զPD$T$HC1ۣTZs $t$腦9WtC;T~T0tU4t 8;P1ۉD$T$c>48$%=v&PD$T$5[98^$^,1^@^(^^,^Mt&èDpA\1[Í&$D$]1[ÐD$$d]1[Í'D$$T$ Nt nuD$n$+(1Ðt&D$N$'1Ív'SD$$\$ /t?t2/1[ÍY$D$/s'1[Ít&sY$D$?3'1[ÍS\$$$\$x^$^,(^,^1^@^[Í&W XVSt$8yfT9~v t5 t09t&% t&t9tT u u99&9ȍtT t tu[1^_À tt&V 8St$ t\T~S t& t!\ t uTt#f t v uTuu1[^Í& t܍P҉Ty*T΍ tЍP҉Tx\ uTЀ tT W XVSt$8yfT9 t tT9'&9ȣTt t t捶t^9~ZT9|Gt&9ȣTt6 t t u!& t t 9TTC[1^_Í'UWVS5Xl$0=8FD$ fT9\$ 3Q<_< t9< t59/&<_tT< t < t9ftTQt< ug9&9ލtT< t< tᐃU1[^_]ÍvTQu<_u9u< t'붍&'UWVS58L$0L$ D$ &T| t! t< t< uT|T$T$hu _4$D$M>t? x;^l$tF$wǁ%xt>NjD$$ >\$,t$0|$4l$8<Ít&$v뵐XD$$T$$G^t&t$6Í&CӐUWVSÃ71t&ۉ-tktR =š$!=\=,$=.tU8ul$$Suuvt'fTXP1[^_]6 TXP[^_]f \$\$t$t$tIt=h t =g tAt71҉ًt$1؋\$ T)1\$t$ ft$t$\$\$ 8& \$\$t$t$tIt=h t =g t t71҉ًt$1؋\$ T)!1\$t$ ft$t$\$\$ 8&VS8|ӉщtT";ơ$#;^;á^uS,XTP[^4Tt& 1[^Ív4$:룍VSÃ@(PTu taڙSH[^C,t$584$y$vt$$yI t%x[^ \$Ét$3TP$\$%xt$ Í&'SÃ( ~?~~fu-TtzT$$ Cvt[t؃tQT$8sT$v T$$"f([à uv(1[Ð C$S(([ÍD$$fD$$fP$5 냍vWVSD$$xC,sHCD28 :DTX<$蒘D$$LƉD$訖4$`x1xu]$zt‰+|^ufƸx,D$$x1%x[^_Ðt&H&ݐ|$??Eа&|$//Eиt& t ( tz \$\$ t$|$$x‰t\$t$|$ÐxD$$Cw1%x밐VSÃt&n8u&t$D$$xx؃1[^Ã[^Ðt&VS\$ t$t ҍЀ:t]t ɍȀ:t>t:ttۍ؀8u@`O[^ÐBݍ&B`Q빍&B VSÃ$&t$$py n8t$[^Ív1F tD$$D$f $[^ ,t$$t$\$ É|$(׉t$D$T$5rt)mM\$ t$$|$(,ft$D$T$qfSu [Ðt&ptZ$láu7l$Zqx%x[0$f량'l$plD$$l1Ív'p$@lD$$l1Ív'SXeD$L1p\$`$kT$vu"D$0L$$T$#D$D$/$PD$Le3uX[9t't&'zD$tttҍЀ:uB tҍЀ:uB tҍЀ:uB tҍЀ8u@ Í'SXeD$L1tD$Le3PX[Ðp.$jT$;D$1ɣD$ĺD$ȺD$̺D$ кD$$ԺD$(غD$,ܺD$0D$4D$8D$<D$@D$DD$H]t^\$@^h ] պ ܺ ӺߺԺݺѺҺۺٺں xɢ޺t:D$0 ^T$#D$D$/L$$$@^Xպ̺%D$ ht ҉^T$`T$00T$T$D$D$'D$&tD$T$D$0|x4 t $l$l xfT$yt&3htuhǍv_uꐡ^Fպf^$ ]pS1ۃt [fp$kg q  0$  p 4d(`p t 8h,$ x <l | @  D  H  L  P  T  X f`x[Ðt&p$cf [t&1u Ðt&p$f AuÐt$t$ \$|$|$(4$l$váCt$$lt ؋t$\$|$Ít&'SÃxD$D$\$$2i1ɃtST$ /@t? %t5`#t+@t!=t|t 0Ɂt vx[ÐD$$iɃ*ލ|T$T$D$$uf1҅uD$ 1%=@‰Ѓ|Í,|$$1\$Ét$ ։l$(tw߅tl tb܆tXtUt҉T$$7ft9߅t.D$߉$ ott؆tl$t$$Љlj\$t$ |$$l$(,Ít&UW1VSӃ,ʋt$@D$t>D$)/$i TtRD$D$|$8t|$t58:L=T|$Ot&5X9E=8:u$&@t:u 9Ӎpu9}>tL$\$4$V4$iÉT;l$t@l$@,[^_]鐖|$'58:T:U#t&,[^_]ÉL$\$,$렍:M)58:>:TD7$eD$|1ɉ$$$t=T!uot[DxunX9TT$|e3$$$$ĜÍԆtTxDxt$|$sjË$t-h|$\$$buD$(%=@=X9Tt[$軔*D$x$&--8|=9L$xfD$x$f|$\$$DdK|$\$$ bRD$(%=@>Gf=7Tt* 8u$|/$Y8 8/u`hUWVSe<$4eD$訑<T$T$lj$eT$|*///l/\$,$e9t$聒<[^_]Í&9|w1҉l$ ݉Ӊt$(|$,L$$T9D$$ 9_t-u_f*-!9t$(|$,&-0R4t$48t$覑8<1 $腑<<[^_]Ð 8L$D$8b9ZL$l$\$ $h-09v;.C<.{-0;\$ t$(|$,t& L$$L$$;L$$ D$9D$ L$ 9L$$9L$l$\$ $eJ-0u&T$aT$DxeT$D$,tt lD$4T$0D$ CD$T$$VL$8 $ \9D$(D$0|$<|$4t$(t$89\$0Y,D$(t$,$D$4`u؋|$vD$TD$XD$\D$`jL$4|$Q$T$UT$48L$le3 D$0|[^_]ËT$4BBыD$(|$(F $Y$8T$4L$8L$$RZ떋܆RtL$8T$ $ЉD$8D$,2|$뒋&?1ɉ/_8E1tL_8&'VSt$ t+tv$ tut$ [^s[^fUWV1S,$,rD$ @t&,;D$@t$$T$Dt&;t$uՍF D$G($D$r뻍v~tL$@,[^_]É$1:s,[^_]VSÃD$$t$ lD$(tлtLT$L$$Ћ~ t̻[^Í&̻u߉t$$\$ [^WVS tt$0= = ht$\lt$)Ի x@ptld܆Ȼ%Ԇ h; T11|D$ɉ xzTT$$苡 x$T$T$hT$/lD$h$OIlml%xpqt&у|uɉ pM8tW{$Ƀl;<$Bh8 x p= zvt&lv lt$hZhlt$MZ%xh 1[^_Íd8 l p5tօ5t2=p%0l$ 1[^_Í&D$D$|$xT]&lt$BYl1 [^_Ðt&8xt&+v{ػ| DvKlt$Xl1t [^_Ívl$atlh\$$F |$lV;p lt$Xld |$ld|$$aEt&D$؉D$VS$=t0 \$0Dt$fWHt$D$45Ի x@pLPH܆Ȼ%Ԇ h T11XD$\ɉ TTT$`$(\ T4$T$T$DT$`HtH3uWHt$)VDHt$VD1%x$[^Ë H%xLt-vƒtuL~ t5LtuPx]ډӅۉP=L`D$\$1[^Ít&yx뤍&{Ht$TH1$[^ÍD$D$X$$T\T& H`$\VPHD\$$B \X$v5ػ| DSvUWVS<8t$P x@܆5ȻԆ hD$t#$;$$h\$$Ht&?@ \$ 3>t2C4$_99D$$D$/$$\$ C|$|$^}\$ t&\$ 臬D$/tT<$D$C=ThsL$/lj$$4t;>t<$(fރCuG\$ D$ \$ $D$t.D$D$8$=D$$e%x1lt<[^_]Ðt&8:D:)\$ 8{T$/$Ƀ\$ qD$/$|\$ Sv%\$ ,$L$/T$$\$ L$/|Ɖ$"$4;34$dD$D$*pv'D$D$?pv'D$pdu>=t tJ u1uD$ vD$@svvD$![vuD$?BfWVSD$$t$ uft$=N1ۃ~É$$ 6$b\$$6$5(/8&C;ã,(t# =8uԉD$L$<$,:u$5$b,D$$؉$"6= ~t [^_[^_Ðt&s91ۃ[^_Ð1T$ t':t"$D$ D$f2H£1ÐdT$ t':t"$D$ D$#2H£1Í&'T$ t:tD$ D$$11Ð&T$ t:u $1Ðt&D$ D$$1yҍvWVS1Lf CtD$<$?5u[^_f[^_fWVƓS1̛f CtD$<$4u[^_f[^_fUWVS,$_3)ƒ$_l$M\CMC-tu\" Љt\FVtfUvt9dŀuσ@@\CCC-9D$tsut&\eFVul$,[^_]Ít&t\" ЉQ\?CCC-=31Dxt/9uY1zD$D-D$tT$/L$T$Dt'59t?D$<9 0Dx1/T$$)D$$)D$W$h)D$$P)(D$n$8)6D${$)'11D$D$$O#$U8$[^ÍvD$D$ 0D$ D$$+$[^D$$h(1{ ^L~uct&; dR`u名t&^L+ҸJEE5t$:+t&D$L$x P^w=]t tfH1|Í$H1Ít&SD$(\$$t \$$D$ \$$1[ÍS^D$^D$D$D$$9^[Í&'D$ D$$ Ðt& D$D$D$D$$ Í'S1\$T$ 1t$:u9ZuBu[ÍU1WVS1ۃ,T$@ uf|$D / th\uC>D$ ȅtLCD$MD$t|$t D$ |-tXwЉE\$|$|$\$ T$1s"T$T$ D$T$ T$Dr;^p5Wǃ뽋D$D\$ ( c|$D\$ / OL$D\$ ) ;D$D\$ ( '|$D\$ / L$D\$ )D$D\$ (|$D\$ /L$D\$ )L$D\$ )\t{0|$~Љ<w.Lt{|$~Љ<wLЉ\$\$|$D /SPFɃ0GT$ L$D)"t$D ?t9ȃ ]Ct! ^uL$D)|\thL$DȀ)T$L$9 T$L$DxaT$LxT$ E|Cu|-u ?t9tPȀ|$D/T$L$T$L$DxT$T$uT$DptT$ȀfUWVS,\$@($0 $L\$$ št$8}<'uLD$E8uut&8ˍvt T$uuZf<"tD$E1ɉ< 1<  u2ufT$1ۃv À  tډ,$MD$KT$T$4$D$XD$,$L1,[^_]ÍE멐UWVSL\$dt$lt;u|$`L[^_]É$D$SD$ ҉DՅT$u¡l D$D$$u¿̛Ɠ'lD$D$$ _t>tD$\$ u¡l D$D$$Z_uƒ,[^_]Ít&' t%lD$D$$5D$ n|$1Ð,\$ø!|$$1ۉl$(Չt$ t ;$+( i-se@archf@)`@ t$\$/': t$$L4$,\$t$ |$$l$(,f$Ǎ@!a@reve@rse-@ Yv'S$p+ËD$ CC CD$$CCC CTCC$PC({C4C8CDCHCLC,C0^C`ChCdC+&'VSÃxtP,@D$8$t$SCS0CD$C C,9|R)‰$ChxRT$D$1%x[^Í)Љ$辺ChyC,9C0t8$ChS(P닍t&C$Ch鐍&\$t$t$ x@E|%xFLv t؋t$\$ÍFPD$D$FL$~ÉFL؋t$\$Ít&'UWVS<|$T\$P,k<E<uhE= U= ==0@=`O=HCsLsLCt S@CS<~(t$Cl$t1<[^_]pCLx{Pt {QS C9  CP$K <D$ L$T$qPkD9S ul$ T$*Knl$1yPv@f܋sLt$Cl$EKC<$CLCD$S,C$臏C$TC(Pb-y{ =T;=X[8|$$$JVv `w;5X}@8t$$$Vt#~v-|;5X|k C)L*9l$C9}RL$|$$D$ &CD$ -8|$ l9K u؋D$|$$)ЉD$CT$S 5T X9C)|9C 8 1 95XS ߋCS ҉T$$ @CD$C$%CT$$ SC CCK CkdshL$$aCH؅CHCK kdshL$$8t$D$ D$$~kd9shDCD$C$[!S 95XCC0KCDDCD$C$!S T$C8D$ D$|$${C t&'UWVSD$ x$ GD‰ClA1t.t uC1$KɉC~"1t&C,m,9u,C(C,KCD*C$gC C8{HC`$SCdTChCzu7&$CL$D$q‰[^_]t&1[^_]ÍH8$B$8CT$$SCK(D$7&D$%t&S\$ $PCL$D$~ 1[͉[#t"D$jD$$(Í&'VS~!1ۍvl$ D$9u5([^Ð&VS 9~K9։~5T$$ D$$9֋ }t&009uCtW`[^Í9}5$ $z C@CC$C  CC$C  C$jCC$S`C R@[^ÍvUWVSD$ 4$[t}TX@D$D$P{1C\D$$@@LC1t$<\[^_ÍvXTD$D$PhL£@1t$<X뫍't@$( t @|1É'VS$d$>@Dd\$$ \$$dD$ $D4$v (41ɉڅ $~X1ҋp1f ʃ9}d|,$1[^Ðt&tp1ĉ1҉$v(Ot&L$D$$LwL$W& t8uvЀxPup1 f,$\$t$ |$$l$(u4-H^(;\$0uBu>\$t$ |$$l$(,f1;tuЋ-H(+-P;\$0tčct$0 <9~=@tt$49҉L$01ҋD$4$(ơT9D$0;9D|= $; tu/9=H%9!))9D$0~t&)xt&9(vWuMtYV)9|P=4u>9|l5(v9DO-P)믍t&; u1D$jD$$(땐t&vN uDuD$jD$$9uI&;\$0t&4|$0l$4flD$D$9u)$t9=@t$4L$0"5Dx{vL$0D$4$45DxMD$jD$$T$0n|$01ۋl$4flD$D$9u@WVS$|$ 9t^;=V)ƅ~U1ۍvl$ D$9u䡼D$jD$$(=$[^_át8tt1ۍt& D$jD$$9ufVS\$ Cw^(t)l$D$l$[^ÍvlfD$D$$D$ gÀu tlD$D$$D$ ؃@@9aDXO[@6l?D$D$$D$ :t&ST$L$҉xF tYu [ftFۋX[Í&=([Ít&ȃ)[ÐKdpD£,1Ív'@@ LL(\\,<<0TT4XX8PP<DD@ ,D$4D$D$0D$ D$D$D$$ t`XT,D$D$P3L£@1t$<1,Ív$ @t$LLt$;  @((L00<,,\44T88X<<P@@DÍ& d,$t$1 ,\$|$$|$0t$ l$(ddD$ $tbh,$ƍ@$z u43D3@t$ |$$l$(D؋\$,Í&l$$df;t;$ƍ@$ 1t.d$D$(V$ 1 c'WVSt$ 4$m~]1ۡl$ D$9u4$m=1t&(9Z(Du8[^_É4$mvD$ tD$jD$$Ívtt&UWVSD$8L$Le$1T$D (G:9Why$9$t$8|$DN$9ۉE T$8\$D+l$89$T$`+L$D\$TL$Hы$yt 9Ǎq9D$@D$H9$ ; ى\$4$yt 9؍yu\$49|$@ $e3DĜ[^_]Ív$+;tl 1)9=45DD$L;$zL$L;H}@ ~$DŽ$DŽ$$T$ T$DL$p $T$D$=Í@ l$ D$D$8$(8T$DL$8f-|P9DNH)v$ T$8 t$Dы$:t# t&I:NމэQ+l$8^9։+D$DT$`\$TD$HD$@T$,OT$,v  GN9ÉL$\ 9 N:OD$<L$4 l$@L$\t$Pl$<Ɖ|$XD$4T$4t&9|$4s!A:Fu։< VE9Ӎyrى|$4t$Pщl$<|$Xl$@D$<t$X|$dt$4T$LL$LҺDH9 $T$PtQ $\t t6D$Lu@|(T$8t=pu;t$@=(EȡUp|$H=D$@x=|L$1D$<$W x(u);D$Ht#;H~l$H;-T}+P(t&1҅uH);|~9)1DH)á9~ D$d)$5l$趸 8 D |%xc[ MD$E T$8$T$8E - fD$dD$hD$PD$D_v FD$F T$8$T$8F 5  FD$FT$8$HT$8F5 -D$Pڍ4PSK9t$XOt$XF‹5%))É\$$ D$$5<\5D$H ND$FT$8$T$8F5 VD$F$YF5 vD$L @@t&H|VD$FL$<$L$ 0$t$&D$ $IڅtE pPt8)މD$t}︌ur1u=u)E$L$P$T$X\Ív΍&ftߍ&|$(>ufzt&D$(}t$)EU&$ˉ$Ɖ$D$׉$ىxt#$$$ĬÍ&D$D$\$4$̩Ǎv' x6@v T$ $Ё%xÍ'tT @tJt ,t1ĬÍ@071,ĬÐ$`D$`D$$>> >l>ht G6`>*>>D$D$`$@&$D$$D$$謬D$$蘬D$$脬D$$pD$$\D$$H @>D$D$D$$,D$D$D$$ {St =@t_t =,t Ĩ1[Ív\$D$$踢\$D$@$蠦1,Ĩ[Ít&\$D$$x\$D$$`\$D$$H\$D$ $0\$D$$\$D$`$\$D$$\$D$$Х@ hȆt(' t&t&'̆t  $Ѓ Hht@C &`uR$($`D$$ةD$`D$$Í&'t&D$D$`$觨É' uR$w$kD$$'D$D$$;Í't&D$D$$Ív', \$$D$0t$(t]]tStWu@`uLÃ@@9D$^tp\$D$D$D$$5\$$t$(,Í묐D$D$ƃuD$^?맍&yDpterv'VSÁx΀xpt$$4$衞t$D$$艦\$4$訞\$$LD$t$$TxxĔ[^Í&t7Tfat&'D$uzu ÍvD$S\$ 9t)1t\$$%%[SZtŃ[ÐS\$ $Pu& 0҅t\$$%Ȟ1҅ƒ[Ív'X4S[",%xt[,utD$$褝t& &1Í' 31 f\$\$ |$|$$t$9~؉)ߍG$8|$\$Ɖ$>\$t$|$Ít&S4\$ 9|0&4D$8$849~׃[&UWVS,5TX 8^9ƉD$ D1D$~<~t9< t)< t%ېyt&< tt < uDD$މ݉fD71ۍV< 1<  u9T$< u|$~t#,1[^_]Í&< t9T$O|$~u݉)ݍE$WǍED$8<$؉D$苜D/<$螣<$Dt$\$,$5,$,,1[^_]f<1~$Zt$\$lj$5<$Bt&'SD$ \$$D$$.D$ áD$ \$ D$D$$b$ D$M$0[ÍSD$ \$$D$$.D$ CD$ \$ D$D$$$ D$͡$谝[Ít&'UWVS1ۃl$4,$+NjD$0$9lj%\$0 9|$l$$&u[^_]Ã1ۉ[^_]ÍD$D$D$D$w&D$0  D$0Ð&S1T$9t[fcDX[ÐS1T$9t[f3DX[ÐSD$9t Ã[DXtE[É'SD$9t Ã[ÜDXtE[É'S1T$9t[f胜DX[ÐD$tcvÍ&'S\$ $@$\$$ٝ[Ít&Se$1t$YT\$,D$ 9D$D$$D$<$D$~$T$e3uĸ[ڞv'S\$$tGT$ \$ D$$T$Ú$ D$讞$葚[Ít&뭍$`Ð<\$,Ét$0։l$8͉|$4]D$t~1t&h]9u_]NjD$$\\$$D$Gp8u(,$k\$,t$0|$4l$8O^t$ .$1붍t&t$$h$4-fc,농S=tG\$ T$$tX|1 $u$1҅‰[f t& u6ۋ $x< ɉ y1뒍t&T$ T$ 뻐ى $뺍t)T$M$,1 t\$t$|$=It =H<<$|T)t#88 uqD$|$$ɝu]\$4$9-5Tx*D$$1\$t$|$Ít& ǐ\$t$|$Í&'< \$,á t$0|$4ׅɉl$8puoQ @ $D$gu!51\$,t$0|$4l$8<Ív^uǡT$$D$$D$[t}T$$T$u\$,$T$$M$ET$,Mt&$&1ҍ&L  u$ t&\$$T$,$T$蜚f 1$Pt$ơT\$9t)T$$u2P19T 1\$t$ÍPD$T$*붐&҉\$Ét$5T|$=PD$$~D0TD$$P/1.\$=P|$5Tt$f{/TD$$P0 1Í't$t$$|$|$ \$9t(t$<$Yt$<$)19‰1\$t$|$Ít&SD$ T$$xHTT$$.T9t D$$i=^u TP1[Í&؉D$ [ 'SD$ T$$xHTT$$/T9t D$$=^TuP1[Ðt&؉D$ [)'S\$ D$$xhTtND$$-T9t D$$=^t1[ÐTP1[Í&%1[Ít&D$ [&ST$ D$$xHTD$$:-T9t D$$=^TuP1[ÐD$ [&(X$TD$P:1Ít&UWVS5Tl$0 8Nt&u&T u6Tu1uD$4$=^tH1[^_]Ð tŀ u"뤍t&T1ۀ À ‰ uTusTP1[^_]#1[^_]UWVS5TL$0ɋ 8OD$0D$0&l$0|$0u0f t t/uITTul$01|$0uD$4$=^u TP1[^_]ÐTt1ۃ à ‰ t0sv1ۃ É1ۃ É Q/HTTu2"1[^_]Ít&'Tt뙍 t7t& u^uPT1 S\$|(u$&t&tIu퐍t&K1[Ð$ A404P,PÍ&' D$0 x, Í&,t$L4,0t/P,P0$4護,tÁ%xfS1,uVs,tI 0 tx 0tHt< uD$ -D$ [Ív1[É'S 8<Q9|B@t@$<D$< 8Q@\$ 8[á@<$z 8Q@뼍v'@t$l@,8<t$蝠,0%xÍt&'Sxub|u 8x1[Í&@t$&$蛴\$$迈$wx 밍t&VS @twyuH\$ t25@4$‡$7t$$[$u΃1[^Í8P8@D1[^u낍v yT$tH @+X88%xD$T$ & Ív'[VS$\$0t$7$蘀D$t$$ԃtWtC趀 tuRt$f$H$fyҍt&$[^Ðt&D$$[^Ðt&x$[^f hdS)ӍC9N[ h9dÍ&'1҅t hhxT$fh h9dÍ&'T$,x,Ít&'Lp$@ $D$Hl$($<$~1󫍜$҉֍BI 2) t( ,\$ l$DŽ$($,$(D$D$$$<$@$D$HLÍv'S,D$x,x,[Ðt&U1WVS\$0$藰=dơh9tD&=Mō^:u9$^_á$V3xu0'$PWs&%xu0tȆtЃ:fÍt&$C$ aT$ @@É'[D$D$ $8}Ít&S^^\D$$aXD$`$aPD$ {$`TD$`z$`lD$|$`pD$|$``D$ $`^[ÍvWVS D$|$4D$D$0D$T$`vu \$t$u @uuۉ5=$T$O4u [^_Í$)01D$ D$$@tOt\55 D'$yt&P$B+0txD$ D$$sjۉ?D1$y랐뮋T$D$t  tÍ&'p$PoD$$Íp$ oD$$`ht =t CvztÍv&UWVS,\$@p1t $nŅ۸RD؁=Dt$菌Ht$~DHD$4VI1LPTX\`dhlptx|<,[^_]D$,$OhDHD\$$T$p1ۍ|$t&4|$$[wu܋1t$9m1҅=4~5~u<$lu|~`f@^,1[^_]Ít&D$,${ m1[t&$Ll1҅$=%+ v$LH"$6D=4\$\$$t$t$ td~5~4t'~/\$t$ÍCۣх͋\$t$Ít&H$덐kt&'W1VS|$ t871 vt0:u|$$ouuۋ[^_Ív1[^_ D$ $m1Í&D$D$ D$$D$D$ $pÍt&VSt$ t>~.1 D$jD$$p9u܃1[^Ít&1ۅ~f$D$`s9u1[^Ít&$ D$8s1f ht]t4t1ÐLtD$jD$$Wo1Ð$D$p$~l1Ð&t!tD$jD$$n D$ u%ttD$jD$$náxuۃÍvT$ t- t#|$$t'D$jD$t#$cnÍ&; ^u덶 $@nÐW1VSt$ >4$lÉX;4|f8 ڈ T9~8\$t$$vh(u*TtJD$ D$T$$CTأT8XX[^_Ð tyuA9u+qPQ뱉$XG'UWVS,D$@t$D9~‰֋X9~ 9Љ1ۅI؉t$)߉$\X)9ӉD$}&f 8,9l X)9ދ(D$t0$X8)X,[^_]ÉvD$ t$\$$뾍&'TX9~!TL$tP9xÍt&yTԣPfPÍ'\$\$$|$|$(t$t$ 09~4T1ۀ>t 4$gP؋t$\$|$Í|$$Y뻍&t$t$ \$|$|$$4$1j;4}?8t$$jXtD$ \$t$|$v$뷍&'D$ D$ D$TD$8$gX9| ^ty XÐ=^`fu8T$D$$hXv D$|Dt9T9 )‰ЉTy T1 fTyTf؉D$ fSD$|std TX~!^1҅u1ҁ=^`f‰)Ӊ9|! Ty X1[ÍTXӍ؉D$[VS\$ t$$ctYuP|{t>T V~ D$8D$$xg܅u(T1[^Ívt$$\$ [^T91[^Ðۉt$$\$ [^ \$\$ t$t$$btCu:|mt%X9Tt>$9Tt<T1\$t$Ét$$t$\$ \$8=^uʐ&{뵐ۉt$$t$\$ \$&';t&'kt&'T1ÍvXT1ÍvVSt$ D$$t&Tu;fT8\$$c$ۉT~hwav¡uTD$D$8${e렍&T8\$$6c$tBTt8 avơuTD$D$8$e뤍v1[^Í&Tމt$ D$$[^t&S\$ D$$St&T;XD$8$nb$TX9u9fT;XT}cD$8$"b$tF`vġuTD$ D$D$8$}b;XT|71[áTXT9RD$8$a$&o_vuTD$ D$D$8$aۉ\$ D$$[Et&UWVS\TT$eD$L1D$4$QD$TT$_T$D$DD$H$T$;\$D$ލv8t$$`^v ~$twl$M^t u À9tݡ809|$~6qaDXtf,΍9|$D$ʋT$1TT$Le3\[^_]Ðt&8D$ D$t$$?`D$tHfD$&9>aDX._,&D$D$DD$ D$T$,$)D$8D$^PT$,T$Ӄ$hf$d;D$T$D\$3T$D$$`~D358D$\$4$]\f؋\$D$1ۃD$,D$$u_$fp80D$ÉD$,7;3 c$@}8$D$y$迃y18Ív'|u迯jy18fD$$D$D$ $t1Í&' x@ v%x1 Í\$t$|$|$ x@%x9tYBtr A 1\$t$|$ÃCt[DuZv t$<$ 뿐S^DXt\Buvt$<$fcZv tEt$<$jt&t$<$U&t$<$|=&t$<$$% UWVSL\$`eD$<1|$dY5-5D$ D$D$$D$$2[)hD$+1-zfYt yu D$)D$)D$*$|1fT$58\\$t$$ Ë$rCt$\$r1[^ÐtDD$$rP$ XT1f1Ðt&\$t$t1\$t$Ðt&$ p584$ã7D$pt$$D t$\$@P1Ít&'t$,1ÍS\$ D$$VC^P XңTuTP[ÍUWVS,8$KC$o\$$C5 D$e;D$1t~Ctl9DD$$,= tf; ut$Z=8<$B$*o|$$NCC@uD$5 $D$D$$χD$$o,[^_]1 >1 Ð&VS\$ |rt==8tGr1t%u$D$c1[^ÍvtDءTu'Xt8럍ۉ\$ [^ ;XD릉'S\$ |{u 1[f=8tBft'u$D$Z1[Í#1[Ít&Tu' Xt8릍ۉ\$ [;XDӐ&S\$\$D$[ D$$$ ^^D$e1 ^1 ^^~ D$ ^Í |tT$1 ^1Ív5 ^1Ð$Al@PPP t@fD$@PPP t Í&Ðt&UW1VS5tItC$ ?NjC$?t&$>ŋC$>u܃[^_]Ív'Ív'T$1x; t ÍvÍÍv'1;t tÐ1tÐ1;tÍ'D$+<x;}tÍ1Ðt&1Í'VS\$ $ +jۉt!$=$j\$$6>ËD$$FF[^Í1T$ tRt  8 t Ðt&D$ D$$}:É'VS\$ t@tFt$T$<$Ri\$$v=F[^Í'\$\$ t$t=t$TCt$Ts$j\$t$Í&1獶VSteD$l1$t;$H9V$\$,=D$ӞD$ @D$D$?$D$I@ڋ !%tDJD)ڃ$g\$$ <D$4$ DD$le3t[^Ðt&2$g tt$1~ 1&\9u<2D$$g~<&\$\$ t$|$tGD$${1t<$4:$f|$$:FCF؋t$\$|$Ã,\$\$0|$$1l$(l$4t$ xs;}k$ Kfơ<,$9$.fl$$R:oD$8F,$9$fl$$':F4\$t$ |$$l$(,ÍD$$\$t$|$l$ |) 9}t=tx%t9Xt]$t$|$l$ Ðt&1҅ɽ ۍv9~!4t9^uul$nۍvxuT$P뛍vV1ST$ x359})t% t\9u[^Í&'WV1S=D$ I9~g)1ۅ~"v$e9u) 1<1҅tf9u55[^_Ð ؅ufÍt&'Ív'S~,1ۍv$9[ÐS t\ $dKu[É'<\$,ËD$@|$4Ϲ)׉t$0ֺ؞l$8wؠ D9T$$c|$\$ʼn$P2D=D=:D= T$$T$7\$,t$0|$4l$8<ÍUWVS,Ät#|$$T$1T$t,[^_]Í|$$T$1T$KD3$u5&v>tB(uB<Q>H$?nf9uǃ<S,n[^_]À&t$uԉ|$$T$1T$31fvt(9ulD$@T$$0T$uvt"҉T$$T$0T$Ef3tE\u|3 t'tߍ&9D̍t&ÍvD볍v,[^_]É|$$T$80T$|3()i<>D3<-t<<119&'UWVSÃLɉT$8ƒ|$8L$< ˆT$7t1< D$D$0D$(\$,t f< u;4;uD$(L[^_]f< t:|$$t'9D$$+D$$T$,hD$ |$7t9|$8}T$89T$$ T$D$<D$9D$0~{T$D$(,$ L$_T$ t$T$ʼn$.T$ D$D$DT$(L$)T$,.< < t$,'vD$0 D$0D$D$($_D$(`v @ts|$$,;El$,t}t$ ;,;t-D$4$-u߉t$ +D$$l$,D$ ht$ +D$$l$,D$ hD$$|$$D$ ؉D$,D$ D$(.UWVSÃLT$(T$dL$e L$<1ɍL$4D$4T$,T$(D$8L$$T$ T$-l$ K;D$><3tI;D$t@[,v ?\uD+;D$ƃ<3uv9t$ +D$ $@]1҉D$$19t$ }PD$ |$ |$$t& 9}+ \ul;l$uL 9|f|$ ЋL$$D$,tL$,?T$(D$$L$Mt8I8l$$u-t "~|$${'b \i'Z9O,߀}Uvt$( I1\$88ȉ\$,4$U\$8$'$dT\$$(\$<1ۋ$e3"Ĭ[^_]Í&D$DT$$K#T$l\$4$ЅL$8t$( I\$88ȉ\$,:D$0# 11D$$D$HD$PD$TD$(3vD$$9 oD$(9l$0D$,8D$(uʈT$L$4!T$v I;D$4(;D$4"Nt&tuD$$9T$,o:9l$0Ut&\$<3\$89\$,t D$,$ST$P#D$T1ۅvT$,D:D$@$q!D$0)$RNjD$,<$D$4&<$|%É;\$$|&L$$+D$$4$L$$L$NRƉ)|$$%<$RD$0hJD$H$D$$9uL$,o9vD$$@L$$4$T$L$QT$v$L$,$\v>vۍD>D$@T$L$ $ T$L$ t$(؋T$8<D$8&<uft$DD$4L$|t$,$\$@ˉL$XD$|DŽ$DŽ$DŽ$T$LfD$|EEl$$u9>u͋\$@l$|t$DT$LE!ကtDȍEDɃ+l$X;\$$|&T$$+D$$4$T$$T$PƉ)L$|L$o$#f+T$$T$$'\qD$$9G\oD$(t&T$8$"$OL$8L$$!#T$<T$,oD$$9+T$,:J+D$HD$HD$$9"o~D$,|8$t1ҋL$,oD9<'u)<'t<\vuހ|)ԍt&D$DT$$+T$tL$,|$ $ЋT$T$DŽ$DŽ$$MT$|$pD$L‰D$$T$T$o Il$pD$tD${D$zD$yD$tD$D$yD$$l$pD$4L$4T$,D$@*<:<%|<*& <$ <- <^ xЉ Y T$@M |$,1D$P\$@TPXЀ v\$@T$P<^<*6 ҿ$ 9D$PD$D҉L$p|$D$D$,ËD$L$+MT$<4$ML$89L$,D$,$MvD$0$KD$,IT$,BB:Bs\$$D$0D$$@D$$4$D$K1t 1|>$'u$&'t\uހ|ԍt&D$$@T$$4$T${Kot&D$$@L$$4$L$[Kt&D$$@D$$4$D$;Kt&1D$$@D$$4$D$Kt&)D$@$uJT$@|$,T$|$D$4$D$4L$@D$É;\$$|&T$$+D$$4$T$$T$JƋD$4D$)$+D$4$Kfv D$p1҅tL$,D<"t<'uЍD$pD$D$,T$$Kl$pD$4vD$PD$Tt$(1=L$p<$$FI|$$jǁ<$$I|$$5<${4T$p\$lD$PD$\T$dD$XD$@t&D$,<:HL$,D|$4'@trL$4tg t" ttOtE't u'Q@'P'@\@'@'$F>'@'@,$&$\$,\\$41҉߉ЃT$щ $=\$$ T$ǣу |$h\$p\$Ét$|$t;$$x=\$$t؋t$\$|$Ít&$1t։$Ǎ@ $'=t$É$ID;;/.his@tory@똍&'UWVSӃ<=AD$$D$t$$Q D$(t9N1D$,š+\$,D$9~ED$ L$ |tGt8t $t$;\$tuʼn4$}'#+|$,9\1t$6fD$.$$]. 9=~DtPt:t.T$$@$. 닍vt$D$(1ۉT$T$t$$ T$xP$xt"D$XtD$ $E9\$TT$,e3u%<[^_]ÐD$$߾D$(n,\$Ét$ ։|$$ωl$(tC8t>$d4$ZD$+1t/\$<$4$&$+1t$$\$t$ |$$l$(,Ív<\$,\$@t$0|$4l$8;~C&#,$l$ D$(t!tt9uD$(1uvt$(l$8 p$gpIp|8$K )Ѻ p T8C5TT)‰$i@B)щ$$l$D$D$ D$$r15T[^_]Í&9$t;D$,)D$(D$(D$,[kvD$,([vD$ D$~uUD$ $)D$~D$ $]D$~D$ $}qÐt&D$$)TD$~D$$]8D$~D$$}Ð&T$p~pÐ<҉\$,Ét$0։|$4ωl$8tqD$D$L$E|$l$ D$D$$$|$t$$7\$,t$0|$4l$8<ÍvD$D$yT$l'UWVS,T$L$@^<TD$D$0$T$$)D>fFUU~ՈPPP2 1$ t&4Dt&F9\fL1[^_]Ð$=OЉ T J!)ÅۍH؅t 9@rM|$4$D$9L[^_]ÍGw:$߃߃߃߃߃߃߃É$ڃҍJH~P4҉5HT^ FT$(u$A A)DTDuD$(F 5'T$@$$T$ E4$T$ t$$T$D$<4@t$4" 9ʉL$4D$,T$4$tyt l$,L$,@\$(TɈXL$,L$8~?ىL$0L$8\$4\$0D$D$(TTBuD$t$,\$4@T$)t$1ED$E D$E$9rރ[^_]ÍU]Ë$ÐUS??uЋCSu[]ÐUS[=8Y[GNU bash, version %s-(%s) i686-pc-linux-gnuGNU long options: --%s Shell options: ../bash/shell.c -%s or -o option run_one_command-crbashBASH_ENVI have no name!??host??POSIXLY_CORRECTPOSIX_PEDANTIC\s-\v\$ > ~/.bashrc%s: invalid option%c%c: invalid optionlogin_shellEMACSemacsdumbetermPS1PS2SSH_CLIENTSSH2_CLIENT/etc/bash.bashrc/etc/profile~/.profile~/.bash_profile~/.bash_loginFUNCNAMEBASH_SOURCEBASH_LINENOmain%s: is a directorydebuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfileUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -irsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. /usr/share/bashdb/bashdb-main.inc%s: option requires an argument%s: cannot execute binary file$[P"0pC,'܇1H;L@ЇFԇPpC= 0\8Ɉ4timed out waiting for input: auto-logout PROMPT_COMMAND/%s TMOUTreader_loop../bash/parse.y ; ;|&syntax error near `%s'syntax errorreadline stdinTZ%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEesac#%^,~:-=?+/evaly.tab.cUse "%s" to leave the shell. "$@"COPROCexpected `)'-ncommand substitution-p&&||<&>&;;;;&<<-<<<&>&>>>|thenelseeliffiforselectwhileuntildone[[coprocB|X,B+,,B+B+B+B+B+B+B+B+B+B+B+,,,,,,,,B+B+B+B+B+B+B+B+//B+B+-B+B+B+.B+B+B+B+B+B+B+B+B+B+B+/B+/[0B+B+B+020B+B+B+2B+B+/2B+B+.B+J1B+T1B+1B+B+B+21/,/[0  iä /E8Bsա <mԢ;l0wj._Ɯ(^'X-d؟F|Рݠ%Ր%,5Lcju|hΒ48~#Z&Q-k+I2Pn~К '=U]#{֧   (1ժ  ܪF  P `~éW43%339.f6-3G3fh#kPp3333333333333333333f333333333Q~  33333333333333333333333333333333+3D3=3333H33)3333333333333333333333333333333333??333333<33Jl33,.33)3333339333833 333333:33)3LP333WWW3333 33;G*333n3V2W?3+333333333Z333q333333v33333kA33333oE33vM3333331;<827695:  !"#$%&'()*+,-./04 ' ~75<=%?><BE 53 !<0E5  D3 ;!"C334;12|}7x9;83!"9;234;933=>993!"339988~333993998;28()*82342342()*#$%&'+,-./<)67#$%&'5+,-./=>67"#$%&')+-../<:5<679::? ::!"#$%&'123+,-./:3467:9;  ::::4#$%&'+,-./234679; #$%&'+,-./3679; #$%&'+,-./679; #$%&'+,-./3679; #$%&'+,-./679;#$%&'+./67@AEw (v)&(85=rs5><wKv F|} d?eyz~LB !f|} !GHIMhiwGH-9bc=gjk?55lm.:no>wpq t  GHI55GHI#$%u,38B4NOPQR7S;<TUAVWCDI  !"*+/10 !6D 2EF JK LM@ 'GHI !  !  !  ! C !XYZ[\]^_`a45o69;<@JDA>F?EGHI4jf& /)#,23 4:7=hgp("1+%. '!0*$- ne8cbiktUVBCd`m_z|~u]KLWXal{}^MNSTYZqvwsxyQRrOP[\  =>>>>??@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@AAABBCCDDDDDEEEEEEEEEEEFFFFFFFFGGGGHHHHHHIIIJJJKKLMMMMMNNNOPQRRRSSTTTTUUUUUUVVWXXYYYZZZZZZ[[\\\]]^^^_____`````aaabbb33l3333334333333T33634333"#$x%&'()*+,-./0129:{J;3467 {();&| '()   !syntax error near unexpected token `%s'syntax error: unexpected end of fileunexpected EOF while looking for matching `%c'unexpected EOF while looking for matching `)'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional command../bash/general.cOLDPWD`%s': not a valid identifier/dev/ttyPROMPT_DIRTRIM=~:~getcwd: cannot access parent directories`"../bash/make_cmd.csyntax error: `;' unexpectedsyntax error: `((%s))'clean_simple_commandsyntax error: arithmetic expression requiredmake_here_document: bad instruction type %dhere-document at line %d delimited by end-of-file (wanted `%s')make_redirection: redirection instruction `%d' out of range  ../bash/print_cmd.c%u! ) && || {%s}<<%s%s>|%s>> %s<> %s<<< %s{%s}<&%d%d<&%d{%s}>&%d%d>&%d{%s}<&%s%d<&%s{%s}>&%s%d>&%s{%s}<&%d-%d<&%d-{%s}>&%d-%d>&%d-{%s}<&%s-%d<&%s-{%s}>&%s-%d>&%s-{%s}>&-%d>&-&>%s&>>%sxtrace_set: NULL file pointerPS4%s=(%s) ''%sfor %s in select %s in case %s in case %s in [[ '' ]] (( )) time -p for (( | if then else function %s () { } { coproc %s print_command do () cprintf: `%c': invalid format characterxtrace_set: %d: invalid file descriptorxtrace fd (%d) != fileno xtrace fp (%d)print_command: bad connector `%d'8@x@(@8`xpXh( X../bash/dispose_cmd.cdispose_command x0 xP@  hcannot duplicate fd %d to fd %dcannot redirect standard input from /dev/null: %sexecute_coproc: coproc [%d:%s] still exists%s: restricted: cannot specify `/' in command names%s: maximum function nesting level exceeded (%d)TIMEFORMAT: `%c': invalid format character../bash/execute_cmd.cexecute_cond_node/dev/nulleval_builtinbuiltin_envreturn_temp_env%s_PID%s: %s: bad interpreterbgfg#? loop_redirectionssimple-commandauto_resumeexactsubstringsaved redirectscommand_not_found_handle%s: command not foundPS3COLUMNS%*d%s%s%s: readonly functionexecute_commandfunction_callingexecute-shell-functionreal %2R user %2U sys %2Suser %2lU sys %2lS real %3lR user %3lU sys %3lSpipe errorpipe-file-descriptorslastpipe-execexecute_connection;;s;V;F8660554P3t55=d ../bash/variables.c%s=%s: %s: cannot open as FILEIFSOPTERROPTINDignorespaceerasedupsignoredupsignorebothHISTFILE_=LINESPPIDshell-initSHLVLBASH_ARGVBASH_ARGC60060~/.sh_history~/.bash_history() {+ i686HOSTTYPEOSTYPEMACHTYPEHOSTNAMEMAILCHECKBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRINGIGNOREEOFignoreeofHISTCONTROLHISTIGNOREHISTTIMEFORMATEUIDBASH_XTRACEFDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMBASHPIDHISTCMDCOMP_WORDBREAKSDIRSTACKGROUPSBASH_CMDSBASH_ALIASESGLOBIGNOREPIPESTATUSFUNCNESTHISTFILESIZEHISTSIZEHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRhistchars%s: %s: invalid value for trace file descriptorall_local_variables: no function context at current scopemake_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1pop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scopeerror importing function definition for `%s'/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin../bash/copy_cmd.cH HxhX line %s: (null)last command: %s Aborting...warning: %s: %s:%s%d: %s: %s: %d%s: unbound variable%s: readonly variablebash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jumpK0d0z000../bash/expr.c%s[%s]invalid numberinvalid arithmetic basevalue too great for base*/%+-&^|syntax error in expressionrecursion stack underflowmissing `)'exponent less than 0division by 0expression expectedbug: bad expassign token%s%s%s: %s (error token is "%s")syntax error: operand expectedsyntax error: invalid arithmetic operatorexpression recursion level exceededidentifier expected after pre-increment or pre-decrement`:' expected for conditional expressionattempted assignment to non-variable33333333333333333333333333333333333333sa\bXeTfPh8Gi,kLm0nHpr tDu<v8x4B,GC@EH4GI$P(T../bash/flags.c../bash/jobs.cSignal %d[%d]%c |%5ldDoneStoppedStopped(%s)RunningDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s) %s: line %d: (core dumped)(wd now: %s) notify_of_job_statusstart_pipeline: pgrp pipe[%d] %ld [%ld: %d (%d)] tcsetattrSIGCHLD trapno job control in this shell%s: job has terminated[%d]%s (wd: %s)fork: retryforkchild setpgid (%ld to %ld)job-working-directorydeleting stopped job %d with process group %lddescribe_pid: %ld: no such pidwaitchld: turning on WNOHANG to avoid indefinite blockinitialize_job_control: getpgrp failedinitialize_job_control: setpgidcannot set terminal process group (%d)wait_for: No record of process %ldwait_for_job: job %d is stoppedwait: pid %ld is not a child of this shell%s: job %d already in backgroundforked pid %d appears in running job %d../bash/subst.c$($[<(>(?*+!@#%^,~:-=?+/}#%:-=?+/}%:=+/%s: substring expression < 0%s: bad substitution%s: parameter null or not setprocess substitution-Ano match: %sbad substitution: no closing `%s' in %scannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1%s: cannot assign list to array member$%s: cannot assign in this waycannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dbad substitution: no closing "`" in %s                                                         (( K' H( ( K' K' K' ( K' ) K' K' * K' K' (* (* (* (* (* (* (* (* (* (* K' K' K' K' K' p* * K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' * K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' K' + ../bash/hashcmd.c../bash/hashlib.c../bash/mailcheck.cYou have mail in $_You have new mail in $_The mail in %s has been read ../bash/trap.cinvalid signal numberSIGexit trapdebug traperror trapreturn trapinterrupt traptrap_handler: bad signal %dEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myself../bash/input.cerror reading input file: %scannot reset nodelay mode for fd %dcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %d../bash/unwind_prot.cunwind_frame_run: %s: frame not foundunwind_frame_discard: %s: frame not found                                                             x > > > x x x x > > x > > > > > > > > > > > > > > > > x > > > > > > > > > > > > > > > > > > > > > > > > > > > x x > x > > > > > > > > > > > > > > > > > > > > > > > > > > > > x x ../bash/pathexp.cargument expected%s: binary operator expected%s: unary operator expected`)' expected`)' expected, found %smissing `]'too many arguments%s: integer expression expectedH (  Ⱥ  h        h 8                    p 8           p 8  (   x X H (   release4.2%s.%d(%d)-%sGNU bash, version %s (%s) Copyright (C) 2011 Free Software Foundation, Inc.License GPLv3+: GNU GPL version 3 or later This is free software; you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. @(#)Bash version 4.2.10(1) release GNU|FHFHGF F../bash/alias.c ;|&( ;|&()../bash/array.c../bash/arrayfunc.carray assign'()'bad array subscript%s[%s: %s[%s]: %s%s: cannot convert indexed to associative array%s: invalid associative array key%s: cannot assign to non-numeric index%s: %s: must use subscript when assigning associative arrayG../bash/assoc.c../bash/braces.c%0*d../bash/bracecomp.c500%s: cannot create: %s../bash/bashhist.c%s%s%s../bash/bashline.cno closing `%c' in %scompletion-ignore-case;|&{(`$include /etc/hostshostname_completion_filesymlink-hookC-xC-e%s %dinput-meta "'READLINE_LINEREADLINE_POINTbash_execute_unix_commandfc -e vi#comment-begin$@Bashshell-expand-linehistory-expand-linemagic-spaceshell-forward-wordshell-backward-wordshell-kill-wordshell-backward-kill-wordhistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-historydabbrev-expand'" \"'@<>=;|&()#$`?*[!:{~()<>;&| _EmptycmD_%s: missing colon separatorFIGNORE%s: first non-whitespace character is not `"'fc -e "${VISUAL:-${EDITOR:-$(command -v editor || echo emacs)}}"bash_execute_unix_command: cannot find keymap for commandfc -e "${VISUAL:-${EDITOR:-$(command -v editor || echo vi)}}"../bash/stringlib.c../bash/locale.c/usr/share/localePOSIX"" setlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %ssetlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %s#: %s:%d msgid %s%s msgstr "" ../bash/findcmd.credirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here-document: %s%s: cannot assign fd to variable../bash/redir.csh-thdfile descriptor out of range%s: ambiguous redirect/dev/tcp/*/*/dev/udp/*/*      X X        X X     P 8   ../bash/pcomplete.cCOMP_LINECOMP_POINTCOMP_TYPECOMP_KEYCOMP_WORDSCOMP_CWORDgen-shell-function-matchesCOMPREPLY_DefaultCmD_completion: function `%s' not foundprogrammable_completion: %s: possible retry loop../bash/pcomplib.cprogcomp_insert: %s: NULL COMPSPEC%s: %s:%d: cannot allocate %lu bytes (%lu bytes allocated)%s: cannot allocate %lu bytes (%lu bytes allocated)xmallocxreallocRead lines from a file into an array variable. A synonym for `mapfile'.Read lines from the standard input into an indexed array variable. Read lines from the standard input into the indexed array variable ARRAY, or from file descriptor FD if the -u option is supplied. The variable MAPFILE is the default ARRAY. Options: -n count Copy at most COUNT lines. If COUNT is 0, all lines are copied. -O origin Begin assigning to ARRAY at index ORIGIN. The default index is 0. -s count Discard the first COUNT lines read. -t Remove a trailing newline from each line read. -u fd Read lines from file descriptor FD instead of the standard input. -C callback Evaluate CALLBACK each time QUANTUM lines are read. -c quantum Specify the number of lines read between each call to CALLBACK. Arguments: ARRAY Array variable name to use for file data. If -C is supplied without -c, the default quantum is 5000. When CALLBACK is evaluated, it is supplied the index of the next array element to be assigned and the line to be assigned to that element as additional arguments. If not supplied with an explicit origin, mapfile will clear ARRAY before assigning to it. Exit Status: Returns success unless an invalid option is given or ARRAY is readonly or not an indexed array.Modify or display completion options. Modify the completion options for each NAME, or, if no NAMEs are supplied, the completion currently being executed. If no OPTIONs are given, print the completion options for each NAME or the current completion specification. Options: -o option Set completion option OPTION for each NAME -D Change options for the "default" command completion -E Change options for the "empty" command completion Using `+o' instead of `-o' turns off the specified option. Arguments: Each NAME refers to a command for which a completion specification must have previously been defined using the `complete' builtin. If no NAMEs are supplied, compopt must be called by a function currently generating completions, and the options for that currently-executing completion generator are modified. Exit Status: Returns success unless an invalid option is supplied or NAME does not have a completion specification defined.Display possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Specify how arguments are to be completed by Readline. For each NAME, specify how arguments are to be completed. If no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. Options: -p print existing completion specifications in a reusable format -r remove a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications -D apply the completions and actions as the default for commands without any specific completion defined -E apply the completions and actions to "empty" commands -- completion attempted on a blank line When completion is attempted, the actions are applied in the order the uppercase-letter options are listed above. The -D option takes precedence over -E. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Formats and prints ARGUMENTS under control of the FORMAT. Options: -v var assign the output to shell variable VAR rather than display it on the standard output FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output; character escape sequences, which are converted and copied to the standard output; and format specifications, each of which causes printing of the next successive argument. In addition to the standard format specifications described in printf(1) and printf(3), printf interprets: %b expand backslash escape sequences in the corresponding argument %q quote the argument in a way that can be reused as shell input %(fmt)T output the date-time string resulting from using FMT as a format string for strftime(3) Exit Status: Returns success unless an invalid option is given or a write or assignment error occurs.Set and unset shell options. Change the setting of each shell option OPTNAME. Without any option arguments, list all shell options with an indication of whether or not each is set. Options: -o restrict OPTNAMEs to those defined for use with `set -o' -p print each shell option with an indication of its status -q suppress output -s enable (set) each OPTNAME -u disable (unset) each OPTNAME Exit Status: Returns success if OPTNAME is enabled; fails if an invalid option is given or OPTNAME is disabled.Display directory stack. Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. Options: -c clear the directory stack by deleting all of the elements -l do not print tilde-prefixed versions of directories relative to your home directory -p print the directory stack with one entry per line -v print the directory stack with one entry per line prefixed with its position in the stack Arguments: +N Displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N Displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Remove directories from stack. Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and changes to the new top directory. Options: -n Suppresses the normal change of directory when removing directories from the stack, so only the stack is manipulated. Arguments: +N Removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N Removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Add directories to stack. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. Options: -n Suppresses the normal change of directory when adding directories to the stack, so only the stack is manipulated. Arguments: +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. dir Adds DIR to the directory stack at the top, making it the new current working directory. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Common shell variable names and usage. BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directories given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Execute conditional command. Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators: ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. When the `=~' operator is used, the string to the right of the operator is matched as a regular expression. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value. Exit Status: 0 or 1 depending on value of EXPRESSION.Evaluate arithmetic expression. The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION". Exit Status: Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Resume job in foreground. Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'. Exit Status: Returns the status of the resumed job.Group commands as a unit. Run a set of commands in a group. This is one way to redirect an entire set of commands. Exit Status: Returns the status of the last command executed.Define shell function. Create a shell function named NAME. When invoked as a simple command, NAME runs COMMANDs in the calling shell's context. When NAME is invoked, the arguments are passed to the function as $1...$n, and the function's name is in $FUNCNAME. Exit Status: Returns success unless NAME is readonly.Create a coprocess named NAME. Execute COMMAND asynchronously, with the standard output and standard input of the command connected via a pipe to file descriptors assigned to indices 0 and 1 of an array variable NAME in the executing shell. The default NAME is "COPROC". Exit Status: Returns the exit status of COMMAND.Execute commands as long as a test does not succeed. Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero. Exit Status: Returns the status of the last command executed.Execute commands as long as a test succeeds. Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero. Exit Status: Returns the status of the last command executed.Execute commands based on conditional. The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true. Exit Status: Returns the status of the last command executed.Execute commands based on pattern matching. Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns. Exit Status: Returns the status of the last command executed.Report time consumed by pipeline's execution. Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. Options: -p print the timing summary in the portable Posix format The value of the TIMEFORMAT variable is used as the output format. Exit Status: The return status is the return status of PIPELINE.Select words from a list and execute commands. The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed. Exit Status: Returns the status of the last command executed.Arithmetic for loop. Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1. Exit Status: Returns the status of the last command executed.Execute commands for each member in a list. The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed. Exit Status: Returns the status of the last command executed.Wait for job completion and return exit status. Waits for the process identified by ID, which may be a process ID or a job specification, and reports its termination status. If ID is not given, waits for all currently active child processes, and the return status is zero. If ID is a a job specification, waits for all processes in the job's pipeline. Exit Status: Returns the status of ID; fails if ID is invalid or an invalid option is given.Display or set file mode mask. Sets the user file-creation mask to MODE. If MODE is omitted, prints the current value of the mask. If MODE begins with a digit, it is interpreted as an octal number; otherwise it is a symbolic mode string like that accepted by chmod(1). Options: -p if MODE is omitted, output in a form that may be reused as input -S makes the output symbolic; otherwise an octal number is output Exit Status: Returns success unless MODE is invalid or an invalid option is given.Modify shell resource limits. Provides control over the resources available to the shell and processes it creates, on systems that allow such control. Options: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -b the socket buffer size -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display information about command type. For each NAME, indicate how it would be interpreted if used as a command name. Options: -a display all locations containing an executable named NAME; includes aliases, builtins, and functions, if and only if the `-p' option is not also used -f suppress shell function lookup -P force a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed -p returns either the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file'. -t output a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or not found, respectively Arguments: NAME Command name to be interpreted. Exit Status: Returns success if all of the NAMEs are found; fails if any are not found.Trap signals and other events. Defines and activates handlers to be run when the shell receives signals or other conditions. ARG is a command to be read and executed when the shell receives the signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed before every simple command. If a SIGNAL_SPEC is RETURN, ARG is executed each time a shell function or a script run by the . or source builtins finishes executing. A SIGNAL_SPEC of ERR means to execute ARG each time a command's failure would cause the shell to exit when the -e option is enabled. If no arguments are supplied, trap prints the list of commands associated with each signal. Options: -l print a list of signal names and their corresponding numbers -p display the trap commands associated with each SIGNAL_SPEC Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. A signal may be sent to the shell with "kill -signal $$". Exit Status: Returns success unless a SIGSPEC is invalid or an invalid option is given.Display process times. Prints the accumulated user and system times for the shell and all of its child processes. Exit Status: Always succeeds.Evaluate conditional expression. This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Evaluate conditional expression. Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators and numeric comparison operators as well. The behavior of test depends on the number of arguments. Read the bash manual page for the complete specification. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. All file operators except -h and -L are acting on the target of a symbolic link, not on the symlink itself, if FILE is a symbolic link. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. -v VAR True if the shell variable VAR is set ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2. See the bash manual page bash(1) for the handling of parameters (i.e. missing parameters). Exit Status: Returns success if EXPR evaluates to true; fails if EXPR evaluates to false or an invalid argument is given.Suspend shell execution. Suspend the execution of this shell until it receives a SIGCONT signal. Unless forced, login shells cannot be suspended. Options: -f force the suspend, even if the shell is a login shell Exit Status: Returns success unless job control is not enabled or an error occurs.Execute commands from a file in the current shell. Read and execute commands from FILENAME in the current shell. The entries in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed. Exit Status: Returns the status of the last command executed in FILENAME; fails if FILENAME cannot be read.Shift positional parameters. Rename the positional parameters $N+1,$N+2 ... to $1,$2 ... If N is not given, it is assumed to be 1. Exit Status: Returns success unless N is negative or greater than $#.Mark shell variables as unchangeable. Mark each NAME as read-only; the values of these NAMEs may not be changed by subsequent assignment. If VALUE is supplied, assign VALUE before marking as read-only. Options: -a refer to indexed array variables -A refer to associative array variables -f refer to shell functions -p display a list of all readonly variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Set export attribute for shell variables. Marks each NAME for automatic export to the environment of subsequently executed commands. If VALUE is supplied, assign VALUE before exporting. Options: -f refer to shell functions -n remove the export property from each NAME -p display a list of all exported variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Unset values and attributes of shell variables and functions. For each NAME, remove the corresponding variable or function. Options: -f treat each NAME as a shell function -v treat each NAME as a shell variable Without options, unset first tries to unset a variable, and if that fails, tries to unset a function. Some variables cannot be unset; also see `readonly'. Exit Status: Returns success unless an invalid option is given or a NAME is read-only.Set or unset values of shell options and positional parameters. Change the value of shell attributes and positional parameters, or display the names and values of shell variables. Options: -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the Posix standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions. -- Assign any remaining arguments to the positional parameters. If there are no remaining arguments, the positional parameters are unset. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed. Exit Status: Returns success unless an invalid option is given.Return from a shell function. Causes a function or sourced script to exit with the return value specified by N. If N is omitted, the return status is that of the last command executed within the function or script. Exit Status: Returns N, or failure if the shell is not executing a function or script.Read a line from the standard input and split it into fields. Reads a single line from the standard input, or from file descriptor FD if the -u option is supplied. The line is split into fields as with word splitting, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with any leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. Options: -a array assign the words read to sequential indices of the array variable ARRAY, starting at zero -d delim continue until the first character of DELIM is read, rather than newline -e use Readline to obtain the line in an interactive shell -i text Use TEXT as the initial text for Readline -n nchars return after reading NCHARS characters rather than waiting for a newline, but honor a delimiter if fewer than NCHARS characters are read before the delimiter -N nchars return only after reading exactly NCHARS characters, unless EOF is encountered or read times out, ignoring any delimiter -p prompt output the string PROMPT without a trailing newline before attempting to read -r do not allow backslashes to escape any characters -s do not echo input coming from a terminal -t timeout time out and return failure if a complete line of input is not read withint TIMEOUT seconds. The value of the TMOUT variable is the default timeout. TIMEOUT may be a fractional number. If TIMEOUT is 0, read returns success only if input is available on the specified file descriptor. The exit status is greater than 128 if the timeout is exceeded -u fd read from file descriptor FD instead of the standard input Exit Status: The return code is zero, unless end-of-file is encountered, read times out, or an invalid file descriptor is supplied as the argument to -u.Evaluate arithmetic expressions. Evaluate each ARG as an arithmetic expression. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. Exit Status: If the last ARG evaluates to 0, let returns 1; let returns 0 otherwise.Send a signal to a job. Send the processes identified by PID or JOBSPEC the signal named by SIGSPEC or SIGNUM. If neither SIGSPEC nor SIGNUM is present, then SIGTERM is assumed. Options: -s sig SIG is a signal name -n sig SIG is a signal number -l list the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and allows processes to be killed if the limit on processes that you can create is reached. Exit Status: Returns success unless an invalid option is given or an error occurs.Remove jobs from current shell. Removes each JOBSPEC argument from the table of active jobs. Without any JOBSPECs, the shell uses its notion of the current job. Options: -a remove all jobs if JOBSPEC is not supplied -h mark each JOBSPEC so that SIGHUP is not sent to the job if the shell receives a SIGHUP -r remove only running jobs Exit Status: Returns success unless an invalid option or JOBSPEC is given.Display status of jobs. Lists the active jobs. JOBSPEC restricts output to that job. Without options, the status of all active jobs is displayed. Options: -l lists process IDs in addition to the normal information -n list only processes that have changed status since the last notification -p lists process IDs only -r restrict output to running jobs -s restrict output to stopped jobs If -x is supplied, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader. Exit Status: Returns success unless an invalid option is given or an error occurs. If -x is used, returns the exit status of COMMAND.Display or manipulate the history list. Display the history list with line numbers, prefixing each modified entry with a `*'. An argument of N lists only the last N entries. Options: -c clear the history list by deleting all of the entries -d offset delete the history entry at offset OFFSET. -a append history lines from this session to the history file -n read all history lines not already read from the history file -r read the history file and append the contents to the history list -w write the current history to the history file and append them to the history list -p perform history expansion on each ARG and display the result without storing it in the history list -s append the ARGs to the history list as a single entry If FILENAME is given, it is used as the history file. Otherwise, if $HISTFILE has a value, that is used, else ~/.bash_history. If the $HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise. Exit Status: Returns success unless an invalid option is given or an error occurs.Display information about builtin commands. Displays brief summaries of builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise the list of help topics is printed. Options: -d output short description for each topic -m display usage in pseudo-manpage format -s output only a short usage synopsis for each topic matching PATTERN Arguments: PATTERN Pattern specifiying a help topic Exit Status: Returns success unless PATTERN is not found or an invalid option is given.Remember or display program locations. Determine and remember the full pathname of each command NAME. If no arguments are given, information about remembered commands is displayed. Options: -d forget the remembered location of each NAME -l display in a format that may be reused as input -p pathname use PATHNAME is the full pathname of NAME -r forget all remembered locations -t print the remembered location of each NAME, preceding each location with the corresponding NAME if multiple NAMEs are given Arguments: NAME Each NAME is searched for in $PATH and added to the list of remembered commands. Exit Status: Returns success unless NAME is not found or an invalid option is given.Move jobs to the background. Place the jobs identified by each JOB_SPEC in the background, as if they had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Returns success unless job control is not enabled or an error occurs.Move job to the foreground. Place the job identified by JOB_SPEC in the foreground, making it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Status of command placed in foreground, or failure if an error occurs.Display or execute commands from the history list. fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. Options: -e ENAME select which editor to use. Default is FCEDIT, then EDITOR, then vi -l list lines instead of editing -n omit line numbers when listing -r reverse the order of the lines (newest listed first) With the `fc -s [pat=rep ...] [command]' format, COMMAND is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command. Exit Status: Returns success or status of executed command; non-zero if an error occurs.Exit a login shell. Exits a login shell with exit status N. Returns an error if not executed in a login shell.Exit the shell. Exits the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Replace the shell with the given command. Execute COMMAND, replacing this shell with the specified program. ARGUMENTS become the arguments to COMMAND. If COMMAND is not specified, any redirections take effect in the current shell. Options: -a name pass NAME as the zeroth argument to COMMAND -c execute COMMAND with an empty environment -l place a dash in the zeroth argument to COMMAND If the command cannot be executed, a non-interactive shell exits, unless the shell option `execfail' is set. Exit Status: Returns success unless COMMAND is not found or a redirection error occurs.Parse option arguments. Getopts is used by shell procedures to parse positional parameters as options. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead. Exit Status: Returns success if an option is found; fails if the end of options is encountered or an error occurs.Execute arguments as a shell command. Combine ARGs into a single string, use the result as input to the shell, and execute the resulting commands. Exit Status: Returns exit status of command or success if command is null.Enable and disable shell builtins. Enables and disables builtin shell commands. Disabling allows you to execute a disk command which has the same name as a shell builtin without using a full pathname. Options: -a print a list of builtins showing whether or not each is enabled -n disable each NAME or display a list of disabled builtins -p print the list of builtins in a reusable format -s print only the names of Posix `special' builtins Options controlling dynamic loading: -f Load builtin NAME from shared object FILENAME -d Remove a builtin loaded with -f Without options, each NAME is enabled. To use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. Exit Status: Returns success unless NAME is not a shell builtin or an error occurs.Write arguments to the standard output. Display the ARGs on the standard output followed by a newline. Options: -n do not append a newline -e enable interpretation of the following backslash escapes -E explicitly suppress interpretation of backslash escapes `echo' interprets the following backslash-escaped characters: \a alert (bell) \b backspace \c suppress further output \e escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits \xHH the eight-bit character whose value is HH (hexadecimal). HH can be one or two hex digits Exit Status: Returns success unless a write error occurs.Define local variables. Create a local variable called NAME, and give it VALUE. OPTION can be any option accepted by `declare'. Local variables can only be used within a function; they are visible only to the function where they are defined and its children. Exit Status: Returns success unless an invalid option is supplied, an error occurs, or the shell is not executing a function.Set variable values and attributes. Obsolete. See `help declare'.Set variable values and attributes. Declare variables and give them attributes. If no NAMEs are given, display the attributes and values of all variables. Options: -f restrict action or display to function names and definitions -F restrict display to function names only (plus line number and source file when debugging) -g create global variables when used in a shell function; otherwise ignored -p display the attributes and value of each NAME Options which set attributes: -a to make NAMEs indexed arrays (if supported) -A to make NAMEs associative arrays (if supported) -i to make NAMEs have the `integer' attribute -l to convert NAMEs to lower case on assignment -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -u to convert NAMEs to upper case on assignment -x to make NAMEs export Using `+' instead of `-' turns off the given attribute. Variables with the integer attribute have arithmetic evaluation (see the `let' command) performed when the variable is assigned a value. When used in a function, `declare' makes NAMEs local, as with the `local' command. The `-g' option suppresses this behavior. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Execute a simple command or display information about commands. Runs COMMAND with ARGS suppressing shell function lookup, or display information about the specified COMMANDs. Can be used to invoke commands on disk when a function with the same name exists. Options: -p use a default value for PATH that is guaranteed to find all of the standard utilities -v print a description of COMMAND similar to the `type' builtin -V print a more verbose description of each COMMAND Exit Status: Returns exit status of COMMAND, or failure if COMMAND is not found.Return an unsuccessful result. Exit Status: Always fails.Return a successful result. Exit Status: Always succeeds.Null command. No effect; the command does nothing. Exit Status: Always succeeds.Print the name of the current working directory. Options: -L print the value of $PWD if it names the current working directory -P print the physical directory, without any symbolic links By default, `pwd' behaves as if `-L' were specified. Exit Status: Returns 0 unless an invalid option is given or the current directory cannot be read.Change the shell working directory. Change the current directory to DIR. The default DIR is the value of the HOME shell variable. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, the word is assumed to be a variable name. If that variable has a value, its value is used for DIR. Options: -L force symbolic links to be followed -P use the physical directory structure without following symbolic links -e if the -P option is supplied, and the current working directory cannot be determined successfully, exit with a non-zero status The default is to follow symbolic links, as if `-L' were specified. Exit Status: Returns 0 if the directory is changed, and if $PWD is set successfully when -P is used; non-zero otherwise.Return the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0. Exit Status: Returns 0 unless the shell is not executing a shell function or EXPR is invalid.Execute shell builtins. Execute SHELL-BUILTIN with arguments ARGs without performing command lookup. This is useful when you wish to reimplement a shell builtin as a shell function, but need to execute the builtin within the function. Exit Status: Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is not a shell builtin..Resume for, while, or until loops. Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resumes the Nth enclosing loop. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Exit for, while, or until loops. Exit a FOR, WHILE or UNTIL loop. If N is specified, break N enclosing loops. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Set Readline key bindings and variables. Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: e.g., bind '"\C-x\C-r": re-read-init-file'. Options: -m keymap Use KEYMAP as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input. -V List variable names and values -v List variable names and values in a form that can be reused as input. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -r keyseq Remove the binding for KEYSEQ. -f filename Read key bindings from FILENAME. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. Exit Status: bind returns 0 unless an unrecognized option is given or an error occurs.Remove each NAME from the list of defined aliases. Options: -a remove all alias definitions. Return success unless a NAME is not an existing alias.Define or display aliases. Without arguments, `alias' prints the list of aliases in the reusable form `alias NAME=VALUE' on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Options: -p Print all defined aliases in a reusable format Exit Status: alias returns true unless a NAME is supplied for which no alias has been defined.alias [-p] [name[=value] ... ]bind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-aAfFgilrtux] [-p] [name[=value] ...]typeset [-aAfFgilrtux] [-p] name[=value] ...local [option] name[=value] ...enable [-a] [-dnps] [-f filename] [name ...]exec [-cl] [-a name] [command [arguments ...]] [redirection ...]fc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]set [-abefhkmnptuvxBCHP] [-o option-name] [--] [arg ...]export [-fn] [name[=value] ...] or export -preadonly [-aAf] [name[=value] ...] or readonly -ptrap [-lp] [[arg] signal_spec ...]ulimit [-SHacdefilmnpqrstuvx] [limit]for NAME [in WORDS ... ] ; do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donecoproc [NAME] command [redirections]function name { COMMANDS ; } or name () { COMMANDS ; }variables - Names and meanings of some shell variablesshopt [-pqsu] [-o] [optname ...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-DE] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [word]compopt [-o|+o option] [-DE] [name ...]mapfile [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readarray [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array],RRW[]`dgjlnLr}ԁh4XL<ԞĨpXX< 0pP\4,  h`P!!t( )unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [expr]cd [-L|[-P [-e]]] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocalecho [-neE] [arg ...]enableeval [arg ...]getoptsgetopts optstring name [arg]exit [n]logout [n]fg [job_spec]bg [job_spec ...]help [-dms] [pattern ...]disownletlet arg [arg ...]readreturn [n]unset [-f] [-v] [name ...]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [id]time [-p] pipeline{ ... }{ COMMANDS ; }%job_spec [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [-n] [+N | -N | dir]popdpopd [-n] [+N | -N]dirs [-clpv] [+N] [-N]shoptprintfcompgencompoptmapfilereadarrayalias `%s': invalid alias name../../bash/builtins/../../bash/builtins/alias.def, line editing not enabledbind_builtinlvpVPsSf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via "%s"%s`%s': cannot unbindh   `   X                H      @ (             only meaningful in a `for', `while', or `until' looploop countNULL%s %s %s ../../bash/builtins/../../bash/builtins/cd.defchdirOLDPWD=LPHOME not setOLDPWD not setCDPATHpvVcommand_builtin../../bash/builtins/../../bash/builtins/command.def%s: usage: %s: numeric argument required%s: not found%s: invalid option nameinvalid octal numberinvalid hex number%s: %s out of range%s: no such job%s: no job control%s: restricted%s: not a shell builtinwrite error: %s../../bash/builtins/common.c`'%s: ambiguous job specSIGJUNKUnknown%2d) %s%s: invalid signal specification`%s': not a pid or valid job specerror setting terminal attributes: %serror getting terminal attributes: %s%s: error retrieving current directory: %s: %s +acfgilprtuxAF%s %d %s ../../bash/builtins/../../bash/builtins/declare.defcannot use `-f' to make functions%s: cannot destroy array variables in this way%s: cannot convert associative to indexed arraycan only be used in a functionD B B B B C B B B B B B B B B B B B B B B B B B B B B B B B B B C B C B B C C B C B B hC B B B XC B HC B 8C  C B B C neE../../bash/builtins/../../bash/builtins/echo.defadnpsf:enable %s enable -n %s %s: not dynamically loaded%s: cannot delete: %scannot open shared object %s: %s../../bash/builtins/../../bash/builtins/enable.defcannot find %s in shared object %s: %sS eS eS S eS S eS eS eS eS eS eS eS S eS S eS eS S %s: not a regular file%s: file is too large_evalfile../../bash/builtins/evalfile.cparse_and_execute toppe_disposeparse_and_executeparse_string topparse_string../../bash/builtins/evalstring.c../../bash/builtins/../../bash/builtins/exec.defcla:%s: cannot execute: %s~/.bash_logout/etc/bash.bash_logoutThere are stopped jobs. There are running jobs. not login shell: use `exit'logout exit :e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %c%s %sfc builtin${FCEDIT:-${EDITOR:-$(command -v editor || echo ed)}}${FCEDIT:-${EDITOR:-$(command -v editor || echo vi)}}../../bash/builtins/../../bash/builtins/fc.defhx x x x x x x `x x Px x x x Hx 8x currentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-thits command %s: hash table empty %s ../../bash/builtins/../../bash/builtins/hash.def                 %s: cannot open: %sdms%*s%s - SYNOPSIS%*s%s DESCRIPTION%*s%s SEE ALSO%*sbash(1) IMPLEMENTATION%s: %s These shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keywords `Shell commands matching keyword `../../bash/builtins/../../bash/builtins/help.defno help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrw%s: history expansion failedhistory position%5d%c %s%s cannot use more than one of -anrw../../bash/builtins/../../bash/builtins/history.defX  P @          8  0  (      no other options allowed with `-x'../../bash/builtins/../../bash/builtins/jobs.deflpnxrsjobs_builtinahr             Unknown error(%ld) - %s%s: arguments must be process or job IDsMAPFILE%s: invalid line count%s: invalid array origin%s: invalid callback quantumu:n:O:tC:c:s:empty array variable name%s: not an indexed array%s %d %s%s: invalid file descriptor specification%d: invalid file descriptor: %sinternal error: getting variable name../../bash/builtins/../../bash/builtins/mapfile.defȩ ! ! ! ! ! ! ! ! ! ! !  ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! P ! ! ! ! ! ! ! ! ! !  ! ! ! !  ب @ directory stack emptydirectory stack index %2d %sno other directorydirstack../../bash/builtins/../../bash/builtins/pushd.defersa:d:i:n:p:t:u:N:read_builtinread error: %d: %s%s: invalid timeout specification../../bash/builtins/../../bash/builtins/read.def a a a a a a a a a a a a a a a a a a 8 a a   a a a  a a a a  a ` a P @  H can only `return' from a function or sourced scriptoff%-15s %s set %co %s allexportSHELLOPTSfv%s: cannot unset%s: cannot unset: readonly %s%s: not an array variablebraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtrace../../bash/builtins/../../bash/builtins/set.defcannot simultaneously unset a function and a variableNaNBL  NeNENT OhOHtLIP ,d O0G1Ok9OmAOCKOnROfYO|_ObfOunOtuOP~O @Ї Op0\vJ  Oxdeclare -%s %s -%s aAfnp%s: not a function-ra-rA../../bash/builtins/../../bash/builtins/setattr.def                                                shift count../../bash/builtins/../../bash/builtins/shift.deffilename argument required%s: file not found../../bash/builtins/../../bash/builtins/source.defcannot suspendcannot suspend a login shell../../bash/builtins/../../bash/builtins/test.defunknowntrap -- %s %d trap -- %s %s ../../bash/builtins/../../bash/builtins/trap.def                       %s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP../../bash/builtins/../../bash/builtins/type.def8 o o o o o o o o o o o o o o o o 0 o o o o ( o o o o o o o o o  o o o  (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %s`%c': bad commandhardsoft%s: cannot modify limit: %score file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile locks../../bash/builtins/../../bash/builtins/ulimit.defcWWdW,We 3Wf WWi GWlWW,WmiW,WnyWpWWq WWrWsW,WtWWuWv W,Wx Wu=%s,g=%s,o=%s agourwx -SSpumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARG../../bash/builtins/../../bash/builtins/getopts.defautocd%s: invalid shell option name-s-ushopt %s %s BASHOPTSpsuoqcdable_varscdspellcheckhashcheckjobscheckwinsizecmdhistcompat31compat32compat40compat41dirspelldotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoreglobstargnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinteractive_commentslastpipelithistmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echo../../bash/builtins/../../bash/builtins/shopt.defcannot set and unset shell options simultaneously# # x# ?# h# ?# `# PZZZHZZZZIZT ZX Z\ Zd Z[4 [[![*[2[XE;[D[JR[[[f[xq[|[t[J [[0G [t[:`p [[[ض[[\L\\E\ *\8\WC\dmissing hex digit for \xmissing unicode digit for \%cwarning: %s: %s#'-+ 0v:hjlLtzlld'  '  '  '  ' '  '  '  '  '  '  '  '  ' ' ' ' ' ' ' ' '  '  '  '  '  '  '  ' '  '  '  '  '  '  (  '  '  '  '  '  '  '  '  '  '  '  '  '  '  ' 8(  '  '  '  '  '  ' (  '  '  '  ' ( ( (  '  ( )  '  '  '  '  '  '  ' )  '  '  ' )  '  ) 8( ()  ' @' = Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 < Q6 Q6 Q6 < < < Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 ; Q6 Q6 Q6 Q6 Q6 Q6 Q6 Q6 < f: @: 9 < < < Q6 9 Q6 Q6 Q6 Q6 k9 ; Q6 8 Q6 68 Q6 ; Q6 Q6 ; ../../bash/builtins/../../bash/builtins/printf.def`%s': missing format character`%c': invalid time format specification%s: illegal option -- %c %s: option requires an argument -- %c bashdefault-r%s: invalid action name-D-Ecomplete -o %s dirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-varrayvar-A %s helptopicrunningsetoptsignalstopped-G%s %s -W-P-X-C-Fcompopt +o %s +o:DEgroupserviceuserabcdefgjko:prsuvA:G:W:P:S:X:F:C:DE../../bash/builtins/../../bash/builtins/complete.def%s: no completion specificationwarning: -F option may not work as you expectwarning: -C option may not work as you expectnot currently executing completion functionpX V `X @X  X X X V V V V V V V V W V V W V V V W W V V V V V V V V W W W W W W pW V V `W XW V V V 0W W V V V V V V b bbbbb@6acDbVc d6E@v:NeBfuR)cK cgt=@j1Ok3ccs;c9BcIc c@u,0vp p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p v u u u u u u u u u v u u u u u u u u u u u u u u u u u u u u v u u u u u u u u u u u u u u u u u u u u u u u u u u v u u ../../../bash/lib/glob/glob.c?*+@!asciiwordalnumNULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELascii?*+@!alnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDEL../../../bash/lib/glob/smatch.c../../../bash/lib/glob/sm_loop.c         ʜ ʜ                        j O 8    Ѭ    f 7                                  ttttttt tZJtILt8          8                     8                            (                                                              | | | | | | | |   | | | | | | | | | | | | | | | | | | |   | | | | | | | | | | | | | | | | | | | | | | | | | |                                                             (  ../../../bash/lib/sh/getenv.c../../../bash/lib/sh/setlinebuf.c../../../bash/lib/sh/itos.cBASH_REMATCH../../../bash/lib/sh/shmatch.c/dev/fd//dev/std../../../bash/lib/sh/netopen.c%s: bad network path specificationsocketconnect%ldm%d.%03dssh_makepath../../../bash/lib/sh/makepath.c../../../bash/lib/sh/pathcanon.c../../../bash/lib/sh/pathphys.csh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s-%luw+../../../bash/lib/sh/tmpfile.c../../../bash/lib/sh/stringlist.c../../../bash/lib/sh/stringvec.c../../../bash/lib/sh/shquote.c  x x x x x x x x x x x x x x x x x x x x x    h  x      x  x x x x x x x x x x x x x x   x   x x x x x x x x x x x x x x x x x x x x x x x x x x x     x  x x x x x x x x x x x x x x x x x x x x x x x x x x                                                                                                                         x ../../../bash/lib/sh/strtrans.c F F F F  F F F F F F F F  ; ; ; ; ; ; ; F F F F F F F  F F F F F O F F F F F F F F F F F F F F F g F F F F F F M F F F F    F O  F F F F F F F  F F F  F  g  F         H H H H H H H H H H H H H  H H H H H H H H H H H  H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H  %s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789ABCDEF0123456789abcdef../../../bash/lib/sh/zmapfd.c../../../bash/lib/sh/zgetline.c'd ../../../bash/lib/sh/casemod.cOAOBOCODOHOF5.1 l|h^0bBFT` l|hwW^0bBFT` l|h^0%bBFT` hl^$0ftFT;,%wbeWBE|`_*\AaIiCcDdPpYyRrSsXx~vidomove_dispatch: unknown operator %dabortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-complete-backwardnext-historyold-menu-completeoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertskip-csi-sequencestart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-backward-bigwordvi-backward-wordvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-bigwordvi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-forward-bigwordvi-forward-wordvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-tonon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-agains0@yppy`ze NJ@M |Ňڇ|Z@!`;`} H R[PRmQn Pш0߈ p   `[*9|E]Pzy { &`}g Éh ډ  ON QJM@  /`<l dl l m <0 N] r  Ί`Wڊ PZ`A#P3P@>WCV@Pk`Q}`O HGRIË`O ы O Q [ F pI $F -pI 6Y E ` TT a0\ p`R zM U  S `G @`G ŌPM ьO ތ@L E @D  \ E #PH 3PH <a IN WO i^ rP K  = `< K PQ ǍB ύa ڍX E D a  ` E #D /U warning: turning off output flushing//--More-- "\'`@$><=;|&{(Display all %d possibilities? (y or n)bad value %d for what_to_do in rl_completebind-tty-special-charsbell-style"%s%s": "%s" %s%s outputs %s noneaudiblevisibleterm=mode=%s: line %d: %s $endif without matching $ifcompletion-display-widthcompletion-query-itemshistory-sizeisearch-terminatorskeymapC-\M-blink-matching-parenprefer-visible-bellControl-Metaunknown parser directiveno closing `"' in key bindingprefix-meta/etc/inputrcINPUTRC~/.inputrc\C-%c# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on ... set %s %s %s is set to `%s' otherC-CTRL-EscapeLFDNewlineRETReturnRuboutSPCSpaceTabendifincludebyte-orientedcompletion-map-caseconvert-metadisable-completionecho-control-charactersenable-keypadenable-meta-keyexpand-tildehistory-preserve-pointhorizontal-scroll-modemark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmenu-complete-display-prefixmeta-flagoutput-metapage-completionsrevert-all-at-newlineshow-all-if-ambiguousshow-all-if-unmodifiedskip-completed-textvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insert$else found without matching $ifcompletion-prefix-display-lengthprint-completions-horizontallyk k k k k k k k q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q W q q q q C / q    q q q q q q q ߿ q q q ˿ q  q  q ? ΔŔwfu• ƕ Ε ҕ ٕ   ; й p  ]l_I ]+d>]Vd0tܻDI @Ԗ )(58xF$\ rƓ J0 >  WЭ  n` {p  L~~vŗnJ`fЗ`fؗ`f@^     w _rl_col_width: called with MB_CUR_MAX == 1debug: insert_some_chars: count (%d) != col (%d)\%o/-_=~.#$readline: /var/tmp/rltrace.%ldreadline_callback_read_char() called with no handler!coli amxnkm@7DCclcrdceiimkDkHkIkdkhklkrkummmopcvbvsp6-׍0c`hdXtlTPXxÝ\NƝɝ|V̝cϝLҝVv(arg: %d) X%luunknown expansion error() <>;&|$!@?+*"'`:$*%^ ;&()|<> =event not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitution  9,?Sq ~ ~p->minfo.mi_magic2 == 0x5555nunits < 30bcoalesce: CHAIN(mp2) != mp1 malloc: %s:%d: assertion botched free: called with already freed block argumentfree: called with unallocated block argumentfree: underflow detected; mh_nbytes out of rangefree: start and end chunk sizes differmalloc: block on free list clobberedrealloc: called with unallocated block argumentrealloc: underflow detected; mh_nbytes out of rangerealloc: start and end chunk sizes differ ^MGA;5/) @ @ @ @;<hE? F~TFPF?`<x`=cD=cd=d=e=Hf=f>f>xgH>hp>Xh>xh>h>j>hltS?S?SX@S@TA4TAHT(B`TB|TDTETHEUF,UGPUXGpU8HUXIUHNVhOHVO|VPVPVHQVhQVxS$WTLWVWVWhWWWWXX(X,XXDXXdXXXZX[X\YcHYdtYdYeYfYhgZg,ZHhLZhxZxiZmZXmZm[hoX[ox[o[8p[p[p[p\q<\hrl\(s\Xs\hs\(w]wP]xx]{]8|]|]|^|^(}8^h}L^~p^X~^x~^~^~__8,_h@_x_X__ȁ_X`؂$`<`T`hl`Ȉ`ȶ aXxaȾaa bxPbhb(b4cHtc(cc(c8cH dX dh4dHd\dd(dHdXddd eX(ex{H>{>H{>`{>{X?{?{@ |@D|Ep|F|F|F|XG}H,}IH}xId}I|}I}HJ}J}8K}L ~XM ~M8~MP~Nh~XN~(O~HO~hP~HQ \x]`(eet(ggg hXHiiij j8kop8q 8rHrxssttu@Hu\upuhvȄwwx hxD(yyxzzx{4{X8|HĆX$8ȌX<Pȍd8XẌx H$ȓPX|h88X $xL(t8XȚȊhXxȤȋ8h@lh،x,Hx(x8(<ht(܏X0Ld|Xxx@8\$<h8̒ LX̓$<hdX(h( h8@pHx  x\8xX$dH X!И#%<H&p&(Й,-0-.Ě//(/ X/,/P807ܛXC8GxI8I̜MMM$(N<(Ot8OxOOܝ8P(L؏Ԟ h0(XXПX4XLРغȽ<hhȡ8HXh,LlТhL`8أX8X88x XL8ȥ8(<x xPhhܧXhHx8Xx4LhH̩DXHXԪ,X|ԫ$8h\Hx LHl(Xh@p8ЮxHh8xįD(|аxPd PH X 8,@h|hԳ H(x<l(Ĵ<XdH x!H!H""($<&h&&($h)<h*`*+8+ȷx++h-T-xH./X/5$5`h66h787H889 :$x:H:x;;ܻH<==>(@(@A̽BBhC8CľCFDxHHJܿLNtPQRSS8HTl8UUXY$ZTZ[\(^8bDbhcdefHi@xi\ipjHkkk(HlXl|mm(nDnHoo4rrt(tutwy{LXH(hؒؓȔ8X0H(tHx,X((Lh`xtXXx4T8(Dlx DX (8Xd(x HthXh,x@Th|hxh(@XpXX<tX DHlx(X(P|X@p XxDhp((T h`xX , L hH 8D(T8tX(48HH\( x "8"T#9X<< H=<=tH>>H?(?H?h8@@@A$hB<xD|EXFhGDG\GtGGI(I8I XI hI4ITJxKMOdxU8a,HbXhblb(ddeegD(hdHhxhhhii8jhj4jL(ktklllXm(nT(nhnpHq4wthw8xyy{D{dx~(hL`t(؉ (8PHt؋X، X8\8tx؏H@XHxȑ(hxȓhh<x`hHH@(XȞThXx @hxPpx@`xH<8( h$<hh8H(d  8 @X4Th,h8(<H3|3(44455<86P6x778`X::X;x;>hADE<ETGK(LXLN8HNTQ|QRhST(UTXY`XbP8cdkl,op(ss s0 w\ xp x y (y 8y y$ yD Hzd ({ { x| }8 ~x  X X x    , X h| H   xPxH(XTx<xhdHXT,@T(84tx lh  h,tX8$|Hx,@8x(h((@d|H X  Dx!p!!"8"""#H#,#Tx$p$$x%%%&& & '<'`((++-(.D8000h23,x3D55(9=D(?l8@AB4 xC\ C xD D D!(EH!E!hG!hH0"XJp"J"J"(K"K #K4#LH#HL`#xLx#L#L#M#M $xN\$Nt$O$xP%SL%Tl%T%8U%U&XV@&V|&W&X&(] 'x^L'^'_'e(h\(k(hl(n0)nT)nl)(p)q*Hr*r4*hzt*H{*X{*h{*{*X|*x|+X}8+~h+~++ ,؀,,XP,Ht,x,H,x,,Ȅ-؄-4-x-8-x--، .(<.`.t.X..ؑ.(.H.x /$/XD/(p///h080X00h0(0 1L18`1ht111181H12L2Xl2ȡ22Ȣ23L33H33$4d444h45ث05D5X5Xl55H55856(6H6hp6X6H686<7س|7H7X78h88xL8p8H8h89H 9ؽ<9P98d9ؾ9(9ؿ9 :H,:D:p:8::x::P;X;;;X$<D<|<<<(<X<=<=Xt==X==X,>D>\>(>8>>H>?$?XH?p?8??@4@@@HA8PA8AAXA(BHO?Oh? Ph@8P(A\PxA|PxBPBP8K,QLQMQMQXMQMQMRhOXRQRTRTRXV(SV{x?4|@\|A|8E|G@}HH`}hHt}(I}hL}XSh~S~UUU(V<(VPxVpVVVWW8WhWW8WL8Yt[\ĀzR| $#QC M<4l#AA CAE@ AA AAA t<&=AC wA \&AC0 AA <'7AC CCC0#CA AA (YAC L AA T(AC 8(C (L(qC WK C w I $x()C Om A \)5C q)C W)HC z C G(*C RK H  G ,+AA F  AAA LdAB yl$-MC `-C0t A $.6C0W C $/AC@ AH 1*11%(hH(D1rAA C j AA p02AC A2*C f2C X2WC v G ,3AA C R  AAG 4(G` ,4/GT E NP4<d5AA AAC`q AA AAD <7C FFF 7AE _ AB 48AA AC  A AAE $ ;8;ZC V PP;AC At;;YC0d A p;3C0o <3C0o H<AC  AD (<AC0 AB uA(=9<=FC BT>,h8> |4>eAC _A>C @8?^AA AH | C AAD CH AAHT?AA C   AAC \  AAB M  AAA H@\A@pA AA AAF" AA AAD lM.AC \ AG lxNAC AAC@ AA AAA 1 AA AAA O AA AAA hHTPAA AAC@ AA AAA u AA AAA X CA AAA XV,AA AAC AA AAC  AA AAG X k'AA AAC AA AAA  AA AAA (l zWC@Kb C l {F&AA AACf CA AAE ' CA AAA  HA AAA @ AA AAF CA AAA L 4LCH$d lC0L A ( JAC V CC dE( JAC V CC dE COT $*AA AACPf AA AAG k CA AAA T AC z CG x AC AP 4AA AACp AA AAA ZAA AA( CpHLH E T TBAA AAC0 AA AAH } AA AAG ,t LAC o AD J AE  MT >AC CAC(| AA AAE  AC AAA < AA AACP AA AAA P D<d AA AAC@ AA AAA D LAA CC  C AAH CE AA4 AC c CF K FG VA$<{48AA AC  A AAA pPWAC C AH (C _ HAC BASC c B FNNl B TAA AAC@y CA AAB E CA AAE hXOA~ I F UAC OA9AC sA.CgAC}(0>AC U CD ZC,DN@VT#C \(ldAC h AC nA((=AC d CE IC$<C HOK C $CPHPc B H<AA AC h C AAE N C AAE `C Txx4AA AAC@ CA AAE ~ CA AAD 4`AA AC  A AAF ,(AA C v  CAA ,8mAH@ AF C FG $hC0ML[ A $pC0ML[ A qC mpNC j C $C HDz G ~< FAA ACCP AA AAH T!AC [At, C0\4NC j C h3E m FAC @A `C HHH@$uC0HHHHM$0PuC0HHHHMTXpAC ACCP AA AAE y AA AAA :C v$C0LHH`PfC LV fC HHHF4WC HHT,WC HH tlrAC lANC J LAC FA ,yAC sA$C HHHx E T GAA AAC`# AA AAB  AA AAH (xhC@LH[ C $,C@PHH@C |  C LHt$xC HOS C 00C0HHHNk L fd)x,C hC G F <4AA AACp AA AAA 0GAA CE yA AA  /C k 88?AE  AB \TAE |A:AE rA8AC E J  AAC f  AAH ,AC C   AAA tC FKO E D0@AA AE  A AAG yA AA0xGAA AC }A AA44C HHHu H s E o C XRC  F X$,dC`jy B $TLgC0MHHW I <|AA AAC@ AA AAK 4.AC _A DpAC jA.AC _A pAC jAD C \\ Wt<1AC gA\,AC bA(lC@QHQH E 0@AA AC0A AA(=AH e AI CA4@AA AE0n A AAG (x AC E z FA 3Co4 5C q4\ C@RHx% F W I (  AC g AD [A 8X VAC PA\ tC R C [(| AA C  AA0XAF AC A AA(C0HPh E (BAC |A(X-AC gA<HhAA AAE@ AA AAE #AE [A(DAA C | AA<GC FFwlDAC ~A-C i,%AC [AL%AC [A,lFC0JG B E(C0J[{ E #C _<AA AAEP AA AAA H4 AC E O  AAF [  FFI K  AAC 0 AC ` AC [ AD |A( $C@HFKF B $ C Lx A |!X_!"C ^4!H!7AE mCh!< |!AC F !GAC AA!C O(!4AC T AG RA("4AC T AG RA4"H"\" *4p" AA AC0z A AAE "!?C HHg "!NAf A L L "!C W(#!AA C0 AA 0#P"vAC pAT#"C Xl#"C O#"PC L(#"`FNNN^ D #((-AA AAF AA AAF  AA AAD V CA AAD  CA AAB TP$UAA CCE`] CA AAH t CA AAF ($\oAA C e CA$$]AA AAE@<$^BAA ACE`L CA AAC @<%blAA AAH AA AAA X% jAA AAHN CA AAH  CA AAE ,%nAA C0  CAA T &DoAA AAEP~ AA AAA T AA AAD <d&rVAA CAE@ AC AAH ,&sAA E P  AAG (&|tC`FIH]x A '@y' 0C l(L>$=AC k AH CAx>8$C `>PAC WA(>PwAC C k CA4>PAC C y  AAF C CA$?C H_k C 4mAA ACE@L AA AAE h AA AAD pT@IAE TT@AA ACE@ CA AAH s CC AAE @TC z $AC A HxAE A4lyAA ACp A AAD ,\C MHHo I JԘ7$C JJ B (pC0U: F 4<C JJFK H g A Y$tnC ME C U.C [ B M.CX E M ܙrC NJF G <P/AA AACP AA AAA <@@ AA AACP AA AAB (dAC K CF IA(gAC I CH IAؚXKC h E C H E rXAA AC0m C AAH  A AAF K C AAH ,pAC0L AG 7 AH P L4Cp ̛txAC pCCV \AC VA ,wC HO H TPpAA AAC` AA AAA @ AA AAA P!oAA AAC@) AA AAL hCA AA4"AA C   AAJ H CA<4#+AA AACP CA AAA (t$pAC C d CA$?C ^ G V% ԝ%(%&AdP<%AF AAC0` AA AAH VAA AA(X%gAC Q AJ CCP%AA AAH0W HA AAB SCA AA ؞&`C HH\pPD&AC CCE` CA AAA AA AA<P'SAA AAC@H CA AAC 0*_AA h AE \ AC ğ,*,؟8*AA C V  AAC *|AC vA,,*[AC N AE O AH \$-IC z C H|T-C  B ,(.AC n AE C CB $Ƞ.C0HHDZ G 03?C {(X3C0HHLg B <44!AA AAC0 AA AAH ht5AA AAC` CA AAD _ CA AAC CA AA6]C X E |(07yAA Em CA(,7aAC E U AA(X7C@FFFF C 91AC kA9C OT9*AA CCF^ CA AAF AA AA4;xAC E V  AAG C GAL;C Td;x;(;C@H[e E <H=GAA AAFz AA AAH X?DC @T?@AA AAE@: CA AAG ] CA AAE hxA;E n A ,AAA C i  CAF ,AAB E AAA C (WC0HHU A (pZuAA C0m AA,<ZdAC AT  AAE 4l[wAA AC [ A AAA 8L[xAA AAE0jAA AA8[xAA AAE0jAA AA8[rAA AAE0dAA AAX\FC HKoxH\CC HKlx\CC HKl\NC L~ ئ\TC LD@T] AA AAC@ AA AAE P AA AAA T]aC ]<l$^AC AAEP AA AAB <_+AA CAE@ CA AAD ,`AA C ^  AAK TdaAA AACP AA AAC M AA AAA tbCV$bCV,bCV4bCY<ԨC z8WLW.C j@dWC0HHHL C P H  J [(C d,[@C0Qm G G A \C0 C H H 8^AA C ^  CAA U  AAA P^PC  G l`AC x CB Pa bb\Cv G O A ccDCm H HcTc+AE _A<dcbC ^TcaC FFQ(t dAA E w  CAF 0fQC@JGFq H PhCVThAA AAC0 CA AAC Y AA AAC DLiIAC j CG hxiOC ] H f(iAE C AF @C@jC GFH~ J  B ^ J Z E $kC0Tk F , 0l_AC P AC ^ AA (P`lwC Jy B c E |l&l)ll-m)C e,,mJAC0{ AH P AG Ln(Hn=C b C T0HhnsAC q CH S CB WC|nFC g F U0ndAC Z CG X CE XC oIAC CA,LoAG A  CAA $$oAG g AH ,LpAG A CA<|DqAA AAC0 CA AAD <$rAA AAC06 CA AAE (tsC HHHm H }((sC HHHt A }<T\tAA AAC0 CA AAD ,,uxC HHHd A k A 4|uAC F CC k AD wC DvIAC CA pv>ACxA@v/AC gC`vtvv1vCP E pTwVC RwH,wAA C K  CAD HxeC V G _ A 8x:C Y D YXx$AC[D$xxPCJH^ E W$xC0MMO D $yC0MMO D ,zC@MMD G C E H @{AA C f  CAA C  CAA I  AAE <l{AC ACE0 AA AAB T|eAC0X AA 0|C HHLg B e K <|}AA AAC`t AA AAA DWAC OCh( |$yAC  AC KTAA AAC@ AA AAA x FA AAG AC@L AG 0@AC vAP C] H l%%,̄AA C Y  AAH AA C k  AAF C AAP0AA FCC@ CA AAA MCA AA4AA E W  AAH U AAl<\AA AC0 C AAG  C AAH _ A AAF y A AAD HmAA C0  AAA   CAE G  AAG l AA AACP AA AAF f AA AAF  AA AAF |~T(AA AC  C AAA M C AAF JC AA ?C {( BC ~@ P8C tX xMC _ F @t NAC FE i C AAC CH AA@ NAC FE i C AAC CH AA< AA ACC@ CA AAE (< C@JO A <h AC ACEP AA AAB RAH GA( 4AC Z CG YC( AC  AH MC\$ ,1AA AC   C AAH ] A CAF t C AAG   NC ] H e C h E M(4lCAF E t AA`%C ax1+!(PAA C H AA@(AA ACCZ AA AAA LC X<d AA AACP AA AAC IC EIC E8HAF FFH@AA AA$JC F(<TC0FKHF D h(AC ABAC xA,AC E   AAG $uC Lx A lT5AA AACP CA AAA  CA AAA T\AA CAC0M EA AAJ C CA AAG l h (d=AC b CG CEx2C n( 8AC C n AA8LAC C   AAG  AA<AC AACPl AA AAG <0AA AAC` CA AAA #C _4 cAA AC   A AAD X(W,ltiAA C0  CAF >Cz$:C0Yq C 4AA AC n A AAA (|AF C v  CAD <@p ACh AC V AQ L GE EI & h C0 D  C  1Cm( C0LHq H 4  }AA AC i A AAA X <C i D G@x8 AA AAFn AA AAD <!%AA AACj AA AAC 80C d A C 8AC A AB 8@p9TAA C   AAJ S  AAK |:HC D:*C f:8(;IFIQ_] D $4  AAC   AAA b  AAA ($`_C ~ G C E (d`'C c(|`)x`C X )`AC A4D) a AA FH0 A AAG |)b")c$C ` )(cXC u H L D CT)dcTAA AAC@ AA AAA z CA AAE ($*lgC OH G [ E P*gDd*gaAC AC I A AAD CC AA*g)C e* h,C h4*$h|AA C B  CAE g CA+lhC Z ,+thxC c B f B gP+h1C mh+h=C l A L+idC } H [4+hiAC AC  C AAB <+PjAA AAC@ CA AAA  ,jS$4,xC0LNK@ H <D>AA AAC@ AA AAE 8>`AC AI  CAF C CA >C0YHo E <><$-+{:9};-8(/$)4|4&T ;@    ̍ uRW+{:9}t|9E,,,0,,,&,p,1,,*,@----"-.-9-A-0+0F-0*Й+ <`=O-W-`-k-y-,@+0Z^=c=j=q=y=================>>>>>'>1>9>B>H>O>V>b>n>w>>>>>>>>>>>>> ??"?.?:?F?R?^?i?t?????????*?,   *&,@7 LP%P   P      @ `    @    B H ## L`P6p 568+6P %664; 6X+6   666  66D 6+ 7@ 67TZ $ %6 787' %x6<7M@)  p6MF7@) %h6F7K7P) %`6K7V) %X6,Q7O P64,Y7O H6d,a7O @6,G\P 86g7}70S 06,`[  (677 % 67R*0o  6,[u  67%C0u 67Cw %6(-( %57(P %57Z` 5l-"P 57tL 5-Z %5-8p 5(.| %5H. 8 58#8 %5.1u  5(8<0  5/N@  538N 5D/N8 5t/W8  5]8g8  x5n8/  p58"T h588 `5808 X588  P585  H5/0 @588 85/8 %0589 %(59 5/%5$05T0W5!9@50;40414<14`1uR41494<9K94M9Z94d9u949419@ 499 49b 499# 41902 42}e 4@29i x429m p439 h43: `44?-tttttt,tttu u u T u u u u %u (u 7F8u;u?uCuGuKuOuSuWu[u_ubufuju*nuruuuyu|u=ZJ u!u"u#u$u%u&u'u(u)u*v+v,v-v-$v-*v-/v.6v.v/v/@v041Ev2Iv3Ov4Tv5B6Yv7_v8ev9nv:jv;tv<v=v>v?v@v[v\v\v]w^ w^w_(w`5w{@w{Sw|aw}mw}{~w Pi`ipiiiiiiii j tj j $j Dj Pj j j j j kkk,kp?$q@\q[q\q\r]hr^r^r_s` 8FP@PNoD[oTj U@s VH |PP\0w\   i     # <` 8D?  ? ? ? ? ? 0@C@ 4D t hO t