ELF844 (444  TTT_ _  p_ _ hhhDDPtd44; 4; d&d&QtdRtd_ _ /lib/ld-linux.so.2GNUGNUvEw0d /")8KgUa!c,d'4qwC6FvX}7,C0tSJ.N@5~RmDhtx /^y>.O!>mNfihZV'KSa  ]E4`]&gYf8Zk k N Lk    libz.so.1__gmon_start___Jv_RegisterClassesdeflatedeflateBoundinflateinflateInit_crc32inflateEnddeflateEnddeflateInit_libpthread.so.0pthread_selfwaitpidforkpthread_createpthread_joinpthread_setspecificpthread_key_createraiselseek64pthread_getspecific__errno_locationfcntlpthread_exitsigactionfsynclibc.so.6_IO_stdin_usedstrcasestr__xpg_basenamefflushstrcpy__rawmemchrgmtime_r__printf_chkfnmatch_IO_putcstrncmpstrrchrregexecpipe__strdup__open64_2getpwuidmmap64closedirftellsignalstrncpyregfree__stack_chk_failunlinkselectmkdirreallocstdingetpidstrspnchmod__assert_faillocaltime_rgmtimestrtolisattyfeofstrchrnulsymlinkfgetcfgetsgetpwnamcallocstrlenungetcsetitimersigemptysetmemsetstrstrstrcspnrmdirfseekchdirmemcmpgetpagesizedup2unsetenv__fxstat64poll__fprintf_chkputenvstdoutfputcfputsregerrormemcpyfclose__memmove_chk__vsnprintf_chkstrtoulmallocstrcatstrcasecmp__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfregcompstderralarmmunmapgethostbyname__snprintf_chkgetuidreadlinkexecvpstrncasecmpfilenogethostnamegetcwdfwritefreadiconv_closegettimeofdayrenamemkstemp64__memcpy_chklocaltimestrchrutime__vfprintf_chkmktimeiconvfdopenreaddir64qsorticonv_opensleep__strcpy_chkgetrlimit64__sprintf_chkmemmovefopen64accessmemmem__strcat_chkstrcmpstrerror__libc_start_mainferrorsnprintf__cxa_atexitZLIB_1.2.0GLIBC_2.1GLIBC_2.2GLIBC_2.0GLIBC_2.3GLIBC_2.1.1GLIBC_2.7GLIBC_2.1.3GLIBC_2.2.3GLIBC_2.4GLIBC_2.3.4       '@ii ii ii  Dii qi ii si si ii ii ii ti ii _ Fk k k ` ` `  ` ` ` ` `  `  $`  (`  ,`  0`  4` 8` <` @` D` H` L` P` T` X` \` `` d` h` l` p` t` x` |`  ` !` "` #` $` %` &` '` (` )` *` +` ,` -` .` /` 0` 1` 2` 3` 4` 5` 6` 7` 8` 9` :` ;` <` =` >` ?` @a Aa Ba C a Da Ea Fa Ga H a I$a J(a K,a L0a M4a N8a OD$= $Ml `p D$ $Ml t  p D$Z $Ml t p D$d $Ml bt p D$n $Ml @p D$ $Ml t p D$; $Ml t  p <$FL<   щD$k D$$KcvD$| $Ml Jp ;t&D$P $Ml Pp =p u=k t p D$ D$t$$k )Dv[23u4$7D$ $D$`4$tl 볃 D$ D$$$T$k k :D$$@~D$$@~,|$,t<11ۋ|$4@$;\$,rދD$,l D$4$=k T$?1b 1D$T$D$D$@p $1`ti?p  }D$͕ $@p D$ $@p m=(t  =p   ~  $C$!$!D$$r &$T$N D$@$o&D$X$ D$|$$Y~&16D$X$"D$XD$T$D$T 1$t&,$P;l tL$$k D$ D$$h D$ -p D$\!e3l![^_]ËD$PD$ $ۉ=k tH1t& k @$T#D$ D$4$D$ ;k rt$ D$D$$G b=(t tG11ې0t @$"D$ D$4$D$ ;(t rt$$ 4$4$b)=p FD$( 7$KD$l$ 81ۃ=(t y $! $!Bxfp$( i$\ ]$ AkUWVS1ۃ -@t D$vX9}Lt9tV<>u19T$v:: J\$t9t4< u19L$vD$ D$$E 1k1(t&<\$0\$@t$4|$81t\$0t$4|$8<ÍD$,D${D$(D$ D$<$9t|$(t0$<$$ D$h\$0t$4|$8<ËD$,t$$D$4ub ts,`D$4$ D$Ev<$$ D$%'FF_$D$uG&[t9PtPuL$DT$T$$u2[u͍Gunt$u,[^_]Ív뙍D$$5YUWVStF4$Xs-9ލvw;/u)4$sD$|t [^Ð1t&D$ D$$M D$t Ð&t t$M 蘻t8u$[ ٍ'VS$$V t$_D$D$D$Ct8u[|t t:u\tc$L\$4$D$XqD$D$$V D$@4$m$[^͉뚐t&uD$ D$m 4$p뛍vVS\$ t0fu$oX  t10fL օu[^Ít&SD$ $D${ É$\$$X Ҹ}$S$ D$ϊ$;[Í'S$$\$ t3JLu tDD$$AĨ[Ð\$$ 踲Ĩ[V1SL$ t$t&Q\Q   ةuu1[^Ðt&[^át 1VSt$ t k2t  ˃  LPPu@([^<.t4< v0<:t,<,ft&<t<'<\ ffÍv'$\$Ét$|$y4wu D$|$$蓵Ћ\$t$|$Ít&'WVSÃut&t &u4$u MftFD>ut41&t twu 9uՃ[^_Ít&[^_Ív'UWV1S|eD$l1$=;$$Q=?T=u uD$2$u Z;D۸?D؀?uL$$]$襳D$;$;D$Zt$:D$2D$u 4$$um}1B5 10  =:T$le3ƀu u |[^_]Á;|\$|$$Ȟ 8g$诲$۶;D$$D$(FT$(D$ D$ T$,Pƒ&t>,D$$|$$D$ D$ Pƒ&u‹T$$T$(T$w׋ƒb E‹T$, $L$T$D$]T$L$L$,T$$돍&D$$=?ƀ;$ 谴t 8'k$T$轵T$=T$D$ D$$?VT$$Ɔ?@D$ $ nD$ )t$ t$$D$D$ T$?D$4$趱T$$貱1L$5 qL$ SD$2t$,$UAl$$ t&D$D$$?0 CHt&D$$?T$T$t$莳$ D$蚬T$t$ΰT$ 4$T$޲D$.4$4$.$?ƀ?.@D$ D$.T$$貳T$D$D$ )щL$?$?^fc wk $T$轷c Vf$ 蜪˰$~$ѝ y)ЉD$D$ D$ ?$o$ ?$ 3vD$$D$ D$D$D$ $IÐt&\$t$$8 }$H o$Y aT$ t$\$T$ $\$t$É'VS$i #t C$|  t C$ $| $i ٰT$ t$\$T$ $m[^Í&CÐUWVSl$T$$L$$$@D$,E=tT$`tl[^_]Í$pT$ۃ $t$|$T$$4$|$Tt$\>ۉD$XT$|$4t$HBD$B<$D$LL$(ft$<$TD$P%=@=tċL$LD$HL$ $0E=tu щT$ L$TL$$T$T$$t$<$ƚr$?9D$,~T$,$P@T$B$MT$Bl[^_]ÍD$($D$4$D$ T$=|1ۃD$P%=@T$LD$HT$$̏$T$L$L$$T$T$T$‰p4$l$t$ $D$qd$P$D$_$QA/BAADvD$$^$$? D$$$, D$D$ D$&D$O $X O$ ϥ UWVS|$0l$4tdt&@uaX$u H[tA3@tF($ςE= tuՃ Љ4$T$8[ufu[^_]Ð@($腂u㍶UWVS,D$\$@|$Dt$LD$$I^+&E(tD$ D$$襇t$,$׉$tu΋s11At&< C=t" |$D$$T$HfS9s\K @x u<t<uL$HD$D$؉|$$S9r&uD$$],[^_]ËC $CCC ʃ$[|$$h D$跣VSӃ@1҉D$ f9w1ҍ8u0[^Íy Ív'y T$ÍvT$1w ÍVSt$  4$D$ctut$$ v[^Ð&U1WVS-y tOT$(y 1҉$D$.t&t$(x8t;$DЋDu΃[^_]ÍUWVS,t$HL$DD$@ ʈ&NHNHN H N@Fy y H9 D$ D$,$nD$y ~.=y 1ۉt$ƍvt T$9ut$y $蚦D$y y D$y T$y ,[^_]ÍD$]všy D$뽍t&'S\$ $Pt [Í&;$D$D$[f<\$,\$DD$@|$4|$Ll$8l$Ht$0$t:E\$$ D$象11T$P\$,t$0|$4l$8<Ðot։l$1|$$D$oT$u‰u ڈ{tl$1|$$D$T$t}t&b1ul$|$4$zuJf2l$1|$$D$T$J,Mz,C1t&VSDt$PD$\$4$D$HR$$\$4$D$0RD$4$M\$,t$0|$4l$8<Ít&$ 谛uD$$M1ƍt$뒍v'UWVS\$0L$4$n荜~)T:/u{K|/ufu;~B=SD$\$$ wD$$ ljD$]<$ 1,+t&=~1ۃ[^_]Ít&$ t\$,$RD$<$uD$\$$ Ɩt<$1踘u D$$ 諝wD$$c 菝[$ G$\ cn[^_]Ít&?tf$(tQ$=wBD$ t$$ 4$D$\$$ 4$1ۖf`t \$|$$$$$u*\$|$$$Čf1tz1)Ήm€E@t $ ͉ хʁ@t{!ρI19xL$$话^D$D$\$$ xST$ `t Zt&T$$et&$ ofс N&UWVS|$4t$0t}tv11ۀ/tz8uf, Eu|/t  :u)L$|$ u/t>;tSC:uÀ;uv$,e3D$<[^_]ËL$D$4$L$ֽt$4$x4$"~|*/t4l$t$<$řnD$ d D$C <$D$ Ltu11?fD$D$<$CT$(D$L$,BD$(D$,D9t0< tP^vD$D$\ <$K9uЉ<$D$BD$(T$, PT$(T$,D|$$; _<$C<[^_]Í&D$֔ $At$CD$֔ $hAD$D$S <$HG$; 0L&S(T$D$D$ D$D$$$ ē=w[X`  0! L " ڃL # ¸$ ([$ 貈fD$ $d Ð&,l$(l$8t$ t$4|$$|$0\$t\$t$<$~)u\$t$ |$$l$(,fu$q *f$ <  D$ D$D$ $MÉ' D$ D$D$ $}EÉ'D$$T$(0D$ D$D$ $Ít&D$$T$(D$ D$D$ $EÍt&,|$(|$0T$eD$1\$ \$4t$$D$d|]tC;t$8sfډ1ɉ3T$e3u$\$ t$$|$(,Ð1ɺ 贌T$T$$ |t$$ l-$Ӊ뢍l$$ T$f,\$\$$D$'$ :\$$t$(, <$L$\$,Ét$0։|$4l$8шō@1$荌PVljP VP V PV@@@!P@%@)@-l$\$$謄l$DL$D$@OtD$D8\$,t$0|$4l$8<Í&UWVSLe$<1\$(T$D$$D$D$t&l$D$$`t޿ 8u*D$9D$S $*DD$D$뤍t&!%tDVD)ރ*~9$(T$$x"D$Pb tD$Qb fD$$$|$(^ڋ !%tDJD)ڃ*|$Q $(D$)T$$,T$$$(BJ$,P$0P$4P $8PvD$T$$<e3uOL[^_]ÍD$Qƀ> D$$L$$(D$D$$D$Q D$Q't$Ɖ\$|$D$\ @ $ǡH Vu{tC\$t$|$ÐD$ <$|C1tS/4$CC\$t$|$$\ L O녍t&'UWVSe$1  fC-D$4$ku$\ l$8D$$` D$ 2D$,yt&to{-|$4$tC$D|$D$ D$ dD$D$dD$,$=dw{D$D$,l$$虔u$` 2t&1$e3uLĬ[^_]B$\ \$$0t$$Ԣ {봉|$$h z'UWVSÁ $$e$1T$t=$T$D$t$ډ$T$~D$$螃T$t$,D$t$$~<$D$lT$Ku&tD+b uD,1l$4$:t[ 8u@D$0L$0b tb u$T$,$D$Nj$e3ļ[^_]fpackBed-rBefs$D$ tnT$($~D$(D$t=tRC-t$$g}uS1US US USU CED$VF;~t& L$(T$$D$$D$ l Ív   Ðt&UWVS|$0<$t|/t |7/uu[^_]ÉŐ$规l$|$݉$}E/.gifEt$莜t2$|<$蜀ƍ$Xt$|$É$|D$8VL$43/D3$D$$z|[^_]ÍUWVS$$$e $1ɅD$(T$,tE$D$$$D$ D$(D$ D$$D$ T$~4$lv.TL ǹָDv@uv[^_f@,$9<ty uOT$,$ӥT$$ԣ T$D$X$3T$V$V,$躣D$$ D$V$!['$$$e$1҉$$$$D$DŽ$\$$ jT$ T$$D$aD$uD$0%=$$T$ D$|$$$t1ډu9$e3$$$$19ډNt11Ҹ $tT$@$|$$T$D$tZ$ 6\$$ $t$$[t,C]$[\$$h D$TfD$|$$d$$D$ D$t$,$VvD$t$,$Z\8l$9$է 1rSf11҉$hc @$c D$$|$$t$c D$\$$ ׷$ ɷ|$$aZ[$Y\$$d D$Rt&\$$ R\$$c pR\$$H XRh\$1$ >RD$S11҉$z:$1@$H $H$H$H$HT$|$$T$l$$ Qt$2fD$ $D Q\$$ el$$ St$$XaiZ$?Xl$\$$8 D$ #Q5\$$ QD$ $x P\$$ Pl$$ 蹵$Al$$ 蘵$ 芵t$$"XZYPw`l$$ Wtl$1$ LP$ +l$1$ P$1Wl$$ D$Ol$1$< Om Ul$$ Ot$O UWVS\$p$xe$L1$t$ t$蒳t$$D$4$)$Ɇ1C$T\$,$#ZuSt#$8L$L$ ,$L$ $R1$Le3\[^_]Ívk D$*D$$ D$ TT$D9r$D$ D$$R;$~v1)9s)Gl$(|$$< uW9s>G< t6s<>t>< ft8؋L$0>t* t%9uD$,$ D$I1;\$0t؀8 tݍ$T$D$ $RD$ D$D$ $$Qt$8$t$D$$脗ut$8C|$HtT$0T$Ht$4$t$ETt$$'Nix _$D$BT$$D$ $MT$$D$,-$8 H-t +Hb Hb Hb @b B$D$ D$$Q$z :$D$D$,T$$|$T$D$ $4$RD$T$(B1$I,$$e3[^_]Ðt&$lNT$4T$$D$Juv9T$d$|J9t$`rBD$t$$`JuB$D$ \$,$ xt&$H,$;@$ݾ-I$ D$(D$D$ D$$D$D$ $iÐt&L$ T$&'VSD$0\$$t$4D$D$,$D$;p tJT$ $T$T$(T$1҅x [^Ít&uT\$$& tCِt&ttG[^f\$$ @C[^Ívủ\$$& +Bv\$$ B&VS\$ t$$u t&tC@t$$7Fu[^Í&UWVSl$e$\1T$4t d 1҅t.1t&$DJډt Ƌd u$Mt T$8D$0x 1T$T$$D$\ $T$$>T$$;-u{gu {D$l $T$$>T$$D${ $T$$>T$$|$,yBT$(B vET$dE\$Lt$P|$Tl$X\ËD$@L$(P=AT$(B=J>@b<߃AB=D$(H uCL$(A>D$ D$$W@T$(Xa$ H3D$ $T$$7T$$T$(B>L$( A>D$(H>T$(B>B>D$(ǀ\D$ D$$?T$(\$, 2D$ $T$$6T$$u6T$(B>L$( I? I=@A>ǁ\?D$ $T$$r6T$$D$ī $T$$R6T$$uu$ \1D$ $T$$5T$$tND$ $T$$5T$$xD$ $T$$`5T$$u$D$(H=D$(H=T$$D$ $T$$ ƃ-u({rq{N{m{D$ $T$$4T$$u{vu {HD$ $T$$4T$$D$ $T$$AD$( $T$$%D$2 $T$$B4T$$D$(HA0L$(A@IAȂA@$ /D$(H=@$蟜T$(D]D$(H@ D$$ 7D$(HA3D$(D$(HA T$(BA BAD$( H@ HA@D$$]7D$(H@ HA@D$$87D$t$$LtPD$,%=@t`=tًD$$$E\tɋu щt$$uG$&G0[^_Í&D$$$ $g$'p$ D$!&VSD$ p$tBu ‹C$t$C$謝u vu[^Ð&UWVS&>Ѓ  ‰G$j|$$D$vuɃ[^_]É'\$\$,t$t$ T$$ t$D$C$m1\$t$ UWVS1Ʌt/NPtYBRPSPSP S @C1ɉډ^t1ɀt4t&T$,e3ud<[^_]Ð1t&ot&X$tǍ& ȃ  t$T$,$c[uԹ <\$4\$t$8t$@eD$,1\$$ AtD$,e3u2\$4t$8<Ít&$ztD$ D$4$- 'WVS\$ t$$ 1tftc 0K@@CHC<ǃ WǃPWsaC<`ǃPǃTǃHǃLǃ\CLǃǃ$$ t t[^_Ð4$![^_Ðt&{t&fUWVSl$$D$Y eT$\1҉4$D$ tA1.T$HŸ \/;T$D9EƉD$$$..D$ 4$gt xD$ 4$Gt x1>^pD$0\$4D$D$ D$\$4$0u7$@$ډ1T$0$‹D$ 1҉ЋT$\e3l[^_]Ðt&D$4D$$@T$H$ED$,D$4$ ED$(T$,$$D$,  ‹D$,D$(Ѓ $ ‹D$(D$,T$$D$D$ T$$lD$(\$D$D$ $T1t&ft&T$ t$B$9$D$ 1҅^$D$ ^ T$ .t$B$z9t&D$(D$D$D$,$DV‰NjD$ <$]ND$, $  D‰\$t$$o S\$$CSD$C $D$ M~)C[Ë$ D$D$(D$D$,$ UWVS$$$D$dD$8e$1ɉT$,L$HD$hD$lD$<tQT$<$n D$8:-.z-$zL$8T*t D$deD$| $D$DD$@D$LD$0v     < ĩ  D$TT$,L$0D$D$@t& tD$,D T$,tD $e3 D$| Ĭ[^_]Í&;$D$|D$DT$,\$TL$0D$<\$T$\L$TD$`z$T$,L$0D$<\$T$\L$TD$`z$lW&D$TT$,L$0D$D$Ω  ש t$0BD$dD$, T$0D$ \$D$\D$TT$TD$ $`zT$H1tT$HL$,A %`x}p$ Dw-$DT$,D$8$T$4vݩ  tF  uXL$,a$ $! L$,A $ D$$ $l $  \$$6 $H $i $ ~$D rfUWVS$0CS CCT$,C D$ ՐMuL$(>|$$ t&F= $jgt6<C=tЅűFt$$D$뷍&|$$g l$  |$ pL$, $ C<C=@gC=b1tq ɉL$$tg\$ t&T$$*]$t;v;D$$L$ (ƉD$|$ $JF[uȋT$$R҉T$$u1[^_]Ít&<|$$t]<t<< C= ‰C=tf4$4$s<<#C?t ~? ‰\$4$>pD$ t$$WC<DŽ$ ҉$ ׍t$$r8u닔$ \$ tNDŽ$ J:$L$( D$ #D$$L$($ u\$ u&0x$% ؉;0u+DŽ$${?MD$($D$ D$$tlP$$Pt;C v @$ډ$t@Tk tK9sG$uD$$-@C=4@4$K=@|$$6xCt$4$T$C$l$ $`F<$t9L$ 9J w@HttI@uD$$l$$F<tC?0y$T$ S>0tNt$ tFD$ t  ։1@tS> 1uuӋ$L$ L$(MT$ 1DŽ$ t'|$ $ t$$5u닄$ T$( Ru$ \$,T$$ft_1f1uQ$t:?uRu@uхt(D$$뿍& މ1@uԋD$ \$,t@D$ t&1u  ։1@uދD$ f"@uD$(t&"@u$ $9L$( $~9$T$ C u9D$$vuC?t$ <.E u<9D$$t-T$@u 0ۅtF$1ۅth1ۅÍ؋t$ \$|$$l$(,fF$wuO<Őt&Bfnt&'L|$D|$Pl$Hl$T\$@u tˋu$E$D$\$}D$,(vC$tPuBu8t3t?G=@uՍD$,$ډy[t&FvD$덍t&vD$0{\$读(v'VSÃP0$4tt$$Jv&C=@u&Pt;F wى$xJt$$|tt [^Ív4$]H$ D$t&1[^Ã4$3H$ D$vUWVSÃ<@><u&H~Hu⋓LtLtS>Ћ{C>t$1stN1 f ;ss=t@t(uރ  у \$$W,;srfC<$D$j5C><$#5t<[^_]Ð1-P$tKՉL$(D$,\$$ut$H@ ‰D$$XH;XL$ ry1ɅtlD$ 1҉l$f0>u 9tl$ uD t$t&Í6  DÍ&A?   DÍD$$D$D$ $i8uËk $T$k D$ D$$i$Ét$$|$ljl$ Չ1tftЋ|$C+l$   ω t$ ȃƒ ЈC$Íxf#mff[&S \$ $\${CD$CD$C$[ÍSD$$$H D$D$ D$; t9 $Ë@x$Cx$$~$&'UWVSÃ/4$tUD$un߉t$<$|\$$P>/tg؋t$0\$,|$4l$8<Ð#$D$}l$É$#륐t&D$@|$$D$y&'tR$i,$ljD$S$D$O|$l$$D$T$u;|$ ;vt% ;$!4$1$!4$1;tt8/tb$V;$A|$,D$<$$ $ 9$p$\ _D$ $ \$$ $4 |$$ٴ ;$ D$;$ٴ D$\$$ٴ t&'UWVS<$) ËD$Pt D$PD$$ D$(  !%tDQET$(\$(l$( $ lD$ t?L$PT$(c;t \$PtL$P ɉ B<[^_]É\$$ !GD$$ D$,41Ʌ11t$ \$(t$,|$$ύt&$W $bŅ,$\ c9}a /ut Y 3T$$3D$ e$Y qƃ D$ $Y |$P$ \|$P1&W ^.D$ W T$PD$ q$ 9\$(tD$ 8/t$$6D$ $ L$PT$(D$ mD$,$D$1Ҹ\ L$L$ƉET$P\ $  9\$(\ t\$$ $ ,uiL$PT$(m1\;fc 9\$(tD$ $D$ D$ $$ t$ &-;I9\$(uD$$t('UWVSÃ<1L$$t>21׃  TF FuՋL$$<[^_]ÉT$,6$ƍ@< $L$$l$Pl$|$D$ D$D$$L$$T$,12^'$$T$L$$É$։$$<$D$ + D$D$ED$$$E|$D$D$$$;D$$t$\$$'D$$D$$$$$$$ĜÍ'UWVSÃ(P $P ҉T$~?1ҽ$  ;T$t$<$Ɖ8u݃[^_]Ðt&$d ޹18Dƒ[^_]UWVSӃ,D$@D$D$@ D$tA1ҽ\$ ;T$t$t$8u܃,[^_]Ít&\$T$DD$D$$T$щB RSPSPS P SPA,[^_]Í&$$$$D$$BD$tD$xD$|CƸu}D$D$\$$WuD$$%=uoD$@|$t\$<$D$臍uWD$|8/uND$$u:<$螁D$$5$$$Čf|$t<$dɍ&UWVS|$<$;t_l$D$/4$uCCs,$V,$D$, DE/\$4T$8D$,$萹^$ v؍t/ uT$4Ѓ=T$0wT$8\$$NCt)T$0txE9҉uut&T$<,$T$T$0T$Px,t 0 CC1D$,$й$Le3u6\[^_]Ðt؉$Pl$$< D$8et$t$ \$|$4$5$ߴC|$Í@E$FS1VS5VS9V S=VSAD$$ u؋t$\$|$Ít&$1誰ލt&D$x,t 0 CCÐWVS0 t [^_fsCt fC1@CgC@/uC1ҍvu$1D$脹C҉u v{uD$ D$|$4$ ti1ҋL9ډu4$C腯0 [^_É$D$ D$D$褶1묐t& ؐ0  UWVS|$0L$8l$4‰tew>w09v,ڃցu܋T$<2[^_]Í$4 蜪1[^_]øύt&'L\$<Ét$@ֺ8|$Dljl$H8D1tftD$P3kC D$TCN>xD$(D$ D$,D$l$4$¸tjL$, t])Չ3k$YD$,t$($yt$D$+ D$ D$D$D$TD$D$P$ɬC1\$19^v~$t\$t$Ív[t$\$f4$`1uɋV뭍vSD$L$ Px$t0PR\ȅx1[ÐB[ʋ@Í&I1ҋ[ÍUWVSL-d |$`T$d|$,T$8zhT$8B$0w|$0|$,t$D$Xt hD$X$\$\T$0$D$L$L$4$D$8HD$PT$Tl$$$T$D$D$\$l$ D$D$8T$$薗$h$L$\$D$0L$,5 P T$<ׁ 0 GT$(t0$L$(GG5 P +w 0  0 Bt$,;5c d 5 P vld u!bf5 P 95c [sOd {u݋Ct։$蒞CC+s95c 5 P B[r&$T$4L$EƉ$ T$@@t{T$4$pD$G@$*T$ƋD$d8D$d)@@4$gtL$dt$ $D$o)4${pL[^_]Ét$$ ]lkD$D$$#L$dD$ xvD$$#L$dT$ Vԍt& LD$dT$dD$$D$(pD$\$\$$$D$,C)D$(L$d\$A$"x]L$dtxT$d)BBD$($D$ #D$(L$dD$D$, $D$1($ $L[^_]ËT$dtE9D$dp@0D$ $"D$dj&D$$"L$d룐&,|$(|$\$ É|$t$$D$D$D$C$19uD$D$<$"‹D$Ћ\$ t$$|$(,ÐUWVS$$D$0$T$4$D$}u+9w'}f<{u9s {^+9v|$,(D$TD$,D$81D$4L$0D$T1ۋT$4D$ ,$L$T$i.T$8T:-T$(HT$811Tאt&TJЀ L$(D$dt$ $qÍD$d$D$U$h\$d<D$`L$0D$D$\D$D$XD$D$TD$L$ \$|$$t@D$\D$D$D$X$&T$4l$$ T$D$ dD$T1$`hPf9t$,ƒ)9sW1ېt&<9\{ut;ɉL$huDL$|e3 Č[^_]Ít&1ۉ;T$(ÄɍL$htPu|$h<$讐$輙G$u xv@tnuL$0BRPQPQP Q @AO|$h<$}T$,1T$4D$4U1T./'$D$4L$8D$HD$HD$LD$PCD$ $%L$0D$TD$ D$$ L$=D$4;D$42L1T$,T$8&|@Tu|{u\$,D$8T$-tD$D$ D$ D$D$Ct$(\$$D$0,t&\$$t$(,Í&UWVS$$$$ ,$T$8L$0e$1҉D$Hb|$01tftL$0ډǁ0L$8JtDE<:tl1҄u2f<:t<{tBt<})uf$e3[^_]Í&뫍v~E$\ >vD$(D$D$$D$D$ $Í'UWVS,t$@\$Dl$H|$LD$%$ H\$4$)ډD$T$D$8x%tX|$\$4$ՅtA뭐t&D$4$pVN%JNNDD$Xtt&D$4$8FV%PVVDCv,[^_]UWVS|$8l$4u 9t$\$,$It4t$EuՃ[^_]Ív1[^_]Ít&_t܉$E\$D$D$0$[^_]ÍvUWVS,l$D\$@ED$~~14fD$$MCS9t$ PSSDtFE<0%uD$$CS%PSSDE<0돍&,[^_]Ã,\$ \$0|$(|$4t$$3|$$D$8|$D$D$ CC$-Cu5t\$ t$$|$(,Ð$D$D$\$ t$$|$(,Ësƅt%9s=Ss2\$ t$$|$(,Í&D$D$$D$VI U WVSD$8\$0t$4D‹{+D$$tvCD$ $SD$S4$T$?J}ʅu$[^_]Ðt99sIC{8[^_]Í&CSC[^)_]D$$1oH&UWVS,\$Ht$@|$D.w/ \$4$\$F<$D$@x%9r9ہvυtF,[^_]Í'D8"tՅu#vt29sJVF,1[^_]f4$D$D$,[^_]ÉD$D$4$TD$G&UWVS\$0t$4|$8D$$4$AtgCC%D$$CS9 PSt4$CűSt C1[^_]Í&D$$Fʉ'\$D$$t$\$ t$(|$D$$t$uiC{T819t\$t$|$Ëwt'9vBCsD81\$t$|$ÍD$$ōt&FVSD$$D$$6Ax,D$(t$D$D$ $4$E۸H؃[^ÐD$D$D$D$;&UWVS,L$ftV_9~3D=T$D$D$$;T$}ȉ9͋D$@,[^_]ÍD$@,[^_]Ív'L|$D|$T\$<\$Pt$@t$Xl$HD$,SCJ9sC9׋,r]C (u{2D(C\$<t$@1׋l$H|$DLÐ CD$,$BDS9׉s)T$(DT$$1;C (t4$T$vBT$ƋlD$,S$uNjD$,'׋O&'D$$D$D$D$ $Í',D$0L$P $L$4D$,Í,D$0L$P $L$4T$tL$8¸҅Eƒ,ÍS(\$0D$L$4S$L$1҅t ([É'U1WVSt$0|$4l$8^t,11;^sl$$ׅt[^_]VS\$ taC t"Kt11Ѓ$9;srT$$t)st"11D$U9;sr$D9CC[^ÍWVS\$ |$$tct-St&11t&ЃT$@$׉;srC t$st11fЃ$8;sr$8CC[^_Í&'VSD$$t$ t$K;^t811ۍt&PT$ D$ $D$c>;^rЃ[^f\$\$ t$t$$|$SKB9w<C Ít&UWV1S,D$@l$Dxt21ۉD$1 t&9t'T$4‹,$D$~6uރ,[^_]Ít&,1[^_]ÍD$$D$D$ $yÐVSD$ \$$t$(tu'@u91tt\$t$$ {21[^Ív$<:Սt&$Ց뤍v\$\$ t$$iteуtu\$t$fшސ$跍$t$$ D$11믐t&KiD$$D$W돐t&ll$hl$peD$L1\$\\$tt$`|$dED$E|$x?D$A T$$CT$$~h{/ ^C0D$ $Ct$xD$ ރ5)؉D$$:)ڃ \$\$8T$T$D$ $:T$d D8D$$3d $D$3b $D$3d $D$3cT$$$Et&_9D$v\D$ <$uE)؉D$D$ $&9t')؉D$$><EG9wlE D$T$Le3D$\$\t$`|$dl$hlÍt&T$$$ETt&D$$$hEWt9<>u19v4: Jt9tp< u19vD$ D$$6E D$t&\$$ .Et&D$$$[E|13v<1\$0\$@t$4|$8t\$0t$4|$8<ÍD$,D${D$(D$ D$<$Mto|$(t0$<2<${$ D$ .\$0t$4|$8<ËD$,t$$D$L4$D$1D$\$0t$4|$8<Ít&<$p{$ D$-5t&'UWVS1ۃl$4uBZt&D$2 4$xtA)߉|$D$ 4$6t)x9vt$0D$ މ4$7u[^_]Ðtp` u!8\tK t6t u\Aru` Ðt&\AnÍt&\A\1É'L\$<Ét$@l$HՉ|$D$531tAt:0tJD$N 4$L$,4L$,1t1u,~u&\$t4$zs{ DC[^_f$C t&l$ ͋L$9T$$Ét$Oʉ|$9ɉ(u +D$u$t$|$l$ Ðt&~ ݐt&;T$}9҉މu1|/D뱐L$ D$T$ɉHuÐvVS$\$4D$tKD$D$d D$ $D$*t*D$D$D$0t$$$[^Ít&11ډ$]$U D$bfSD$ PH+9r )مɉHu [Í&[$C t&'UWVSÃD$ $_T$TVS4e$,1$H\$,$@D$ D$D$$DD$$D$ k \$t$ D$ D$$ $,e3u 4[^9t&D$$$z D$D$ D$AÍ'D$$$ D$D$ D$Í'D$$$H D$D$ D$$t&D$$$ D$D$ D$$t&D$d ÍD$$D$D$ $'D$ $ D$'D$$D$D$ $d &VS4e$,1$@ $1 &t,w$%,ru݁t Ƅ4,%rƄ,$,\$\$,D$D$= D$ D$D$$a$DD$$d 'D$$D$D$ $ÃD$$D$D$ $ÐVSÃT$$[CCt$D$ $Est9v(Cs0[^Ít&D$$D$ x D$&D$O $X  & D$(T$$\$t$|$l$q3$T$$t)1KCF #%)#_*#Ovw ?0T+?`v} vrvdЃOvGt{vD$$1\$t$|$l$ ùz1&P9 ;4Ť w;4Š Hؐt&3*IvST$€gS$€QST$€:hM|$? ? <$? kƀ? >&1ST$€cS$€MtHtSu |$|<$? ?  ƀuu|$ƀ4$o&VSt$ t.1ۀ>u /fÀ:t&D$ D$$T$ u݉4$Ã[^ÍvD$ tJwD$ uf tD$ D$$WD$ u1É'UWVSѐ&\$\$ t$t$$|$$t$t\$t$|$Ð…‰u0É$d t$$uu,$ D$$u붍D$$hs붍v',t$ t$8|$$|$4l$(l$0\$t$|$,$ytރ tى؋t$ \$|$$l$(,Ít&,t$ t$8|$$|$4l$(l$0\$t$|$,$Uy:tރ tى؋t$ \$|$$l$(,Ít&UW1VS\$8l$0t,t$4 t&)t\$t$,$D[^_]Ðt&UW1VS\$8l$0t/t$4t&t.)t\$t$,$}[^_]fo[^_]ÍD$ $x$ ='D$$D$D$ $=t$ t&<$,$@$0t$e$1$4$8D$\$4$$,x8$e3u#$,$0$4$8<p[;Dދ(lj$e"/$ D$Cv,\$ \$4t$$t$0|$(|$8$  D$+ |$D$ D$\$D‰D$4$9vt$0\$ t$$|$(,K&\$ t$$|$($,UWVSD$ $T$qT$ D$D$>D$ T$$4D$>D$ $Ɖ׉T$$ C4$|$D$>D$ D$>D$ $Ɖ׉T$ C4$|$D$>D$ D$>D$ $Ɖ׉T$ C4$D$>D$ |$bD$>D$ $Ɖ׉T$R CD$>D$ 4$|$D$>D$ $T$T$X CT$D$,$R<[^_]ÍE<[^_]Í&<[^_]Ð&D$$D$D$D$ $1Í'D$$D$D$D$ $Í'<\$,\$Dt$0t$@|$4|$Hl$8l$L$  |$D$+ D$ D$\$D‰D$4$?9v'l$D\$,t$@|$4t$0l$8bʉ|$(<$3|$3|$ ݋\$Dl$ |$\|$<3|$41ߋ\$1lj|$4t$4|$\3bʋ\$,4$3\$813t$$|$$t$ t$H11É\$8\$ t$8\$$3bʉt$$t$1t$$3\$\\$$\$\\$\\$@3\$<3\$X3\$(Íbʋt$$l$\13l$ l$b΋L$$3L$ 3L$<L$@L$T3L$Lt$<1ыT$@1ً\$  bӋT$$13T$,ڋ\$,T$ T$D3T$P1‹D$ 1l$$bʉl$$ʼn13D$@ŋD$@D$@D$H3D$T3D$(1bʋt$ NjD$@13D$ |$@D$,D$X3D$D3D$41ȋL$,bD$@11ȉl$D$(D$03D$H3D$8=bʋ\$(1Љ͋T$,13l$,ËD$`X\$`D$(t$ D$T$L$C SKsd[^_]É'D$@@#Eg@ @ܺ@vT2@Ít&'U1WVS,\$@l$HL$D3{L$?StG@)9FS2T$|$L$$?T$t ,[^_]Ð)|$[?v/t$؃@@A?wL$E?L@L$tL$l$H\$@L$D,[^_]Ht&<\$,\$D|$4l$8t$0t$@;kD$@ $ȉD$ȉD$7)?D$D$D$D$$1Tʉu\$,t$0|$4l$8<Ð,|$$|$4\$t$ t$8l$(l$0<$=tF9Ct$|$,$]D5؋t$ \$|$$l$(,Ð|D$D$$$D$1҅uD$ 1%=@‰Ѓ| UWVSe$1$$DŽ$d 9;d D$\$$=}d D$$$d 1tC$u$$D$$d $d D$$5d tI4$<$D=t|/t/|$$<$D$,D$t$$utD$<%=udd D$D$d $=d ) l$p d d $ufd $e3Ĝ[^_]Í&d D$/$VtF$ǡd O$$et\$$ t&$ǡd V$ ed $ D$0d $ D$;|$t$$ D$$ \$D$<$ v'VS$;/D$$ X$ $tD$ $  !%tDJD+  \$D$ D$D$ D$D$$ .= [^ÐD$ D$D$ $$D$t$$m/$$3T$$3D$ $$3T$|3D$x D$t$$  /#, Dt&D$\$$ x=\$D$<$ t&$0 ,D$ k L$D$T$D$_ D$$,Ð&VS  u $`  P  u<uG1҃9rtft[^Ðt&Htvf묍vVS  u $V  P   u<uG1҃9rtft[^Ðt&Htvf묍vWS  u $¡ ף B00$  u4u<1tft[_Íz/tf뷍t&'WS( , u( $¡( ף( B$$0 , u4u<1tft[_Íz#tf뷍t&'WS4 8 u4 $F¡4 ף4 B00< 8 u4u<1tft[_Íz/tf뷍t&'    R 4   $   R 0    \$\$ t$$"teуt u\$t$f шސ$"$t$$t D$91믐t&D$$D$"돐t&D$1ÐUWVS<\$PD$,T$(CdD$D$,$}D$,\$t$$贂T$(BD$D$D$ D$ D$,$'T$( xЃD$D$,D$$`T$(BT$(1ۋB Ph T$$t&L$$ $D$,1T$(9Z~`L$(ۋQ tB|H9OL$$~$ h | 9(ʄҍt&Hh L$$넍t&<[^_]UWVSÃT$1ҋl$$9ӉL$ ~]t&$$T$؉E*JFdl$DL$$D$,$uD$DD$\$t$ |$D$ $U~L$$T$DD$$L$zt& $L$$9L$$l$D,$LvL$$t$t $ T$,t$ |$$H T$D$L&{6rT$4\[^_]ÍD$D$u`T$,\$t$$ T$ t$t$$\$\$ 4$t$D$ ؋\$&UWVSLD$Zt$ l$4XZXZ X ZXJ1ۉHBD$B4$D$wl$4$苮t#D$<%=@t'l$4$hu݋D$L[^_]ÍD$4$t5D$8T$D$D$$T$3sf$D$蜤T$빍UWVS<D$ED$,T$ D$$u ]t&D$$T$ B:uT$ t$(D$$N|$ D$ t$<$ÉD$,D\$(9D$ t$$";\$(D$$T$  tD$$T$  uދ\$,T$ D$$3x4 KJKJK J KRS\$,D$ l$$GCD$$ C ~U1"D$,T$t$$iT$9t/T$$t$ D$ ~uȍD$,$L<1[^_]fD$,9xuT$ L$T$$U<[^_]$ fUWVS\$0|$4u.)$~D$/<$Su<$_sk $xI<D$~C $TS CD$DD$$!k[^_]VS1ۃt$ tGxAF$4t2F~)0&9^~ F $u1ۃ[^f[^ÍvUWVStT$ tӋt$ 1ۅt$É؋\$Ív' $\$t$t$|$|$ox$t$|$ Ít$\$$|$|$ ,D$D$D$4D$D$0$q,Ðt&UWVS,\$DD$ $艬D$ND  L P T D$D$t&tt80 1ۃ l$ub u;#[toD$߃ \$ƈ` {T 1b É1ۃ-É t߃ ` vD $ D$P D$荤t&D$vT t'D$$跩1D ,[^_]Í&D$v \$Ɔ` t& t t =Lr11D$1CfT$b uCtC#t;u9D$+ tۍvu?ft` .`  9u\"` 1땅t D$D$1\$_t&]b 1É1ۃ-É u .0$t ` 9=T t+T$T$1L$Ɔ` ` T$HD$$` T$T$@f&b f"\ t뀅\$fƆ` .t$Ɔ` w \$u> 4Zb u"Ɔ` .`  "tm\u ufv1 @Jvntt  ]k` t$ ` Ít&'\$\$ t$t$$$Yt\$ t$D$$\$\$t$Ív'D$$ Í'<@ \$,\$@t$0t$Dl$8l$H|$4t t$H\$,D$Dt$0|$4l$8<81D$$ 艧t@D$$ Q$D$$D$蹪T$$襤tD$,$葪t$$It,D$\$,t$0l$8E|$|$4<Ðt&l$Ӑ;D$$/|$.ft$$D$6D$ t&t$l$$D$Wt&T$t$$T$D$&\$t$$׳ ÉD$D$$D$D$ $/ۉt$u\$t$ÍvUWVS,T$@D$.\$Dt$H$;D$@WOx*+D$@D$tt$@4$ۦ$蜪1ɉt$1D$Ӄt$Kf1b É1ۃ- 9D$tsus]t$@ t.t@t$t;D$ uϋT$@$ T$W$Q,[^_]D$뾍t 눍t$@$ t$ 뱋E,1[^_]Ë\$@$ \$딋L$@$ L$ȝv&'@ $$$$$$¨Ë$D$ D$ $t3$G$$$$ļÍ$D$$ 航D$\$D$$$RD$,D$$>! $ 3D$t$ $n   D$\$$l\$$X  $ t$5 $t&l$$D$$$Tv $׳ 5t&t$$D 苛 $肟댍t& $o t$莡 $Q$ uu?&$uߍD$@D$l$$D$l|$pD$0$è v $Ϟt6$趡\$$5 D$螚 $A$ ‹D$,#D$$$D  D$?JY$*\$$ D$ $ D$0D$D$l$D$ D$D$$H,$=  1\$8D$4D$(|$<,D$0 Džu. 9 D$(< tʃ= tq|> DD$4;|$(D$4vD$(+|$(D$D$,|$$r9w-D$4tD$,D$D$ $Jj\$8}O|$0&ɉ~7 u$t&]Dt t =u琀|\t9Hv OD$4\$8|$<$t@ u$D$,$$D$,TD$(9D$0v$l$0)D$D$,l$$V9D$04$D$2D$$$bN\$$$ 赗D$(f4$$D$,!뜍v'D$$D$ D$D$D$ $Ðt&UWVS\$p$te$L1D$L$(|$0$荤D$8@ n$4D$,D$,D$D$D$8$KD$$D$,D$ $xL T1D$4t$LD$D$4$ȚLD$Lt*1b u+vb tutEL 릍<[u|L[t/<$|$ÉD$D$$$]921뼐TM ]D$ \$\$Dt$0D$@f \$,|$4l$8<l$1$ \t Zl$\$$ D$@ D$0 $8D$> $ hD$I $yD$U $#D$b $؋~D$t $ur,$1wc l$1$.c |tXt 1cD$) ,$OtXt 1>D$ $:aD$ $"1D$ $ D$ ,$D$* ,$ڊudPt 1l$H\$DD$@C l$H\$DD$@?,$1}C{l$H\$DD$@?l$$ D$$n l$Ht$0\$D|$4D$@C\$,l$8<Pt 1 D$ 1$l$$;l$1$wLt l$1$_;PXt w$ t&vÍf\t 1ttڃtӡXt DÍv1Ðt&\t Sà t1 C  S S S[Í$$) D$  3$  "$B  $$    D$$P } RvUWVSÃD$u Lt&tD$;$C$uv.H ljuKC$r$t_:tut&D$[^_]Ít&tK$$t= $u$t" t-u붍D$[v$D$Kv$@UWVS1Ƀ 9rtftһu?Vf tct&wQwu>t F9sL uF9r#|t([^_]Í&FfFf< uƒF [n^_]ÍYf'f&ƒ ) $t$|$t(0) tt` ְ8u$t$|$ Ít&ֿK $t$|$( ø볍&'VS=) tBt>=) t7 u v[t4$D$跅u[^Í&1ۃ[^Í4$1|$t>lu!~fu~u4$|$Ðt& 4$|$Ít&'UWVS,D$@D$P D$D$DD$D$$8D$D$.$=D$D$9D$l$|$ )t(t&3|$l$4$ڌu<>t<[uD$$豎|$,$s C fD$X tI_ t,1[^_]Í&D$ \$@D$HD$D$D,[^_]%t&D$\$@D$HD$D$D,[^_]'||$t$t$p1\$lÉl$x$D$TD$XD$\Ctg1D(rD$D1L$HL$T$DD$(@D$,D$4|$L\$P$藃D$($WL$t&\$lt$p|$tl$x|fD$4\$TfL$$D$DCD$4$ċulD$($uDt/t$TMUEut$XL$TT$Xut$\D$\u$8dt&|$1$e ۍt&|$1$ ~뀍t&|$f1$ ~TUWVS|$t$\D$hl$PD$lD$PC D$T4$D$XCD$D$\D$`D$dCD$@ D$DD$HD$L[D$dD$XD$DD$@D$ C,$D$>4$t$6D$X D$h1D$hD$$D$8@D$$4$D$(͊uYCD$D$D$$$0NjD$$$uNxJ4$1pu`,$r6 |[^_]fC$ D$}}|[^_]Ðt&C$ D$X}4$tD$C$ D$3}뇐UWVSӁD$($t$He$1҉L$D$D$(t$D$$莏>D$lD$$@D$\|$T#ƋD$dxD$3D$,D$4tvt$,D$3) T$NT$D$<;Z$L$ L$k+D$ $L$iD$t$$t$3vL$D$$4$L$,h)D$D$t$)l$ $8t$|$v"H uC<$<:tJf댍t&D$3D$,D$4D$$1|$3Z$KfD$sD$$4$D$ny)ЃD$D$ 4$T$8CgD$8D$ $D$t W9:D$ o)D$ vl$kL$D$D$  $7$$3T$D$($D$k7L$D$D$  $O7JfL$D$\$L$$)7D$<$1~T$|$3JZL$D$$t|$4|$4ED$$D$$D$1tD$$t~ tT$JZL$D$,T$L$D$D$($1 $e3 Ĭ[^_]ËFHD$$&D$$mvT$؍L$p D$xgT$|9[|$$:l$tD|$~|$~|$ ~ |$~|$~|$~|$~|$ ~ |$$~$|$(~(|$,|$DWO NvbSwz_t6T$H/ 19GFG F tWV\$0t$4|$8l$<@Ít&G랐t&tҋEGf%ÍCdGyll$hōD$pD$D$pt$`։|$d\$\L$D$ $uD$NjD$p86<- t&t9s)Fl$L$$Et V9r[^_]ÍUWVSÃyT$gD$ D$X9D$  11S 1ۅ~1 ufᐅuDT$1+l$  nR11ۅ~1 uf1뾍t&u4)Ńn [^_]ÍFF [^_]f1΍UWVSLD$4l$dT$ ‹L$8D$< tы $T$Ћ@D$R~:Ot a:LuZ9uD/b tED$u t<$T$ЋhD$D7L$@S D<ʋD|$4D$,D$LT$HK$DD<щD$0C4SC0u99v x 9t=VN(T$8S8D$l$T$<)‹D$<$T$8q D$,9D$4t3VC8T$8T$4N(T$T$,+T$4l$$T$8*;|$0t%C8VN(t$0l$)|$4$|$0D$@{0C4bt&C$T$HDD$0fC T$@DD$,D$4C8,$D$KC0vC8,$D$KD$ W D$D$ $ Lv'u)D$ D$D$$I MEÐt&t#T$ D$M D$$JÍvD$$1IÍt&u$  >t&d 1\$,t$0|$4l$8<Ð    - < l$Dt$0\$@|$4D$H\$,l$8D$C$DŽ$DŽ$DŽ$CD$4$(Z$1C$D$4$K6C$ l$e$} D$Tt&$- $É$׉$t 5  $0 1i8f4  0 G6t2D$$D$\$$#D$4%=9 G6$CeD$)D$F$_!G4D$ + D$ D$D$F-$#$$$$ĬÍvDž p fF.fF-.$E$pE0 <$98t\$$ D$<$G4O|$D$G$$%D$P$DŽ$DŽ$DŽ$CD$\$,$xEG6CtW4D$$$T$$,$\$$ G$ D$'fz4\$Ét$u" @1\$t$Í&$D$X¸uҋFF$t$C1\$Ít&S\$ CB$9G$G4%=T$ D$<$T$ t$D$T$ XGRO$$T$L$/7L$(uT$$4$(t&|$(ֹD$$f9D$B6L$(A6CֹB$ D$C Xt&J0CRNƉJ0C \$\$ t$t$$CHD$CD$@ D$C@u;C5t DD҉֩t\$t$Í&DDC5҉uʼn\$t$ÍVST$ \$$B\tR`D$$T$1u*$$t$$CD$H [^Ð|t$p$\$l$|$tl$x/FD$ Ft C6'CD$Pl$ D$TD$XC T$T$DD$LD$H1D$DD$<@D$ D$,,$CD$,|$PD$<$D$诮1҅D$,T$$),$T$贘D$\D$<$D$Vt C6D$\\$lt$p|$tl$x|ff{4uI$1 ҍT$\T$\$$‹$҉D$\uVT$t&D$$(uNC$C$rD$$ D$t&<$訢×$$ fL$\D$\$$L$ `F$UWVSL$tT$T$lL$P$pD$h~ ME D$Lk D$L1ҹ D$Xe D$d 1E!ЋPe DEL$XT$\L$Xt,$T$Ћ@D$dD$,!$+F t&$d$D$pI1$d$(a$d$$h$D$`~UD$df$h|$L$LB4\$ L$D$% D$$$ڟD$lt4$ $t$$D$EuL$` T$dI $ D$LD$lmEhc$$dD$pD$D$`T$$$h$T$TT$L$$D$d$$ $dU$dr8~  DŽ$4$1r$ D$h|$h1󫍄$L$P$E $%$E|$/$tL$hT$TD$pB$ 1$DŽ$ED$H$Eh$4E$E $tFD$$D$T$LtBD$LD$ $FD$LD$ D$ $$ExD$H$Ɖ$Exn8F@Et $ F&t$`t$8$ \$dt$<$E|t&D$D$+ $Yt&D$LD$ $蜍|D$LD$ D$$)$QD$$$s$y$DŽ$ [$\$$$@ $$@$$@$$$P$ D$(  3{&F4fW4f1fG$oL$LT$Ht$\$l$D$(D$|ċ$($)D$pD$4@$pDŽ$ DŽ$DŽ$EP$E%$CD$81dv@6t$0uv1$$9$ T$@ȃt$8p$;-CWCCP҉T$@% L$0L$0A6q$pBvL$0fy4fx4 L$0D$ $DŽ$LDŽ$H$蕰$Lp$+$HDt&%=@+vD$ $p :$p7C$pDžv1ۉt&G|`9CQC4F tщPƃ|$0v L$011틴$(1L$8 v u-l$8t&;D$0 J uZRt֋\$0$pL$0D$t t,$T$Ћ$ @D$t$p$p@lrpD$PPED$PD$P2D|$PD$PD$`T$d D$X D$\~*D$P^;\$PD$XT$\} t$Xl$\$pe P e D؉$e DE…ɉ\$x$$ 1D$hD$lD$8D$<G4VNFT$@VL$DNT$HL$L<$É9\$F  D$CD@09|7A$D$$ $_$$ t&$ʍ&fx4D$$MCDŽ$HH$$$LST$0RT$@D$8$D$ ED$D$$ $L$8$ $pD$$ m&o0l$0Ճ t'<$D$ҋT$@$mG4Cfkdټ$l$$$ۄ$5p  f$٬$\$٬$C D$ D$D$ $5C T$($T$( SÃD$t $~<[Ít&'D$D$D$D$ &\$ÍBt$|$׉$"8ƍ@|$\$$D>\$t$|$Ít&UW1VSt=y1t2A t&8pt$9։NΉ98u1[^_]f[^_]ÍT$$D$  T$L$ $T$c $É$։$$D$ T$D$$ D^tJ@*t\@%=$$$$ĜÍ&t$\$$ D<xPD$ D$\$$$1uT$0t@t Epfǡ$D׍D$9|$v D,t$\$T$ED$T$hD5D<$1bĜ[^_]Ð$1 Ĝ[^_]Ð$땉$<${ S(D$0\$4D$D$ 8D$D$D$ $Ex([É\$$ |UWVSCtD$$艝t [^ÍvC$D$[^Ðt$$fWVSt$ 4$蒘tY¸:uVD$/4$͝1t>4$)WÍ8D$/$褝t$Ut݉$ٖ1[^_ÍUWVS,l$@EEEE E\$Dt0T$D fu+D$DT$DUEu ,1[^_]Í@$U҉T$D$E~H1t&T$D<;<$CCƒ ШCtM ;t$uD$T$D$ `D$ $T$,1[^_]ËT$DEUM&S\$ C$葕C[ÐUWVS x,p8~19uo&9tc9uX(44$ۉ\$~.h4;Ut]|$]1|$ f݃;St>9u|$PyuO8 &@< [^_]Ðt&|$U$fSP<<@, [^_]fPDf9})D$  D$D$ $QÍ&St@>u T$ $脒[Ítԃ[ VS1ۃ@@@u#u[tFt[^Ív t$Ƌ\$X$tFPt؋t$\$ ÍS\$t$ sv,\$f;8 t$ ։|$$ωl$(rsD$$GCS PSSD8 f9s$4 44$t$$D$L\$t$ |$$l$(,Í4 ,,$Ȗl$$D$Kd UWVSӃ,H(1G|D$$>FCS PSSDN(9}wV49uع|1FTT$~D$$ECS9l$ PSSDϋN(9|t&F >F,[^_] D$4 D$f8 ÍVSt$ $H;á4 8 sCCCCCC C(C,C0fCDC$$ØC4C$$貘C8C$$衘C;D |$ Zt$~09}At$x49t$u|$w@> D$x09|t$\$,D$(O,|$$1T$ |$1T$39l$ ~ ftV8/PN09}YF@ 9;D$$u;l$t9tT$_V8nN09|F M^0FCS PSSDF,9| F 1<[^_]D$D$X $&CF w~F(9FFFF1맋VFbT9‰T$RF(1D$11j~~u 9~ |D$D$$"=CS PSSD;~(OV49D$v|؃땋F(11D$9t~Xt&|+T$T$D$$]D$$;CSoPSSDT$FT$NDf1D$|$f-V889؋|$.V8D$D$vD$n,D$8~-N81;9Au&;x9uD$ D$D$ $5 諏&|$ Et$y9~t&9D$$D$L$ x0\-5L$ ~u 9~ |D$D$\ؽT$T$Qع|~D$&T$D$.~,D$(~"V81;*Bu;vƒ;ht.9uD$ D$D$ $5 OvtՃع\D$$U9CSD$ PSSDF9D$@D$T$ TT$ $D$蠉$l$$D$&>F ڋL$s~+FFFF ډFV19T$VVFVyD$$o8CS PSSD8N8|P9FFF19lߍt&|D$  FD$ $D$@FD$lFFF<1[^_]ù\SMV0~2^<1 x9tFFFf9uӋFFFHN0F@D$$D$ 1D$  D$0D$ $l ыD$  D$/D$ $( 譋D$  D$D$ $@ 艋D$$D$ ,D$ D$D$ $ PD$ D$D$ $ ,D$ D$D$ $ D$ D$D$ $ D$ D$D$ $ D$  D$D$ $P 蜊D$  D$1D$ $L xt&S\$$tzTg t3\g Xg {tC$D$Tg Tg [ÐD$$Tg D5 Tg uYt&غTg Tg [D$ D$D$ $ ʉD$@WVS |$0D$D$D$Ct$D$tgD$D$uut$<$D$ák D$ D$D$D$$覂uk $ D$D$uD$4$14D$uHt&4$85 [^_ÐS(D$0D$D$D$Ct=\$\$$k D$D$ D$D$D$$$4([Ív'S(D$0D$D$D$CtCx\$tB\$$k D$D$ D$D$D$$腁$Y4([Ít&&VS$\$0D$D$D$CKt$1D$D$Ctrk $ D$艀t$$k D$D$ D$D$D$$ȀT$uD$4$l2D$u胊&4$p3$[^Ðt&$1[^Ð&UWVS,l$@T$DT$T$BurZD$&D$ $tbxk D$$D$ )؉D$tc~u븉,$묍t&T$D$Z| wzk T$D$ BBD$$)؉D$utP\$tP,$k D$@ D$D,[^_]~k D$ BD$D$B$<,[^_]ák $ D$~l$@,[^_]<\$,Ét$0։l$8͉|$4@<tIPT$T$<$T$ut<$蠀|9r܋T$@B3t&x)Չ|$ @l$$D$PtċT$@)B1\$,t$0|$4l$8<Ðt&{Ӎt&'UWVS˃LD$,@ T$4|$dt$4D$<t$`8\xL$,A4Ŵ T$4Ű t$$D$gt$4؍P9sx>ЍP9rD$<vD$,T$,@<T$8D$+D$+JD$,ى<$^D$,@<D$+)9ЉT$$W9T$$t-Lb ɉL$01ɀ|_1 l$0u19T$$t&,1b 1ɀ<_ 9tT9!Bb <_ u6t&9Bb <_ u9sVL$hD$+؋l$8)GD$h|$ D$D$t$,$dv1L$u$L$T$\$$t$(,f4$T$L$xt$$D$L$T$$L$T$$D$D$E \$$t$(,Ð$\$Ét$w$5Kt $D$ɹ DD$ҋ\$t$Ã,T$Ptu"t$T$,Í&D$D$ $,Ív\$Le$<1$Ps$T$XD$C4$D$yu7$<e3$L$P$T$X\ËCCtw$<D$D$ D$D$,${T$$D$ m)l$,9t$(D$0D$ D$$&{ wVT$0D$DL$(D$$T$61҅t(D$Dx L$Hxxljf T$$u9D$ t&ljͺ͐t&9M|$|$LD$9 D$ D$D$ <$-n!%tDQDD$ )$D$ D$ >,$[rT$ ¬$D$ D$ LD$4BD$44oot&'UWVS,\$@T$9vN{9s{{ u&{ t9ul$DD$D;vu9r,[^_]ÍvD$DD$=D$D$$,[^_]ÉfUWVSD$0$e$1D$0T$PL$T;D$0t"'D$0`#D$0ǀ@d /L$T|$ $'kD$X1DlrD$0t&pPuXHuT$0$ BL D$X D$0D$DHhuCP@u<D$Dt.h D$Dtt&p iuD$Dtl$TD$8D$<D$HD$@v\$DL$@tL$0D$@;D$8D$0#T=T$,)T$4S$ $L$,t%$x$x9O>C<uD$4$DŽ$D$T$ $CD$l$$pz$ fD$0`#L$T|$ $i1uqD$XD$HD$@$1uGL$0iHu uD$؉|$,$aV;|$8rt$4|$Ll$\ ǀ`#T$8L$T,$T$T$PD$DT$Pc1\D$0T$,L$T$T$T$PaT$P$pLP @L$lT$ $D$cD$0T$lT$PZXTT$P$$hT$0¬$T$PD$0lD$0:^L$HD$ D$ D$L$D$ $cڋ !%tDJDD$0)ډT$$\$$D$ D$ T$P$ hT$0¬$T$PD$0D$0D$ D$ $$e\$t$t$ |$|$(D$@$UmxÉ<$g|$C! CC CD$$CF ^ t$\$Ít&'S\$ D$@$lT$$PT$(PT$,PT$0PT$4P SC[Í&'S(\$4$fT$@\$T$T$[uًl$D$$A_|$ËD$$]C ?T CT &D$ u!D$t}D$$\Ct& t8  D$t8D$$`\C l$fD$tD$$<\Cl$D\$,D$@ t$0|$4l$8 \$ItR$D$$P\$$> HD$P@T$U',$ $0e$1$$$(Sx$umt${ D$|$4$ S !%tDJD)Dt$<$]PuC 1҉Ћ$e3u$ $$$(,M&8L$$1҅‰D$D$ T$$Ðt&D$l ÍSl \$ tGSx$u#l D$C $OuC 1҃[Ðt&\$ [kt&'S\$ { tCx$SC $]C [Ð<$L$\$,Ét$0։|$4l$8AOō@ $Rl$t$Ǎ@$\KL$_|$$g L$}\$,t$0l$8|$4<Í&UWVSD$4t$0l$<$utND$[ 4$uVtB}t<ىt&[tى<t1[^_]Í&4$h븍t&D$f f4$\tD$s f4$DvD$} f4$(ZD$ 4$=vVSÃt3vt$$D$f $D$ P[uЃ[^Ív'\$\$$t$t$ D$H |$|$($MtD$ $Mu1t}g D$t$<$c1\$t$|$ÐD$ $MtD$ $kMtD$ $RMu낍vt$ \$t$|$ر& u2D$  D$$PvD$ D$$P2Í&'UW VSt$0D$\$4x%$$yŸg EF?t#StT$D$ $MNF?u [^_]Ð\$$g ø uQڍvCD$D$ $Nk <$D$Ok ,$D$O D$D$ $Mk  yKt g T$$kO{ek D$D$$ D$ I;vk D$0)D$4[^_]Hv\t$Pt$h\$L\$l|$T|$`l$Xl$d4$JSl$T$D$D$ $>D$T$)1j?D  rD$ D$ \$D$ <$Sh;kst@9vfCk(4$&Jt$$D$2\$Lt$P|$Tl$X\ÍD$$묍t&D$9 $D$ D$&D$O $X ^Nv'UWVS\l$t\$pE{t$S$KXƃCT D$8v f9sL$ L$8T$L$C|D$ D$ @D$D$D$@$ uDD$8 t$D$T $EKD$Cht&D$D$ $KD$vClt HC\$D$Dt$DD$HD$LC D|$D$$D$ @ D$D$@ D$x D$ D$D$$ CKdS`CTt$ ɹET$D$,$   D‹T$LD$ T$$T$C\D$@ D$H D$ D$D$D$$ Bǃ 4$pD$xL$8D$|8\[^_]D$8 QC|F8=D$D$ D$ D$D$$ zBD$8 DL$4D$ $D$:IL$4~`Cl1l$<߉ˋ t&Gl  OT$ D$D$ $H9uƉl$Wt'|$,$D$/ $D$8Gt$$xD$x%$}D$ $D$Fk {LD$$ *BD$8t.1CBtSDT$1҃{L$‰T$ʹ{LpF,eD$PxCp$"MD$PCDT$`D$LD$@D$lD$HT$t$D$XD$@D$ CL$eSp҉T$,qT$,$CT$h\$1t$$Dt/$Cu#k $ D$?D$k D$$?|[^_]Ðt&HH<-\$4D$`$D$D$dT$h PT$dT$hDT$`$D$D$ D$8T$,D$D$`$T$T$`$D$HD$dT$h PT$dT$hD|$d|$D$: $CD$|$dv k $T$>SAD$PD$D$lD$ D$DD$t$$&F$k |$D$D$ D$h$>f$ >&D$芼dt&F$VcB&CBD$Ht&D$4\$<4T$0T$d9T$0< t1111ɉ\$4v1<@;T$0< tvt<@1<:ÉEō\$<&룍t&t$$D@ &t$$,@1\$4`+ \$\$ t$|$`4$D*Cu.CPtC@tQ4$h\$t$|$Ít&ǃ4$h1t$\$|$É$ tC@ t{LttWt34$T$Ћk D$T$ PT$@$6<$;T$@9 b u 9v b uN9v)^b u &9vb ut$19FӉP}AxEƒ,[^_]f9l1t&돍t&S\$ $B7CD$ [27&'S\$ $7C$7K\$ D$$c[&UWVS\D$e$L1҉L$(D$ $v8D$\$LfD$D$$D$6|$L#D$<D$@D$DD$Hڋ !%tDJDD$()څw҉t |K  RT$($5,$l=T$(KT$Zb tt& b uT$$7L$@؍T$<$*D$DtL$HT$D$t$@T$D|$HT$ T$e$,1T$$\4$T$5J)Gl$,=1~!t&b t߃ 9uT$\$$t@P 9t$11ۅtI$XuY$`t!t$`D$T$T$$\$,e3<[^_]Í&Gt$XD$4$T$\$`t뇉$8T$$T$E v$X1D$4$T$5N$XGt]1+1UWVS,B(B@ B(%=uC$-4WD#ƉЉT$fkeʃ@!9u(l$l$|$$蜧tW@8Cu,[^_]Ë\$tZ9}=3L$ ‹l$RL$H|$3|$$1 t;L$~9|$d 1<[^_]fjrT$Dm$'L$y$D$ C~dt$NItT$ 1|$, \$(vBB 9˅y݋qΉZ2Ӆ~'T$ 1BB 9uߋT$ Dmt$ FV AD$ QD$ zD$ l$$%[\$ s\$(|$,$@ ~&'WVS5 t4= ~fD$59u<$) [^_ÐUWVSӃ<5k D$(D$TD5k D$(… ˆT$/,D$ D$ t&8DD$ D$ D$4$$CuыEtt$$ D$E5U$T$$&S5ɺ  DхX DD$ T$D$4$x$ǃI)CD$ T$ D$ D$D$4$8$T$$$)D܅D|$PuCuD$H D$4$#NjCt5S€u- D$ D$) D$4$#ǍSt>KC | T$DD$ D$ D$4$q#ǃ;"SЃB@Cu1Ʌɺf  Dt$$ "D$ D$4$"SDž=kt$$ 4"C8D$ D$ D$4$"_vt$$ !|$/t*D$(@t t$ D$D$$ <[^_]fD$ D$4$,"D$ D$4$ "QD$(@t$ D$ D$$ ft& H t& 8E׉D$T$ D$ D$4$!CuˋEfɺ  DS\$ L$u7D$u$ [Ív$ [Í&D$$ [Ív$Xt$t$ t@1$t$Ðt&Xt(~,X$JB1t$Í&Bu"BZL$ ڋt$$^ fB 돐,|$(ljȃ\$ Ӊt$$t2Ot%CS  4$\$ t$$|$(,fBu:u WtCu v$ &$4 CR 4$u뙍v1҅K uS 1\$ t$$|$(,ÅC [ 1U3=5/7-'<$t$<$D$3$(1&Ct GC ډ$D$\$<$St&1ɅS u  1XCet GVD$ډ$¸[D$D$D$$S9vtC S 1#t&tC S !1 vCt GD$ډ$¸D${ D$D$D$ ${T$1:CS( 4$cCt GC ډ$TC 1>D$D$vD$D$v1~fC S 1C S uC S 1t&UWVS,D$L$IL$9j\$1ۍr$f$< 9l> DڋuD$b tyT$Bb t&2b uL$t$ $8NjD$p>DD$pD$|$$S<$,[^_]f\$1L${EL$AD$,[^_]`뽉'҉L$tT$$B 5ÐD$$V  ÍUWVST$0l$@|$D!19rtftD$4zBD$8D$8BD$$\$@t$D|$HL$t&D$$ =뱍t&'D$ D$ D$D$ k $lD$(D$D$$$t&SD$$\$ tHT$$T$D$ $T$$:uGuS 1[Í&c 9}fL$(Dc ΐ)(MvCS( $q[ÍSD$ X D$$D$$聱1[Ð&SD$$\$ T$(t,D$D$$#x S 1[Ít&ҸZ uˋC fCS  D$ [t&L$ D$ɋP uxvt!~-1Ít&1Í&x1Ít&Ґɐ&<\$0\$DeD$,1|$8|$@t$4t{t$t$$u=4$1tIW $T$71T$,e3uD\$0t$4|$8<Ív\$$ ΍\$$ 붸 fD$|$ P 1Ív'WVS\$t$t#t!1 $8t9ىu[^_11ɐD$f$9ˉvދ8ҍ:xzxzx z xzxzxzxzx z 8u[1^_ÐUWVS|$<;>tk9une$Le3J\[^_]Ít&9txb u,1|9wt&\$<\$t&)ȃD$D$LL$T$(L$$$$\$<|$)C$LD$$o$ T$(L$$X|$L!Á　tÀD؍GEۃ$L\$0D$<!ǁ瀀t\$0D$<ǀD\$0[\$<\$0D\$<\$<ۍ\$L\$<$L\$0D$HT$(L$$D$ D$$T$(L$$NjD$H9-t)˃9~*@b u&b t9uk19 d<Dt&D$D$<$&$PD$D$,\$$X9|$<)͍\$L\$ $LT$(L$$D$D$\$$L$$T$(*ir!D$WD$$eD$ $ L$$T$(͈T$(L$$D$ D$,$/L$$T$(ހ<-D$tT$D$UWVS$$T$D$`Bt:uD$@Lļ[^_]Ðt&T$D$ $t@T$D$ $̨t(T$D$%$xtFT$(t&T$D$:$PT$1ɀ:tPD$ļ[^_] - = |$D$f11D$1f |$4$u 5 $;D$ruD$ 9ru t'D$9T$}rT$$t T$t&EL$UALAB ЈAB}zMU t$$#1D$$ D$8 D$<D$L6 D$PD$` D$dD$t D$xDŽ$ DŽ$DŽ$ DŽ$DŽ$  w&DR0 D$$ ǸuUu<1t ftD$$OfD$$t$%떋T$$ T$7&T$1u2t&1ɩ uuÐt&fÍ&'UWVS\\$tl$pt$x|$|D$><$T)T$,T$LT$D$LD$ $D$ D$D$0D$L$UD$4t`T$,1|$T$D$H D$ l$D$ 4$衮V\[^_]ÍD$<<$t9rt&9vCb u)D$(D$D$ 4$}D$(1L$( 9m";wҀ t݋D$(T$@1$D$@D$DD$D$HCԤD$@$D$T$DD$Ht$9D$4D$0D$8T$(D$ D$K $T$GTCq$GP1l$,L$$GD$$r$l$$D$ vT$$9r$tD$$輚CS PSSD뒉L$$2Ɖ4$t$$D$踟D$$GLHCGHGD$A($r$Xt$$D$dC+GHD$$GLGDCG@G $D$q$t$$D$ C+G@D$$GD_q$D$$Gl$$͐$s/$|$$D$詞v9u$tD$$ICS PSSD량L$ $蟜L$ $g L$[Ƹ t:~D$D$$)<$|$$D$6 uƀ8,D$$`T$D$$蜘CK)HKKDT$+ $`.G1D$$@L$ )L$ D$ \$ $D$虄D$$FD$$yCS PSSDF>.u<.uF<.t1뗋C19D$$s=K|1L$,-|$,vLp-w ;D$$uT$D$$D$$O G4L$,+T$,W8D$D$$+D$,OG<D$$tCS-PSSD[D$$1Pt&S(D$0D$D$D$Ct4T$4\$D$0D$$T$ $([Í& u鍶'$$\$$$߉$$P1$$ҋ$l$$D$(FD$|E,D$0t+T$T$ T$D$T$us$\$ D$Ю4$D$,1ɉD$$D$0;E,t$E$$$$ĜÍT$,$LD$0xvUWVS,t$\$Hl$L|$PD$P4$9T$DD$K 4$D$T$DD$$D$T,$hl$$D$tD$TL$T$$D$$CS PSSDD$X~T$TD$ $T$趘t<$|$$D$|$@t4$ː,[^_]Ív$D$萏CS PSSD4$萐,[^_]ËD$$D$XD$$D$D$D$耔t&'UWVS,l$D|$Ht&u1ۍv< uE&Db tuu|$@T$L<$DD$躎D$Lt=T$LD$ T$GG$D$LGtm9WG\$t$<$襓D$<$UGW PWWD1ۉE2,[^_]ÉD$D$<$D$tA \$\$t$t$xtt$\$D$t$ Jv'UWVSl$$B,$D$XRT$@$D$\D$$xl$XD$,t D$,D$Xŋ$ET$0҃$T$(D$OuuT$@umȅD$@t^111t& Lօt3t1à LօuD$@T$\D$$T$8$R T$<$T$D$T$4t&1 t&D< uDD$X$\t u0E룍vt$$$B$t0ҍ&@uk2T$$$ŋ$r$|$0ND$$$D$D$\ $趐|$Dl$H$\$$($H!vD$D$f ,$!XtЉ|$$cu뾍D$$ <  u |$4l$X$l$\$$l$X\$t$RD$X|$0D$Xr$\$XrT$(\$T$ $T$$$$$i$D$$"$|$OBыR PQQDt$9rf$B!D$,$l[^_]f$CPD$$誉T$8ED$ $c T$T$D$$KSL$(L$D$(0 KKDtD$t$0$t;D$$輁KSL$(L$D$(0 KKDtT$t$0$L$$L$$g&D$ 8D$(ptD$ |$$D$utD$ t$ D$<$D$Y19|$,tS|$Tl$ l$$uCt(D$$CS"PSSDtt$$"<[^_]UWVS,\$@t$DD$9sED$$耀CS'PSSDt^1<'t)"o1ɉt(<"t$<\t Ff"t\t ÄuL$t$<$}S<"tM<\t)t[97Go(,[^_]Ít&CsPȀTw$ t&L$H1tʋL$H,[^_]D$<$w둍t&D$ t&D$<$w_WD$CGGDD$C/37*S/70ŀ B sL$D$vD$lD$ bD$ XD$ ND$ DY&WVS|$ t$$$'|$tC$'tۉ$|$t\u݉|$$\Ѝv|$$D$ '[^_WVS|$ t$$$'|$ft( tS\t6't1ۉ$|$>u؉|$$D$ '[^_|$$\ 뽍|$$\|$$nyt&'WVS|$ t$$$"|$ftG"tiW   t|t&ۉ$|$mu|$$D$ "[^_L]#[}$u|$$\,뮍{t}u|$$\ 댍t&|$ D$D$$ +v|$ D$D$$ v|$ D$D$$ v t3 |$ D$D$$ ~t&|$ D$D$$ T{WV4eD$,1t$GDt$D$ $B1҅x,(҉ЋT$,e3u4^_!'||$teD$\1B\$lt$pl$x%==t]=@@t)T$\e3\$lt$p|$tl$x|fG@%=uÉՃ 밐z0B,|~ $è AD$\$4 GDD$4D$8D$ TuD$%=@/DȄu6D$(%=@t!18$t$|$l$ Í&/8Ѹrϐ&$\$l$ l$$t$t$|$|$ 9NՉ9(uB9t>\$ u\$@/Dˋ\$ t&/tF)А$t$|$l$ Ðt&\$(@t/tƍ&/u뽍'l$ l$$\$ t$t$|$|$9ӉN9(u/9ڸ|&T$ 01ɸ09M$t$|$l$ Ít&UWV1SD$$x s9~ID$$(>DP(DD$D$,T$ D$D$($ t}9~ ߍvÍӃ[^_]Ív',\$\$0t$ t$4|$$l$(,<$|$}hS1O( C 9։Ss")T$ōTT$,$׳\$t$ |$$l$(,Ív'UWVSl$1ۋ}ut/1 9J(tJ(u9uE ][^_]Í&'UWVS|$4\$0<$|$$D$i|$1ƋC$3;ss7,t&t$$9sv(|$D$Ot׃1[^_]Í't$t$ \$|$|$$^(uC$nW(uC$I19t\$t$|$ÐDD9ۋ\$t$|$ÍS(\$0C(%=uC$ߵD$D$4D\$D$D$ $([Ív'L$A.t/tu*1Ðt&Q/t~-guyit>ft/u빐t&ft.u։Q/tu1Àytuv⍴&'@tQ>f' ‰V(Q@%=u$T$$֝T$$NDT$ $D$T$04t$$jV(@uC$T$$yT$$Fl$($T$Jl$,*ˉ$ J J =CUERul$,\$,$NT$(B;T$0v\$(l$;Gw9T$$D$$T$莝o(xg&@uC$Hl$$茞ËȉGȉCGȉCG ȉC GȉCGȉCGȉCGȉCG ȉC G$ȉC$O,K(O0K,O4K0O8K4Wt`ffS>S@%=uC<$T$T$D$D$$D$<$ٍ$,$0$ 9t$1$B$TD$DŽ$TDŽ$XDŽ$\C$ $XEERT$$$A$X$\$$$}$H$B$TD$DŽ$TDŽ$XDŽ$\C$7H$XCUER$$$$X$\$$$q$yG5  $D$,$I$|$D$ $辝90l[^_]ÐuC$FDŽ$HDIRC1l[^_]Í$Bu$tG$o(mt&$~ t$l$$脻 $t$D$ $踜9$Fl[^_]ÍD$,D$$$D$ D$t1ۋ$BD$xBl[^_]Ct&UWVSt$0\$4~ u0n~<>1ҍ& A%=t6Ft/;Aw*C4$D$t/\$0[^_]D&9u\$0[^_]yD\$0[^_]C&UW1VS,\$@$kk11f;C 4F(0tND $L$豓$Ǎ@LD$UL$|$L$PDʼn$T$輏 GE(FED$l$$T$u.|$T$$;CQ,[^_]ÐL$$ L$,,[^lj_]Ã\$\$(t$t$ |$|$$t 1|/)É\$|$4$1҅xЋ\$t$|$Ðt&в;Fs4F(%=uC$q9úuD9럐L\$@t$DƉ|$HeD$<1D$$ϗ4$腕\$D$ 4$EK t(T$t$D$ ֦ D$D$lj$,\$D$ <$4EC t <$Y8t$D$  D$D$<$\$D$ <$DE,t$ t$H|$$|$4l$(l$0\$V ;VFk8ËEECECE C ECSWSWSW S WS$D$8$C(D$#$ht$$D$t@D$$$;CS}PSSD\$t$ |$$l$(,ËnEUD$E$g@EF@4F@ +FD$9 $D$CovSD$$@t4P@k8BX4$蛊\$D$D$ $?[Ð&VS4D$@Pr\$$JT$HD$$k8qD$(T$D$D$,CD$ $T$DF4u:D$F(D$T $D$ D$,D$?$:4[^Ðt&D$ D$,D$= $D$ ː\$1ۅt$Ɖ|$ta@@$肉xA<$C|$t$É$襅V,1t$ʌV8C,1t$趌C8F&LD$P\$D$tD‰)( ޹u?D$Tt$T4$藁;-( ED$\$oD$$D$(D$,Cl$$ D$L$)E‰D$8D$ $ mT$T$D$$` fkT$$hku vEb uC,$nTBb tt&Bb uD$)D$T$$[nT$D$rl$D$$lD$D$D$$wlD$D$#$mD$3l$$D$D$D$ ,$&D$cD$$D$,D$(D$D$# ,$"T$D$,$G‰ND$,$D$D$ ,$v"D$D$D$ ,$D$%D$,$‰yCDfSC tNt6C4D$C<$S$1ɉC8C,$C(<[^_]ÅuƉ?SC uu1Ft<.~f{v5 =$ $< D$D$ $YjD$CfD$D$$` D$hD$ d $` #1҅tnvEb ut,$T$kT$Hb tfHb u,$t}tdo‰MD$ e $` rD$ e $` nLn‰n‰zD$,$D$$0D$  D$&D$O $X ot&l$$D$D$* ,$$tnl$D$$ilD$D$) ,$@D$ ,$D$#&UWVS|$05H 1~.-D 1 f9t)D<$D$eu[^_]Í1[^_]Í&'UWVSl$0|$4 H 1~F1 t&95H ~6D 1tS8tFC(t|$$Յƒuƒ[^_]fS$1ɋC,$\C(ȍ&C4D$C<$C8룉'UWVS<\$Pd$,D$ D$$D$(T$ D$T$WT$@D$$*tixk@l$@<$PduyT$C<$d$dtC<3u\$uT$D$$*<[^_]fC$` {@@@ @$@(D$\t$D$4,T$(L$`D$t$ D$hD$D$\D$LD$PD$TC@D$ D$$D$ $ t$LD$ D$ 4$L$ $tb4$D$D$D$|D$4$ 'T$X[ƉD$`tC$ D$HZCvt$D$4D$dD$ D$hD$D$\D$@$D$t#D$dD$ $D$\$ @D$Xvt$`t L$D$`$ L$Yt$`iNtkD$ 4$ D$ 4$ t.D$ 4$n tD$ 4$Z _f ?CD$,$0|$Ɖ$"9u֋D$D$;11獶UWVS,\$@u2t&ST$ֹC4S<BRkSPUPUP U @EC0C ȨC0D${T$ ЈC0T$Hu<wC4p,[^_]Í&t$CtL$ $u&D$C0됍vL$DkLt&D$,$D$uD$C0SUWVS$e$1$$D$C@$D$ D$l$$o,$?{D$[D$ D$l$C$4,${"9D$$T@l$0D$(D$, D$4K D$8$j,$l$PD$TD$WD$DŽ$|...$8D$)D$$$WD$,$}2D$(D$ l$D$$]7,$D,$Tt t],$TuD$$FD$D$$2D$f$e3D$u[^_]ÐQ&'VS4\$@D$,D$D$(t$DD$$1҅u 4[^Ðt&C@D$$ T$,L$(tD|  EˉT$ D$4$L$D$  4[^Ív  EӉT$D$4$L$ D$P t 4[^Í&T$L$ D$D$ 4$D %v',D$D$D$D$D$$- ID$,ÐUWVSG)ڍDT$t$$L>"t&D@0lD$h$RUdh떐t&c |$|$ \$t$te`trhdD$ 0M T$4$D$x,h4uΉ<$蓕$ D$Fv\$t$|$Ít&D$$@M `k,t$ t$4\$|$$|$0l$(^(0 tOGt^VDT$$Nj@tfn,_ t.}aD}l:}l0}&t$$D$\$4$D$,$D$@$64$,$C=C1\$ D$Z t$x<$\$lҺ D‰D$D$dT$D$D$D$hT$ $1t$t$0D$lD$pD$tCT$$i31D@ r$D$LD$lD$tD$pE  D$(t T$($3T$($T$D$#D$@D$ \$D$R ,$Pt4$2t$$D$D$$D$pT$t PT$pT$tDT$D$tT$$6D$<$PD$dT$h.PT$dT$hD&D$$D$l:&D$,T$,$ 2T$,$T$D$&$D$wGd$ D$l %  L$KD$t&,$ l$T$$T$ $0%  S(t5D$D$D$D$0D$$?!c u D$=) t"=) tkt $ƒ([Í?% 1 @ % uu  u뿍t&$x$ t5[f?랍vVS$\$0D$D$D$C%@=@E@t$t$D$OD$D$$ 4$Àt$D$D$D$$ 4$^t$D$D$D$$ 4$5t \$uPD$ D$$ 4$4$D$$[^fD$D$o$ 4$+vD$D$ 4$떍D$D$ 4$%vD$D$ 4$.vt$D$D$o$ 4$\&D$D$ 4$8vt$t$$$\$L$D$ t$t$ T$\$ $t$t$t$t${t&'L$(T$$D$ D$ D$D$$=É'SL$ T$~.0b ut&b t9u[Í1[Ít&UWVSLD$l@\$`t$d|$hzD>D$0< D$4b D$<T$l1\$81D$ T$$T$l\$$?T$(T$lT$,'v uSۉt+T$ 9T$(F9t4 uӅT$,D$ 9uӍ&\$8D$ D$lD$(t ;L$ L$(D$l11|$$|$(?D$ 9D$D$$SD$KBCCD1҃9tG.< u;T$ uD$$kCS PSSD19ut&ҋ|$$t8jt&D$$%CS PSSDu+|$(t$(|$t$$+D$4D$0KtD$ptT$pL[^_]ÍD>b uD$<1l$<덉D$ ,&D$<D$4D$0ǍT$ D$lxtD$ 1St$$|$(D$ D$l׃?At&D$D$$SD$KBCCD9l$ T$$*< u&D$$谿CS PSSDC1)u멐D$$xCS PSSDvD$$HCS PSSDLvt$$|$(+|$ t$ D$0D$<l$D$0< 1D$lD$4t!D>D$<D$0D$<1UWVSLT$d|$p҉~L$`| L$`D$ $҉D$,11$97oD$0D$ D$,D$D$݉D$,$uE ur97~nD$8T$`L0\4)9\$lN\$lۉ~(Db uDb tu1ɋD$hL$T$$ vD$,$ L[^_]Ðt&t| tBt&UWVSÃu"Ht&)hCt$l$$)t(|$D$ 4$mu͋C|$t$$[^_]Í'UWVS,D$H\$D|$Lۋ@T$D$tU1$|$KŋUUT$ UU T$)H)ыSH)HыT$L$$T$]u,1[^_]Ít&'UWVSD$8t$0~O\$41nfL$T$,$@;|$8t&K| u؋F u);|$8uڋN ug1[^_]Ðt&L$T$,$N VkFtFF 념t&D$,$pFu$t&V&^tFF 1[^_]ÍFD$$%Nu볍UWVSD$,tlD$ % [^_]ÍvPJЀ gp1ɉ҃ LJZЀ v9?T$ /VB< %^1ލ&҃DBJЀ v9T$ Vt&UWVSLT$`L$dZD$0‹I\$4\$(ʼnD$8D$lL$|$u7D$C\$,t$0|$4l$8<Ðt&$ < CЉ,$yK$& D$'@T$$D$@F‰D$D$ $Í&UWVS,t$@\$DF ` $$FD$t0ڹt$ t< uu$ŋD$hD$1 h^D$ $T$T$l$1;!E t9tz1;!1Åt)؉$D$ ‰ËD$HT$\$,$D$fT$u&$cD$D$$9d,[^_]É\$$& D\$$d& 4t&UWVSl$0U tF}~11ېG$$!9G$<$E E[^_]Ã,T$0\$D$4t$ |$$4& l$(֋l$88uUtu^& t1d uedk 1\$t$ |$$l$(,Ðdk ݍt&l$8\$D$4t$ T$0|$$l$(,hT$$H&  T$D$$& WV S\$ C18D1`( <$D$tu1[^_ÍD$$4d( $D$qS1[^_Ípk D$ ҉D$t $H' O$( CS8-t9&9t4QӀv_tQЀ vQvكAvѸ[f1[Ít&UWVS@$UtW11U4Ft31ېT) tt) t) t$;^rЃ4$y;}r,$j[^_]Í&'U1WVS,҉D$T$D$t<Ӎ& 19uЉ)‰T$T$5t@D$ft29ku|$s 98uڀ| uӃ,[^_]ÐT$1ۋD$iuD$ $&L$T$L$T$Í@ $}T$L$k5D 59C9D$9$S9Љ@) ,[^_]Í&UWVSӃlD$) $D$cD$(|$<D$1$ŋD$(„tNftd u [vt  uD$$L$ <$D$1Ҁ uD$($L[^_]Í볋UӍ<l$,T$(Jt&T$, T$ ,9T$L$ED$L$u$E(%0= D9\$(wL1[^_]ËD$(1$L[^_]Ð&UWVS<D$e$,1D$D$ $D$t`D$1$t$,5D$ &L$D$l$$|$D$4$uω<$$,e3D$u <[^_]ot&'UWVSpT$l$9T$~7x3\ vx&T$HʋSx) t|$֋D$[^_]fl$) Puԡ9tˉt$ ŐU1x u t&x9xt8;Ou1mtuąt$ tT$+D$n1Љ'\$á9t$փt7tlt@\$t$Ít&uF؍t&9u͉fD$$T\$t$Ð& D$t$T$|$( $t1$t$|$ ÐT$$D$t$D$9|$ u\t&S\$ $‰[v9t$( 99Ít&'D$$( MÍ'VSD$$Gk ҉t(1ې( D$$k uۡ9F59jD$$p N9t";t9@9>4tB=9t9$) R9@9[^Ð( D$$WC99됐k'9@9D$$d&UWVSL9T9~ 91fD) 9uD$`$T$`D$/$D$(+D$`D$ D$,t$4D$4$.=9ۉ9t[ktT|$$|$ vkt<,$e9|D$D$`,$D$ t99u|$$t2=94$ 99=9ɉjt&W E‹WɉD$$Z6.4 t& G,0}uًT$$L$$}UD$/$T$,D$ BL$JT$,1:/‹D$ 9D$(T$,|tT$`</tD$ T$$L$D$D$`T$$L$HT$ D$ D$ҺDD$`T$,D$$L$ʉt&?tD$d~05911ۋT$h|$d@D=) DÃB9uL1[^_]á9|$$l$`|$,@&D$<D$8|$l$4$D$4$ΡT$8D$</BD$8D$uktl$ D$ D$$lj\$,t$0|$4l$8<ÍvL$T$ D$ D$$L$wt&D$ E D$ D$$dn'UWVS\T$tD$< T$T$p$\$tT$pt$tD$4D$UM E$Pk] څU$t kE D$E$KCE kE @뛍&<\$,ák t$0։|$4|$Dl$8l$@k k ,$L$*l$$k D$2$\$$k D$L$t$D$ $k L$<$|$$k D$ڔk \$,t$0|$4D$@l$81Ҩ¨l\$0 kt$@؋$8 $$<΍t&$0D$TDŽ$D$ D$ T$T$,$L$T $R|$$T$(D$0T$DT$(D$ T$HT$ BC1;CCT$$$uҡC,Ep4$T$ ;Buz9uET$ L$H+L$D0\ S s XZXZX Z @BT$$CL$ R4Q(@ A$t&T$ ҉T$ T$ Bۀ|$O$@ $$@@@ k $@D$$|$0tD$0؋$(u[^_]Ë\$0t"Ct$@؋$8}uދ$@k $@D$$6q'UWVS,\$@$1҉Ƌ@$tf@u$1v$t6t&>O:yzyzy z IJvuыT$Hl$$D$T$T$DT$ ,[^_]ÐUWVS, e$ 1$@ t$D$ t$,$t)|O$D \$|$$V~Z)tܐ,$1$ e3u}, [^_]Ív,$$]$W, D$Iu,$f$q, /L,$b$$, D$s0D$(\$t$|$|$ ID$$D$㷁$x<\$D$<$4$D$$u6t\$t$|$D$<$'Ս&_$5\$|$$t$D$ , |$D$( t&4$B늍$$$$$$D$t$<$t"؋$$$ČÍt&D$D$t$$Dx,D$X<$D$xD$`D$|D$xD$H떻돐UWVS$D$lD$pD$t%D$@0uED$@҉D$@E‰D$:9rtP|$(u_|$,D&C9w܍&:)L$$T$ 菶T$ 륉=:<$趵:D$(3$@D$T$ D$D$$C\$0t$4|$8<Ít&+t\$0t$4|$8<Ít&'$0\$|É$$f~4L$,6T$(4$t$ōD$TD$,$sT$(f~4D$XT$(4$躉t$ǍD$\D$<$t$TL$\T$(D$`<D$l1D4rT$dT$,D$hD$4$D$0 D$8D$4D$D$lD$D$dD$ D$\D$D$T$胧t$ht D$T$t T$\$\$|$$$ČÐt&s1D$TD$Xf~4t$T11D$\D$`1tD$LD$ CD$D$@$D$̰:D$LD$ D$D$@$D$蓰1҅‰UWVS\e$L1|$ D$BD$@T$D$DD$HD$<$±T$?1B8BD$j C1ۅd<$̬C$菪D$@CD$DCD$HC$Le3\[^_]Ð4$般9C~C44$}uًL$,$tōD$@t$$蕨뻍vC9~?C$7t ލL$؉,$Pۍ 1ۡC$ի9C跪\$LD$ \$|$${<$蓫\$$&- _ UWVSLD$(l$`T$,D$$+D$(P$X<11;uI&;D$8tbD$D$8D$ ~D$\$,$ u D$<À;uD$($ZL[^_]ÃL1[^_]Ít&{t҃듐t&1u‰))ʍ0tD$,T$t$ $D$T$$T$$uD$ - D$D$A- $T- 肰&'UW1VSӁ\,$e$L1蝫D$@D$DD$HD$؃D$C19~&Cfx4uxCfx49څ~"1ېt&C$腩;C|D$C$(D$@CD$DCD$HCA&Sfz4t$>CqvL$<$t$Le3c\[^_]Í&C1&SCfx4un$辨;5C2Cfx4t΋Sfz4t<$蜩u‰<$L$L$D$C<$9D$u땍vL$<$tD$@\$$膤s<$L$L$D$C<$9D$t&|$ D$l$<$蔬\$LD$ \$|$$萪<$訧\$$e- tt&D$ $舧~v'D$P8u @$1҉$ټ$$߬$$ t$0f$٬$ۜ$٬$$fl$PD$jU )x\$pl$|$$'AD$tD$ D$ \$$T$pD$t$|$8tfD$t$r|$@D$l!::D$ D$2$- D$=$T$pD$t$.\$ D$ $rfD$PD$ \$ D$,$rD$ &D$,$rfD$P|t&D$,$xr[UWVS<|$Tt$P|$TbT$TD$@dvw 9rD$ d$ T$ T$,D$ $薕D$( l$ D$$l$OT$ D$$+\$l$(D$$\$Pr|v1  3 . u9L$$St8UT$,M!ʋL$(ы9}) 9\$Pwt$$랍l$9\$PUv\$ tc1t&,@vKT$(D$@)l$@1ҍv4*م~!t&@IVڍTqsYu̓;|$ u$x\$ T$4S4$/T$P,L$,0PT$TH L$ P1tCl$$l$(1DTtt&X Z@u;t$ uӋl$$)L$ 9D$Tu\D$($Ґ<[^_]ø/D$<1[^_]D$,D$ D$($膐1D$ 2 D$$D$- $- ޘv'Ot&'T$1tfUWVS\\$xt$tME$D$K$ w |$KZD$0 L$0 $諒D$4|$p1ɸWv|$4t&ЃȀwAl$4T vуɀ wL$4|$pl$p\$@D$|$D}9މ|$<r11ҋl$4 &w,߃D  3 . 9t$@w9t$@L$T$8$$D$D$(#L$L&|$JF|$p@2 1\$,D$, É3 . #G |D9T$@ʼnt$$)T$ 9}9_ut$^8\ euً\$L$(|$L$(|$(l$(L$ L$(|$$l$L$,l$4B)ȉLD$4$D$4D$4\[^_]À|$KOD$8T$9$"D$KbL$8T$D$,D$$D$ D$iL$8T$ T$(l$ρT$$T$(T$,T$-L$(\$|$D$,D$$D$ D$L$(l$(|$NjD$(\$l$l$(%D$ D$(l$$%D$,D$4D$4\[^_]ÐWVSD$\$Ht'01҉1f;t9F׋Du[^_1vUWVS,D$HT$Hl$@89BsVD$H1ҋH;(t,9s2XuT$D(PD$H@,[1^_]Ã,[^_]Ðt&1뷋B\0\$$D$oT$HBBtwD$|$D$l$ǐt&ot=D$H1ҋp;t"9w1ҍփxuT$HhBD$T$9T$ul$D$$LT$H:'UWVSD$08h1t011DtT$8$T$T$4x ƃ9u܉[^_]fS\$ C$цCC[Ð1Í'WVS1ۃt&r 4$臆t4uރf[^_É'\t$TƉ\$PeD$L1|$Xt t"T$Le3\$Pt$T|$X\Ðd |$8|$ D$CD$C $uSD$,$:$^ÅVT$D$D$ D$@D$ $BD$|$$f>D$,FFC蔆UWV1SÃL$T$4L$<ۉD$0ttD$48CQD$8*,vE9D$0T$4|*/ f{T$4|$4lv*t&/ujKfx^$7P$D$,D$H8D$,@@SVSU9T$0wƋ\$0D$/)l$4\$,$j D$<D$l$\$ D$D$ 4$@D$`D$4$D$D$,$Gz$le3uN|[^_]1D$ %9 D$D$@6 $6 聂$$7 D$t{UWVSكLD$(|$dT$,D$`L$3\$4u 9\$,D$$D$8؃@D$ D$3D$19rtft[tf뵍UTDWVS,D$D$D$D$D$D$D$$XD$$1Z;, \\$LË@l$XՉt$P|$TtZ;1t6Cu,CD$CC\$Lt$P|$Tl$X\fST$D$Hl$XD$Tl$D|$p$|$$l$$T$8L$$$D$ t$|$ L$$\$,$L$@T$8$$$T$ $L$$$|$$t$$l$\$<$t$T$L$ Ĭ[^_]Ë$\$<$T$H$:D$Ls$$t$0|$4$$t$@zl$D1ҋ|$p$$l$D1|$p$$$L$T$D$H.1҅ t&D$H9uT$l$@$D$h\$,$ rCDT$D$ D$$,$CD$H$;<$1 t|[^_]Ít&S`Kk0{t9NT$L$UH 9J  1\$t&LZ 9Y m9u\$ClC(1|$T$l$))‰CpD$S,t(4$ =D$4t$D$$>CT$4$TT$8k,s({0l$=N9Kdkh\$,|$(D$D$4L$l$$Í&|$(1L$@ |$$#L$ t)1 t& t ;A u9u1t9h9t$}\$,C`$A{lkt|$0=NЋCp|$,|$0D$9K t$0l$,{$L$L$8D$L$0؍D\$<|$$ˉD$(|$(1L$@ |$$#L$ t)1 t& t ;A u9u1t9h9t$}\$DP t9t$ 3DP t9넍t&|$ ;|$4}0:L$0t$ t$4v9DB &9ut$ 9P:f3DB t9u19[^_]Í&3D$ :T$ L$4ߋt$09‰Ǹ8[^_]D$@7T$0t$49} 8 u9|vUWVS,l$HL$@|$D1u69r19t < uL$@؉1,[^_]Ív9s tވT$ 79T$ L$l$L$\$Őt&DE #HD]  ЍP9w܋\$\$L$t|9tBL$&19uL$&D$D$1T$9vQP @\$&\$ Ʌhƍ&L$L$t$ 뫋\$t&'L$v"09v ҃vDÍ&'UWVST$ō.$q&L$$l$. h.1E‹T$ J`D$D$ $)L[^_]Ðt&`L$.D$|$L$%|$0l$. .L$ Q0D$ L$] Object %s is a %s, not a commitbad graft data: %sduplicate graft data: %stree bogus commit object %sbad tree pointer in commit %sbad parents in commit %sparent authorcommitterCould not read %sObject %s not a commitnot yettree %s parent %s author %s committer %s encoding %s Warning: commit message does not conform to UTF-8. You may want to amend it after fixing the message, or set the config variable i18n.commitencoding to the encoding your project uses. GIT_DIRGIT_OBJECT_DIRECTORY%s/objectsGIT_INDEX_FILE%s/indexGIT_GRAFT_FILEinfo/graftsGIT_NO_REPLACE_OBJECTS%s/%s%s/pack/pack-%s.keepCould not set GIT_DIR to '%s'UTF-8GIT_CONFIGGIT_CONFIG_PARAMETERSGIT_WORK_TREEinternal error: work tree has already been set Current worktree: %s New worktree: %sGIT_ALTERNATE_OBJECT_DIRECTORIES j u       /usrGIT_EXEC_PATH/usr/lib/git-core/usr/bin:/bintrace: exec:trace: exec failed: %s too many args to run %s  0123456789abcdefYou don't exist. Go away!Your sysadmin must hate you!/etc/mailname(none)invalid date format: %s <GIT_AUTHOR_DATEGIT_AUTHOR_EMAILGIT_AUTHOR_NAMEGIT_COMMITTER_NAMEGIT_COMMITTER_EMAILGIT_COMMITTER_DATEunable to read /etc/mailname: %s empty ident %s <%s> not allowedImpossibly long personal identifierYour parents must have hated you! *** Please tell me who you are. Run git config --global user.email "you@example.com" git config --global user.name "Your Name" to set your account's default identity. Omit --global to set the identity only in this repository. bad tree objectbad tree object %sbad blob objectstrbuf.hlen < sb->allocunknown pending object %s (%s)strbuf_setleninvalid object type "%s"sha1 mismatch %s object %s has unknown type id %d    refs/ref:HOME.git/.gitstrbuf_setlen V W  read errorpacket: %12s%c PACK ...\%o0123456789abcdefwrite error (disk full?)write error0000The remote end hung up unexpectedlyprotocol error: impossibly long lineprotocol error: bad line length character: %.4sprotocol error: bad line length %dGIT_TRACE_PACKET0123456789abcdefDuplicated ref, and SHA1s don't match: %s%s does not point to a valid object!'%s' exists; cannot create '%s'cannot delete '%s' from packed refsthere are still refs under '%s'unable to resolve reference %s: %sunable to create directory for %sRef %s is at %s but expected %sThere are still logs under '%s'Trying to write ref %s with nonexistant object %sTrying to write non-commit object %s to branch %srefname %s is a symbolic ref, renaming it is not supportedunable to save current sha1 in %sunable to move logfile logs/%s to logs/refs/.tmp-renamed-log: %sunable to move logfile logs/refs/.tmp-renamed-log to logs/%s: %sunable to write current sha1 into %sunable to lock %s for rollbackunable to restore logfile %s from %s: %sunable to restore logfile %s from logs/refs/.tmp-renamed-log: %sno symlink - falling back to symbolic ref Unable to fix permissions on %sLog %s unexpectedly ended on %s.invalid rule in ref_rev_parse_rules: %sDuplicated ref: %s peeled packed-refstoo long a refname '%s'bad ref for %srefs/tags/refs/heads/refs/remotes/refs/replace/Can't verify ref %srefs/%srefs/notes/Unable to append to %s: %s%s %s %s Unable to append to %sCouldn't write %sCouldn't set %sreflog for %s is a symlinkrefname %s not foundunable to lock %slogs/refs/.tmp-renamed-logunable to delete old %sDirectory not empty: %sunable to delete existing %sDirectory not empty: logs/%sunable to lock %s for updateref: %s refname too long: %s%s.lockUnable to open %s for writingUnable to write to %sUnable to create %sUnable to read log '%s'Log %s is empty.Cannot handle files this bigLog %s is corrupt.Log %s has gap after %s.Cannot lock the ref '%s'.Cannot update the ref '%s'.refs/%.*srefs/heads/%.*srefs/tags/%.*srefs/remotes/%.*srefs/remotes/%.*s/HEAD# pack-refs with:RENAMED-REF--branches--tags--remotes--reflog--not--no-walk--do-walk--bisectmax-countskip-n requires an argument-nmax-agesinceaftermin-agebeforeuntil--first-parent--ancestry-path--walk-reflogs--defaultbad --default argument--merge--topo-order--simplify-merges--simplify-by-decoration--date-order--early-output--parents--dense--sparse--show-all--remove-empty--merges--no-merges--min-parents=--no-min-parents--max-parents=--no-max-parents--boundary--left-right--left-only--right-only--cherry--count--cherry-mark--cherry-pick--objects--objects-edge--unpacked--unpacked=--cc--pretty--pretty=--format=--show-notes--show-notes=--no-notes--standard-notes--no-standard-notes--oneline--graph--root--no-commit-id--always--no-abbrev--abbrev--abbrev=--abbrev-commit--full-diff--full-history--relative-date--log-sizegrepcommand line--extended-regexp--regexp-ignore-case--fixed-strings--all-matchnone--reverse--childrenbad object %sbad tree %sInvalid revision range %s..%s^@^!unknown option `%s'refs/bisect/badrefs/bisect/goodglob--branches=--tags=--remotes=--stdin--stdin given twice?bad revision '%s'--merge without HEAD?MERGE_HEAD--merge without MERGE_HEAD?bad default revision '%s'diff_setup_done failedbad tagunable to parse commit %s%s is unknown object^--left-only is incompatible with --right-only or --cherry--right-only is incompatible with --left-only--cherry is incompatible with --left-only--cherry-mark is incompatible with --cherry-pick--cherry-pick is incompatible with --cherry-mark--unpacked= no longer supported.cannot simplify commit %s (because of %s)cannot simplify commit %s (invalid %s)bad tree compare for commit %sreflog of '%s' references pruned commitsInvalid symmetric difference expression %s...%soptions not supported in --stdin modecannot combine --reverse with --walk-reflogscannot combine --parents and --childrencannot combine --reverse with --graphcannot combine --walk-reflogs with --graph--ancestry-path given but there are no bottom commitsFailed to traverse parents of commit %sFailed to simplify parents of commit %sfatal: waitpid is confused (%s)%s died of signal %dcannot run %s: %swaitpid for %s failed: %scannot create pipe for %s: %strace: run_command:exec '%s': cd to '%s' failed|&;<>()$`\"' *?[#~=%-c%s "$@"cannot exec '%s'cannot fork() for %s: %sBUG: shell command is emptycannot create pipe: %scannot create thread: %spthread_join failedhooks/%sGIT_INDEX_FILE=%sToo long path: %.*s%s/configPlease upgrade Gitfailed to stat '%s%s%s''%s' is outside repositoryfailed to stat '%s'Error opening '%s'Error reading %sgitdir: Invalid gitfile format: %sNo path in gitfile: %sNot a git repository: %s'$%s' too bigNot a git repository: '%s'Could not chdir to '%s'Could not get directory '%s'Could not come back to cwdGIT_CEILING_DIRECTORIESCannot come back to cwdCannot change to '%s/..'umaskgroupworldeverybodycore.repositoryformatversioncore.sharedrepositorycore.barecore.worktreeExpected git repo version <= %d, found %dbad flag '%s' used after filenameambiguous argument '%s': unknown revision or path not in the working tree. Use '--' to separate paths from revisionsambiguous argument '%s': both revision and filename Use '--' to separate filenames from revisionsThis operation must be run in a work treecore.bare and core.worktree do not make senseUnable to read current working directoryGIT_DISCOVERY_ACROSS_FILESYSTEMNot a git repository (or any of the parent directories): %sNot a git repository (or any parent up to mount parent %s) Stopping at filesystem boundary (GIT_DISCOVERY_ACROSS_FILESYSTEM not set).Problem with core.sharedRepository filemode value (0%.3o). The owner of files must always have read and write permissions.%s/pack/pack-1234567890123456789012345678901234567890.%sinsanely long object directory %spack_report: getpagesize() = %10llu pack_report: core.packedGitWindowSize = %10llu pack_report: core.packedGitLimit = %10llu pack_report: pack_used_ctr = %10u pack_report: pack_mmap_calls = %10u pack_report: pack_open_windows = %10u / %10u pack_report: pack_mapped = %10llu / %10llu index file %s is version %u and is not supported by this binary (try upgrading GIT to a newer version)wrong index v1 file size in %swrong index v2 file size in %spackfile %s not a regular filecannot determine file descriptor flagsfile %s is far too short to be a packfilepackfile %s is version %u and not supported (try upgrading GIT to a newer version)packfile %s claims to have %u objects while index indicates %u objectsend of packfile %s is unavailablepackfile %s signature is unavailablepackfile %s does not match index%s: ignoring alternate object stores, nesting too deep.%s: ignoring relative alternate object store %sobject directory %s does not exist; check .git/objects/info/alternates.could not close alternates filepack '%s' still has open windows to itpackfile %s cannot be accessedoffset beyond end of packfile (truncated pack?)packfile %s cannot be mapped: %sunable to open object pack directory: %s: %sgarbage at end of loose object '%s'delta data unpack-initial failed%02x%02x%02x... lo %u hi %u nr %u failed to validate delta base reference at offset %llu from %sfailed to read delta base object %s at offset %llu from %sfailed to unpack compressed delta at offset %llu from %sunknown object type %i at offset %llu in %sfailed to read object %s at offset %llu from %spack %s contains unknown object type %dpack %s contains bad delta base reference of type %sreplacement %s not found for %sloose object %s (stored in %s) is corruptpacked object %s (stored in %s) is corruptunable to write sha1 filename %s: %s unable to set permission to '%s'insufficient permission for adding an object to repository database %s unable to create temporary sha1 filename %s: %s unable to deflate new object %s (%d)deflateEnd on object %s failed (%d)confused by unstable object source data for %s%s: failed to insert into database%s %luOut of memory? mmap failedindex file %s is too smallnon-monotonic index %spackfile %s index unavailablecannot get RLIMIT_NOFILEpackfile %s size changedcannot set FD_CLOEXECfile %s is not a GIT packfileobjects/info/alternates%s/objects %s/pack.idxbad object headercorrupt loose object '%s'GIT_DEBUG_LOOKUPGIT_USE_LOOKUPlo %u hi %u rg %u mi %u I am totally screwedbad packed object CRC for %sfailed to apply deltaunable to find %sunable to unpack %s headerunable to parse %s headerfailed to read object %sobject 1.2.3.4file write error (%s)unable to write sha1 fileerror when closing sha1 filefailed utime() on %s: %scannot read sha1_file for %scorrupt commitcorrupt tagshort read %sopen("%s"): %sreadlink("%s"): %s%s: unsupported file type%s is not a valid object%s is not a valid '%s' object0123456789abcdef0123456789abcdef../Invalid search pattern: %s%.2s%.2s/short SHA1 %.*s is ambiguous.checkout: moving from @{upstream}@{u}ignoring dangling symref %s.refname '%.*s' is ambiguous.Invalid object name '%s'.BUG: startup_info struct is not initialized.relative path syntax can't be used outside working tree.No upstream branch found for '%s'Log for '%.*s' only goes back to %s.Log for '%.*s' only has %d entries.%.*s: expected %s type, but the object dereferences to %s typePath '%s' is in the index, but not at stage %d. Did you mean ':%d:%s'?Path '%s' is in the index, but not '%s'. Did you mean ':%d:%s' aka ':%d:./%s'?Path '%s' exists on disk, but not in the index.Path '%s' does not exist (neither on disk nor in the index).Path '%s' exists on disk, but not in '%s'.Path '%s' exists, but not '%s'. Did you mean '%s:%s' aka '%s:./%s'?Path '%s' does not exist in '%s'strbuf_setlenshallowbad shallow line: %s TERMdumb%04x%s: protocol error: no band designator %s: protocol error: bad band #%d you want to use way too much memory`pos' is too far after the end of the buffer`pos + len' is too far after the end of the bufferBUG: your vsnprintf is broken (returned %d)BUG: your vsnprintf is broken (insatiable)strbuf_setlen%s:%p missing object referenced by '%.*s'Object %s is a %s, not a tagtype Unknown type %stag tagger Object %s not a tag-----BEGIN PGP SIGNATURE----------BEGIN PGP MESSAGE-----falseWhat does '%s' for %s mean? GIT_TRACE(null)GIT_TRACE_SETUPsetup: git_dir: %s setup: worktree: %s setup: cwd: %s setup: prefix: %s Could not open '%s' for tracing: %s Defaulting to tracing on stderr... If you want to trace into a file, then please set %s to an absolute pathname (starting with /). Unable to get current working directoryCould not trace into fd given by GIT_TRACE environment variablecorrupt tree sha %sunable to read root tree (%s)unable to read source tree (%s)unable to read destination tree (%s)unable to set up diff options to follow renamesstrbuf_setlenObject %s is a %s, not a treeObject %s not a treeCommit %s in submodule path %s not foundInvalid commit %s in submodule path %scorrupt tree fileunable to read tree %sstrbuf_setlenwarning: error: usage: utf-8utf8W]oKXpp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY`24RSrs   "'(229;  * . ` c j o *0/000 #gis strbuf_setlenunable to %s %s: %sOut of memory, strdup failedOut of memory, realloc failedOut of memory, calloc failedOut of memory? fdopen failed/tmpTMPDIRXXXXXXunlinkrmdirOut of memory, malloc failed (tried to allocate %lu bytes)Data too large to fit into virtual memory space.Unable to create temporary file '%s'abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789GIT_FLUSHwrite failure on '%s'fsync error on '%s'%s: write error (%s) wrong versionno messageinflateInit: %s (%s)inflateEnd: %sneeds dictionarydata stream errorstream consistency errorunknown errorinflate: out of memoryinflate: %s (%s)бȱCould not switch to '%s'Too long path name: '%s/%s'Invalid symlink '%s'symbolic link too long: %sCould not change back to '%s'PWDCould not get current working directoryCannot determine the current working directory%10s: %8u (%llu kB) Object %s is a %s, not a blob%c%d %d %o %.*s%ccache-tree: internal error%s: unmerged (%s) %s: not added yet You have both %s and %s fatal - unsorted cache subtreecache-tree.c: '%.*s' in '%s' not foundinvalid object %06o %s for '%.*s'bad config value for '%s' in %sbogus format in GIT_CONFIG_PARAMETERSkey does not contain a section: %skey does not contain variable name: %scould not lock config file %s: %scould not commit config file %sfailed to write new configuration file %sFailed to expand user dir in: '%s'core.autocrlf=input conflicts with core.eol=crlfInvalid mode for object creation: %sMust be one of nothing, matching, tracking or current.bad config value for '%s'%s has multiple valuestoo many matches for %syesoff[%.*s ""] [%.*s] %.*s = %s\n\tbogus config parameter: %sbad config file line %d in %s/etc/gitconfigGIT_CONFIG_NOSYSTEM%s/.gitconfiginvalid key: %sinvalid key (newline): %sopening %s: %sinvalid pattern: %sinvalid config file %scould not lock config file %srbMissing value for '%s'core.core.filemodecore.trustctimecore.quotepathcore.symlinkscore.ignorecasecore.ignorestatcore.prefersymlinkrefscore.logallrefupdatescore.warnambiguousrefscore.abbrevcore.loosecompressionbad zlib compression level %dcore.compressioncore.packedgitwindowsizecore.bigfilethresholdcore.packedgitlimitcore.deltabasecachelimitcore.autocrlfinputcore.safecrlfwarncore.eolnativecore.notesrefcore.pagercore.editorcore.askpasscore.excludesfilecore.whitespacecore.fsyncobjectfilescore.preloadindexcore.createobjectrenamecore.sparsecheckoutuser.user.nameuser.emaili18n.i18n.commitencodingi18n.logoutputencodingbranch.branch.autosetupmergebranch.autosetuprebaseneverlocalMalformed value for %spush.push.defaultnothingmatchingupstreamtrackingcurrentMalformed value for %s: %smailmap.mailmap.fileadvice.pager.colorcolor.pagerstrbuf_setlen088strbuf_setlenidentIdautofilter.smudgecleanexternal filter %s failedexternal filter %s failed %dId: $ Id:read from external filter %s failedcannot fork to run external filter %scannot feed the input to external filter %sCRLF will be replaced by LF in %s. The file will have its original line endings in your working directory.CRLF would be replaced by LF in %s.LF will be replaced by CRLF in %s. The file will have its original line endings in your working directory.LF would be replaced by CRLF in %s%lu %c%02d%02dyesterdaysecondslastmonthsyearsin the future%lu seconds ago%lu minutes ago%lu hours ago%lu days ago%lu weeks ago%lu months ago%lu year%s, %lu month%s ago%lu years ago%lu %+05d%04d-%02d-%02dPMAMiso8601rfc2822shortunknown date format %sJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberSundaysMondaysTuesdaysWednesdaysThursdaysFridaysSaturdaysIDLWNTCATHSTHDTYSTYDTPSTPDTMSTMDTCSTCDTEDTWATGMTUTCWETBSTCETMETMEWTMESTCESTMESZFWTFSTEETEESTWASTWADTCCTJSTEASTEADTGSTNZTNZSTNZDTIDLEnoonmidnightteanowminuteshoursweekszerotwothreefourfivesixseveneightnineten%04d-%02d-%02d %02d:%02d:%02d %+05d%.3s, %d %.3s %d %02d:%02d:%02d %+05d%.3s %.3s %d %02d:%02d:%02d %d%c%+05dS [ d j p t y ~            ;Zx0N             H  u z ! % ) O - 1 5 9 = B G L Q U Y ] b g l p  t  y  ~       R * P+ + * (# )Z ) *\  <  Q :           %s%4d.%01d%% %.*s diff.cmsg%s%s:%d: %s. invalid diff0,01,%dOption '%c' requires a value %s mode %06o %s mode change %06o => %06o%ccannot hash %s%sdelta %lu %sliteral %lu @@ -XXXXXX_unable to create temp-fileunable to write temp-file => %s %s (%d%%) %s%s--- %s%s%s %s%s+++ %s%s%s ~ diff.renamelimitdiff.color.color.diff.plainmetafragnewfuncdiff.suppressblankemptydiff.suppress-blank-emptysubmodule.diff.colorcolor.diffdiff.renamescopydiff.autorefreshindexdiff.mnemonicprefixdiff.noprefixdiff.externaldiff.wordregexdiff.ignoresubmodulestextconv/%s-dirtySubproject commit %s%s unable to read %sstat(%s)readlink(%s)cannot read data blob for %sunable to read files to diffa/b/--patchunified--raw--patch-with-raw--numstat--shortstatdirstat--cumulativedirstat-by-file--check--summary--patch-with-stat--name-only--name-status--stat-name-width-B--break-rewrites=--break-rewritesinvalid argument to -B: %s-M--find-renames=--find-renamesinvalid argument to -M: %s-C--find-copies=--find-copiesinvalid argument to -C: %s--no-renames--relative--relative=--ignore-all-space--ignore-space-change--ignore-space-at-eol--patience--binary--full-index--text--find-copies-harder--follow--color--color=--no-color--color-words--color-words=--word-diff--word-diff=bad --word-diff argument: %sword-diff-regex--exit-code--quiet--ext-diff--no-ext-diff--textconv--no-textconv--ignore-submodules--ignore-submodules=--submodule--submodule=--pickaxe-all--pickaxe-regexdiff-filtersrc-prefixdst-prefix--no-prefixinter-hunk-contextCould not open '%s'%s%.*s%s...internal diff status error%s%ssimilarity index %d%%%s %s%scopy from %s %s%scopy to %s %s%srename from %s %s%srename to %s%sindex %s..%s%sdiff --git %s %s%s %s%snew file mode %06o%s %s%sdeleted file mode %06o%s %s%sold mode %06o%s %s%snew mode %06o%s + @@%s %sGIT binary patch GIT_DIFF_OPTS--unified=-u* Unmerged path %s GIT_EXTERNAL_DIFF:%06o %06o %s %c%03d%c%c%c- - %llu %llu %s%-*s | Bin %s%llu%s -> Unmerged %5llu%sdeletecreate%s rewrite Could not open /dev/null{++}[--]%s%s:%d: leftover conflict marker internal error in diff-resolve-rename-copyinternal error: asking to populate invalid file.error while reading from stdin %sBUG: diff is failing to clean up its tempfiles--name-only, --name-status, --check and -s are mutually exclusiveOption '--%s' requires a valueOption '--stat-width' requires a valueOption '--stat-name-width' requires a valueoption `color' expects "always", "auto", or "never"diff--gita/%.*sb/%.*snewfilemode%06o---/dev/null+++b/%.*sdiff--gita/%.*sb/%.*sdeletedfilemode%06o---a/%.*s+++/dev/nulldiff--gita/%.*sb/%.*s---a/%.*s+++b/%.*sfeeding unmodified %s to diffcoreerror reading from textconv command '%s'%s%sdissimilarity index %d%%%s external diff died, stopping at %s. %s%s--- %s%s%s %s%s+++ %s%s%s %s%s@@ -%sBinary files %s and %s differ Invalid regular expression: %s %d files changed, %d insertions(+), %d deletions(-) ------------only found copies from modified paths due to too many files.inexact rename detection was skipped due to too many files.you may want to set your %s variable to at least %d and retry the command.emit_line_0strbuf_setlen@@diff_words_showfn_out_diff_words_aux`jG*?[{\oops in prep_exclude.gitignoreinfo/excludecannot use %s as an exclude filecan't find the current directorystrbuf_setlen%*sgraph.cgraph->num_parents >= 3graph->revs->boundarypar_columntarget * 2 <= igraph->new_mapping[i] == -1graph->new_mapping[i - 2] < 00 <= graph->expansion_row && graph->expansion_row < num_expansion_rowsgraph->new_mapping[i - 1] > targetgraph->new_mapping[i - 3] == target]#3 \diff_output_prefix_callbackstrbuf_setlengraph_next_linegraph_output_pre_commit_linegraph_output_commit_chargraph_output_post_merge_linegraph_output_collapsing_linegrep.cregexp returned nonsenseNot a valid grep expressionunmatched parenthesisnot a pattern expression %sIn '%s' at %d, %s, %s'%s': %sBinary file matches bug: unknown header field %dbug: malformed header exprauthor committer p->field < (sizeof(header_field)/sizeof(header_field[0]))Unexpected node type (internal error) %d--not not followed by pattern expression--not followed by non pattern expression--and not followed by pattern expressionbug: unknown binary handling modebug: a non-header pattern in grep header list.incomplete pattern expression: %s""P"(""match_one_pattern   ll-merge.coptsOAmerge.defaultmerge.%s: lacks valuedriverrecursiveconflict-marker-sizebuilt-in binary mergebuilt-in 3-way text mergeunionbuilt-in union mergecustom merge driver %s lacks command line.Cannot merge binary files: %s (%s vs. %s) ll_union_mergell_xdl_mergell_binary_mergell_ext_mergeUnable to create '%s.lock': %s. If no other git process is currently running, this probably means a git process crashed in this repository earlier. Make sure no other git process is running and remove the file manually to continue.Unable to create '%s.lock': %scannot fix permission bits on %s%s: symlink too longcannot open '%s' for copyingrefs/headsrefs/remotesrefs/tagsrefs/stashremoteBranch ( %stag: %04d-%fSubject: References: attachmentinlineSubject: [%s %0*d/%d] Subject: [%s] Message-Id: <%s> In-Reply-To: <%s> %s<%s> commit (from %s)log size %i object namesFrom %s Mon Sep 17 00:00:00 2001 %sMIME-Version: 1.0 Content-Type: multipart/mixed; boundary="%s%s" This is a multi-part message in MIME format. --%s%s Content-Type: text/plain; charset=UTF-8; format=fixed Content-Transfer-Encoding: 8bit --%s%s Content-Type: text/x-patch; name="%s" Content-Transfer-Encoding: 8bit Content-Disposition: %s; filename="%s" strbuf_setlenSigned-off-by: .mailmap# repo-abbrev:refs/notes/%supdate notes cachepackfile %s index not opened%s SHA1 checksum mismatchpacked %s from %s is corruptPackfile index for %s SHA1 mismatch%s SHA1 does not match its indexinternal error pack-check nth-packed-objectindex CRC mismatch for object %s from %s at offset %llucannot unpack %s from %s at offset %lluinternal error: pack revindex fubarbad offset for revindexno-[=<%s>][<%s>] <%s>[%s][=%s]cat <<\EOF usage: %s or: %s -%c--%s%s-NUM%*s%s switch `%c' %soption `no-%s' %soption `%s' %stakes no valueisn't availableexpects a numerical valueBUG: option '%s' %sBUG: switch '%c' %sshould not accept an argumenthelp-allhelpunknown switch `%c'%s malformed object name %sno such commit %sshould not happen, someone must be hit on the foreheadSTOP_AT_NON_OPTION and KEEP_UNKNOWN don't go togetheruses incompatible flags LASTARG_DEFAULT and OPTARGuses feature not supported for dashless optionsdid you mean `--%s` (with two dashes ?)Ambiguous option: %s (could be --%s%s or --%s%s)expects "always", "auto", or "never"8 XPunexpected delta opcode 0delta replay has gone wildpretty.tformat:?= =?%s?q?=%02X?=mediumfullerfullinvalid --pretty format: %sFrom: %s: %.*s%.*s Date: %s %sDate: %s encoding --pretty formatredgreenblueresetbad parent line in commitMerge:AuthorCommitinvalid --pretty format: '%s' references an alias which points to itselfMIME-Version: 1.0 Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit Ug!Ǵ.jUTF-8strbuf_setlen'\Too many or long arguments\f\r\vY____Yabtnvfr"\strbuf_setleninternal error: ce_mode is %oInvalid path '%s'unable to index file %sunable to add %s to indexadd '%s' unable to stat '%s'M %s U %s %s: needs update %s: needs merge index file open failedcannot stat the open indexunable to map index filebad signaturebad index versionbad index file sha1 signatureignoring %.4s extension index file corrupt%s: cannot drop to stage #0'%s' appears as both a file and as a directory%s: can only add regular files, symbolic links or git-directoriescannot create an empty blob in the object databaseWill not add file alias '%s' ('%s' already exists in index)index file smaller than expectedUnknown index entry format %08xindex uses %.4s extension, which we do not understand⛲CK)wZSCannot walk reflogs for %sNo current branch%s@{Reflog: %s (%s) Reflog message: %sKey '%s' of pattern had no '*'Value '%s' of pattern has no '*'Config remote shorthand cannot begin with '/': %smore than one receivepack given, using the firstmore than one uploadpack given, using the firstfind_tracking: need either src or dstsrc refspec %s does not match any.src refspec %s matches more than one.%s cannot be resolved to branch.unable to push to unqualified destination: %s The destination refspec neither matches an existing ref on the remote nor begins with refs/, and we are unable to guess a prefix based on the source ref.dst refspec %s matches more than one.dst ref %s receives from more than one src.Didn't think it matches any more* Ignoring funny ref '%s' locallyYour branch is ahead of '%s' by %d commit%s. Your branch is behind '%s' by %d commit%s, and can be fast-forwarded. Your branch and '%s' have diverged, and have %d and %d different commit(s) each, respectively. .remote.mergeurl..insteadof.pushinsteadofremote..mirror.skipdefaultupdate.skipfetchall.url.pushurl.push.fetch.receivepack.uploadpack.tagopt--no-tags.proxy.vcsInvalid refspec '%s'originURL:Push:Pull:branches/%.*s:refs/heads/%sHEAD::refs/heads/masterremotes/%s%s tracks both %s and %s(delete)Couldn't find remote ref %srefs/tags/*strbuf_setlenbad replace ref name: %sduplicate replace ref: %sreplace depth too high for object %s%o%ccannot unmerge '%s'Index records invalid resolve-undo informationBUG: assertion failed in binary searchcannot happen -- lo and hi are identicalofs %u lov %x, hiv %x, kyv %x assertion failure lo %u mi %u hi %u %ssha1-lookup.clov < hivlo %u hi %u rg %u mi %u sha1_entry_posBUG: signal out of range: %d %h: %m %srev-list^%s%s/.git/objects//.gitmodulesuntrackedon-demandbad %s argument: %s.path.fetchrecursesubmodules.ignorefetch.recursesubmodules(submodule deleted)(not checked out)(new submodule)(commits not present)(revision walker failed) (rewind)Submodule %s %s..%s: --recurse-submodules-default--submodule-prefix%s%s/Fetching submodule %s%s --porcelain-unogit status --porcelain failednot checked outcommits not presentnot fast-forwardmultiple merges foundbad --ignore-submodules argument: %sInvalid parameter "%s" for config option "submodule.%s.ignore"Submodule %s contains untracked content Submodule %s contains modified content Could not run git status --porcelainFailed to merge submodule %s (%s)commits don't follow merge-basemerge following commits not foundFound a possible merge resolution for the submodule: If this is correct simply add it to the index for example by using: git update-index --cacheinfo 160000 %s "%s" which will accept this suggestion. strbuf_setlen %m %sxfuncnamecommandcachetextconvfortranhtml^[ ]*(<[Hh][1-6][ ].*>.*)$javaobjcpascalperlphppython^[ ]*((class|def)[ ].*)$rubybibtexcppcsharpdiff=true!diff!^([C*]|[ ]*!) !^[ ]*MODULE[ ]+PROCEDURE[ ] ^[ ]*((END[ ]+)?(PROGRAM|MODULE|BLOCK[ ]+DATA|([^'" ]+[ ]+)*(SUBROUTINE|FUNCTION))[ ]+[A-Z].*)$[a-zA-Z][a-zA-Z0-9_]*|\.([Ee][Qq]|[Nn][Ee]|[Gg][TtEe]|[Ll][TtEe]|[Tt][Rr][Uu][Ee]|[Ff][Aa][Ll][Ss][Ee]|[Aa][Nn][Dd]|[Oo][Rr]|[Nn]?[Ee][Qq][Vv]|[Nn][Oo][Tt])\.|[-+]?[0-9.]+([AaIiDdEeFfLlTtXx][Ss]?[-+]?[0-9.]*)?(_[a-zA-Z0-9][a-zA-Z0-9_]*)?|//|\*\*|::|[/<>=]=|[^[:space:]]|[-][-]+[^<>= ]+|[^[:space:]]|[-][-]+!^[ ]*(catch|do|for|if|instanceof|new|return|switch|throw|while) ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>>?=?|&&|\|\||[^[:space:]]|[-][-]+!^[ ]*(do|for|if|else|return|switch|while) ^[ ]*([-+][ ]*\([ ]*[A-Za-z_][A-Za-z_0-9* ]*\)[ ]*[A-Za-z_].*)$ ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$ ^(@(implementation|interface|protocol)[ ].*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>=?|&&|\|\||::|->|[^[:space:]]|[-][-]+^(((class[ ]+)?(procedure|function)|constructor|destructor|interface|implementation|initialization|finalization)[ ]*.*)$ ^(.*=[ ]*(class|record).*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|<>|<=|>=|:=|\.\.|[^[:space:]]|[-][-]+^[ ]*package .*; ^[ ]*sub .* \{ ^[A-Z]+ \{ ^=head[0-9] [[:alpha:]_'][[:alnum:]_']*|0[xb]?[0-9a-fA-F_]*|[0-9a-fA-F_]+(\.[0-9a-fA-F_]+)?([eE][-+]?[0-9_]+)?|=>|-[rwxoRWXOezsfdlpSugkbctTBMAC>]|~~|::|&&=|\|\|=|//=|\*\*=|&&|\|\||//|\+\+|--|\*\*|\.\.\.?|[-+*/%.^&<>=!|]=|=~|!~|<<|<>|<=>|>>|[^[:space:]]|[-][-]+^[ ]*(((public|protected|private|static)[ ]+)*function.*)$ ^[ ]*(class.*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|[-+*/<>%&^|=!.]=|--|\+\+|<<=?|>>=?|===|&&|\|\||::|->|[^[:space:]]|[-][-]+[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[jJlL]?|0[xX]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|//=?|<<=?|>>=?|\*\*=?|[^[:space:]]|[-][-]+^[ ]*((class|module|def)[ ].*)$(@|@@|\$)?[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|\?(\\C-)?(\\M-)?.|//=?|[-+*/<>%&^|=!]=|<<=?|>>=?|===|\.{1,3}|::|[!=]~|[^[:space:]]|[-][-]+(@[a-zA-Z]{1,}[ ]*\{{0,1}[ ]*[^ "@',\#}{~%]*).*$[={}"]|[^={}" ]+|[^[:space:]]|[-][-]+^(\\((sub)*section|chapter|part)\*{0,1}\{.*)$\\[a-zA-Z@]+|\\.|[a-zA-Z0-9-]+|[^[:space:]]|[-][-]+!^[ ]*[A-Za-z_][A-Za-z_0-9]*:.*$ ^([A-Za-z_][A-Za-z_0-9]*([ ]+[A-Za-z_][A-Za-z_0-9]*([ ]*::[ ]*[^[:space:]]+)?){1,}[ ]*\([^;]*)$ ^((struct|class|enum)[^;]*)$!^[ ]*(do|while|for|if|else|instanceof|new|return|switch|case|throw|catch|using) ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[<>@._[:alnum:]]+[ ]*\(.*\))[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[@._[:alnum:]]+)[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|unsafe|sealed|abstract|partial)[ ]+)*(class|enum|interface|struct)[ ]+.*)$ ^[ ]*(namespace[ ]+.*)$, tabwidth=tabwidth %.*s out of rangetrailing whitespacenew blank line at EOFspace before tab in indentindent with spacestrailing-spacespace-before-tabindent-with-non-tabcr-at-eolblank-at-eolblank-at-eoftab-in-indentcannot enforce both tab-in-indent and indent-with-non-tab$ @$ $ $ % @% % malformed diff output: %s @@Could not stat %sCould not open %sunable to read blob object %smerge.conflictstyle'%s' is not a booleandiff3Last expression must not be negated: %sInvalid regexp to look for hunk header: %sunknown style '%s' given for '%s'strbuf_setlenpushnonfastforwardstatushintscommitbeforemergeresolveconflictimplicitidentitydetachedhead'%s' is not possible because you have unmerged files. Please, fix them up in the work tree, and then use 'git add/rm ' as appropriate to mark resolution and make a commit, or use 'git commit -a'.'%s' is not possible because you have unmerged files.& |k & xk ' tk ' pk )' lk :' hk [attr]%s not allowed: %s:%d core.attributesfile/etc/gitattributesGIT_ATTR_NOSYSTEM[builtin].gitattributesinfo/attributes[attr]binary -diff -text%.*s is not a valid attribute name: %s:%d BUG: non-INDEX attr direction in a bare repo(builtin)false(builtin)true(builtin)unknown strbuf_setleninvalid base85 alphabet %cinvalid base85 sequence %.5s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!#$%&()*+-;<=>?@^_`{|}~38;5;%d48;5;%dcolor.uinormalblackyellowmagentacyanwhitebolddimulblinkbad color value '%.*s' for variable '%s'n* u* - 1 {* 7 * * * * * * * o %.*s%s%s %s%06oSubproject commit %s object '%s' is not a blob!diff --cc diff --combined ,readlink(%s): %sread error '%s'early EOF '%s'%sindex ..%s%s %snew file mode %06o--- %sdeleted file mode ..%06o+++ -%lu,%lu +%lu,%lu %s%s %s%s::::::::::::::::::::::::::::::::strbuf_setlencopy-fd: read returned %scopy-fd: write returned 0copy-fd: write returned %s%s: close error: %sinternal error in merge #1internal error in merge #2internal error in merge #3internal error in merge #4invalid log-grep regex: %sdiffcore-pickaxe.cdata[sz] == '\0'invalid pickaxe regex: %scontainsinternal error: dst already matched.Performing inexact rename detectiondiff-delta.cpacked_entry - (struct index_entry *)mem == entriesѴYiVsg?Df7P*~ {'ZYA n\uT*NN'CMcqH$(~Qڿ80B i6:I_DV<1y UHg=[72waN.ʂ=SGܖ 6k.o; 㐵 mdIP)-_^˵i9/q`ˬymx%!tsC G#cu0׭PycͯE5#egwz3#zo;9 kbѷi>eM? ] {SRЦ-w:ᆑ4}@4m3+]ހ.(uw,܌A!]OJqj&'ȒE R)TZ,m"2TkKةҊs^>*pWGLXY40J}oC9L|Ja%FW$}=ds@`[qFl/:_!j5FH9<`[`=x6(T!fZlG03%Htl߇"Vwra .$b6xޣoӭ~.|܅p ~KP8(zN]{ Lq[(t ?0Q"iQ܃hڬfWfVĻ媍E\P/9YC7?k^f+IvB~'2LO%AA!?CVYRX| e%1_Dž =DdUx-O#[X+j hRd8ޓ 4nomţ2rxud,64JbEvݝE& )p@Hz N#v;'R;*&bU;|b5,]\zcreate_delta_index ~3VԆ(G]>J}y Q/|pENOXHn&B wq_3!uULbׁJڡ4[(VreMA3υ0lY;DT:ՒزkfCF==895GGo>t>ry@ChcJP7p;I}ap 0-N:f76$ %)[k8sK c5"n\6t %w+UaD}lxI,XR&zz+ps}P %c[7t:n }"]]\n}N,5+8U3zrǔ,!RloaU/9uG+"h&ܗ>(@`a;)S7$IF^ffnm0cNH>JE4$bc)MC3ėɷeƄkDˤ: pXPlUC=J-fG kTKVYk[(h~Q6e/VyX'&%p_!VX [x*w1L<<'2dvAK{a5*cB[/Vm-ikP I.Xxj4UWg)f^ h'$ev)Y鮜'/z"Zq `u S#"]N^rC _m$ZL{lL/-AS"|1 *ŤTi,w?WARާn_*8 !F9gPP1]cOd`Dn6]HAw?LA3_W=)LvmgD Ejd;notes.c!tws->nextnote_path_len <= 40 + 19fanout < 20notesubtreeprefix_len * 2 >= npath_len < 40 + 19tree && parent!*pnotes ref %s is invalidnotes.displayrefrefs/notes/commitsGIT_NOTES_REF!t->initialized!display_notes_treesGIT_NOTES_DISPLAY_REF Notes: Notes (%s): tws->path[0] == '\0' && tws->path[1] == '\0'memchr(path + 3 * n, '/', path_len - (3 * n)) == ((void *)0)Could not read %s for notes-indexFailed to load %s %s into notes tree from %s((uintptr_t) (entry) & 3) == 0i == n && parent_stack[i] == tree((void *) ((uintptr_t) (parent->a[index]) & ~3)) == tree((uintptr_t) (*p) & 3) == 2 || ((uintptr_t) (*p) & 3) == 3Failed to read notes tree referenced by %s (%s)strbuf_setleninit_notesload_subtreenote_tree_insertnote_tree_removenote_tree_consolidateinit_display_notesadd_noteremove_noteget_notefor_each_notefor_each_note_helperconstruct_path_with_fanoutwrite_notes_treewrite_each_notetree_write_stack_init_subtreewrite_each_note_helperprune_notesutf-8format_display_notesGIT_PAGERLESSGIT_PAGER_IN_USELESS=FRSX, %u.%2.2u GiB, %u.%2.2u MiB, %u.%2.2u KiB, %u bytes | %u.%2.2u MiB/s | %u KiB/s %s: %3u%% (%u/%u)%s%s%s: %u%s%s%s... , %s. \ No newline at end of file 0123456789;`&h|bhHg iq1itXiЅiij:jĝkkkl5l\ltll<(y|&y&\{&{&}'l~0' `'l'''l(<(܈(()P))))̍4*LX*l*܎** *+$+ܓD+h+\+,,@,|,ܗ,,,| -8-lx--<-<.|X. t.,.<.\.../L/|/̤//\> ><>|(?T?,? ???8@L@`@x@@l@@@,A\ A8APAhAAAAAI>I,?I|? J|@LJ@pJLBJEJE KSdK ^K_K`Lla`>C\FF \G<G`G(>T@LAAA BLBBXBlCEFFlGLK,MMO O@AC S AH \A(܄kC@HLHPO B , AA CP  AAA І&AC `A42 H lC HJVlX+C g8pAA AAC@AA AA +AF bA0CPFJP B U$̈C0LHB G a@4%AC ]C$`D\AK I AA |kAC0cC$ȉC@P@ E (`CPHJlg H @ČAA AAF  AA AAF (D0&C@Ho E Tp4AA AAC0 CA AAE  CA AAE (YF^Rg C < AA AAC0 CA AAG $4AA l AA <\ؓ_AA AAF  AA AAA DAA AC  A AAJ CC AA,pAr E I A F A O$(ܕ`AC e AF P;AE [ AA Tt0AC ACEPS AA AAD  AA AAH xAC0 CA C T(tC0HHHHr C 4P7C sLx7C sd,C h|,C h$ИC0MXFX B (xC@HMHt D %AC _A,WCS< tAA AACP AA AAA `4GC FGv(dC@HNJFp G 0C0HHPHg F iPTAA ACE@ AA AAC [CA AA4aC0HFO$TC@MFH@|CAC AAF  AA AAG ,C HN} B G A @DsAA ACF! AA AAA @4AA ACHS AA AAC x\-C itCWP|AF AAC0r CA AAA CA AA@(yAA AAF# AA AAF @@d$AA AAH AA AAH @P7AA AAH+ AA AAE (L]AEd AE kA<IAA ACC@ CA AAG $4CPFUF@ D \HC@YH\ H ԯ0C l<AA AACP AA AAE LHT.C jl" ,MC HHHm$PYC0HHHHqx#C _+C g#C _4+C gL#C _d+C g|.C j, }AA C@  CAB P+C gh.C j3C0o4<AC AE . C AAC (iAC ` DH qGPصjAA AAC0R AA AAC CCA AAP,AC dCp,AC dC9AC oAT4AA AAC` CA AAG  AA AAB (bC HHHn G Q,4@AA F }  AAA (dCPJSO A <C0PQm G C E L L <$AC AAH a AA AAE <ľAA AAC` AA AAF (PT!FU^h A <|XAA AAF AA AAD @AA AAF AA AAA @aAA AAF AA AAF D+C g\(Hp4AA C J  CAE l  HAC S  HAD (9AA C o CA@AA AAF!K AA AAG , X0@ t,T eAA AH  AAC $ iC HHF{ D ( vAC E j AA \/C k t3C IF`(!NC`FMH A $AA AACy AA AAD x FA AAA .>9C Of,/?xAA C [  FAA L/X?`/d?t/p?C@(/@5AA Gi AA/,@C W(/4@C@LHHPx A T/@(AA AAH AA AAH v AA AAF $T0BpC0JKK E G@|0BAA AAH AA AAG (0dFF!NIw B l0G7AA AAC` AA AAC a AA AAC  AA AAE $\1JC [ A (1PKpAC L AG PC41K`AA C J  AAG C CA1K=AE sC02K:AA AC pA AA(<2K5FIIQ D ,h2LfAA C K  AAA 2 AA AAG 05Z^AA CC RA AAD5ZAA AC w A AAH CA AA(6[mC HHi D U C $D6`[TAm B I O ITl6[AA AAC`G CC AAB  AA AAF <6^AC AACP AA AAD T7p_;AA ACC`g EA AAH  IA AAA @\7X`rAA AACS CA AAH (7eCPFIn| D (7XfCFFXDQ D (7 gCPFFFD| C <$8gAA AAC` AA AAE (d8`i6AA E j CA(8tiFN]PM B (8(kC`FJFaD B (8lC@HLGH B <9nRAA AAC` AA AAH 4T9 oC OHFo A k E k@9o^AA AAF" AA AAF 9tOCPF A ,9(ujAA C@]  AAA $:huC`HRFk B D:@v6Co\:hv5C@i A x:vJAC@ AA (:vCpHL\H A (:\wdFNIu H (:yC@HHHH} H ( ;zC`PHM C (L;|CPHHHH\ A x;,~UAC MC ;h~uC HHc A ,;~AC C O  AAH (;$C Pi D ] C <8'C @0<tAA ACEZ AA AAG @t<AA AAF AA AAB (<C@HHS B 4<0AA AC@ A AAA l=AA AAC` CA AAB l CA AAA 7 CA AAA =8oC0HFLQ@=-AA AAF! AA AAF @=pAA AAH!@ AA AAH @8>̐AC AAF AA AAE <|>x8AA AACp AA AAF $>x\C HL{ F $>yC0HHK J P@ ?AA AAF AA AAH $P?{AF m AA x? cF W A (?`CpHTS A (?hAA C ` AA4?8AA AFr A AAB <$@AA CCCP AA AAA @d@TAA AAF$ AA AAF <@AA AAC` AA AAA @'C ,@xKAC s AH IA(,AeC HLq H T$XAܫC0LMw E Ad-A7AE mCA.AC hAACAC }A,AAA C q  AAH $B@6At(@BdaAA C Y AA(lBAAA C u AA B̭ZCRMw(B%C@JUHT G B 3C0oC43C0o,C\iAA C H  AAA <HCFAA AAC@8CA AA,CqAA C J  AAG (C]C@HHHN C C0#C _8CHAA AAC@AA AAd8DAA AAC0 CA AAD C CC AAE fCA AA8DAA AAC@AA AA8DxC0HHFE B _ A h H hEAF AAC0i FA AAB W FA AAH P AA CAA hEAA AAC@V AA AAG o CA AAC S AA AAA <EAA AAC0 AA AAH ,0FC PSi A i G (`FXAA H I CAFHPFTAC CFC@S CA AAG OCA AA(FCPHHHUN B  G#C _8G$C0`PG:C0vhGܷ7AC0oC8GPAC AAC0BAA AA(GAA C  AA0GtAA AC A AA($H^AA C V AA$PHC HHQ{ A xH|,C hPHdAA ACC@D CA AAE CCC AAH#C \,HȹmAA C E  AAD ,IC HGc C (PI CpHT\ E 4|IhC@JMO G _ A s E 8I wAA AAE0gCA AAIdw(JоCPFJGa E $0JtrC0PLV C y4XJAF C0r  AAB  AAJLC i D XJ{C0H_PJ#C _J,#C _$KD?F Ndx H ((K\C0FIL@ B TKN'C <hKVAA ACCp AA AAC K K@KTAA AAF AA AAD <LAA AAC CA AAG $TLCPL`v A |Lh3C o(LQCPFJo J ,LCGZ| H W,LCGZ| H W MdC HGc C DM"$XMC0HFIQ E @MAA AAC? AA AAF 4M@AF E0  AAA y CA(MqAC U CD MC(N<4C W(Dd`>\C HL_ B O E (pd>5AC ] CD GAld> C@HHS C c E o I ? E ) E _ E O E  e(Jp eJAE r AG <De KAF AAEa AA AAE HeKAD FC A AAH ] E AAA ,eLEXv E l G 4fLZAC C }  CAH E CA$8fMUC EJ` F Yd`fTMSAA AAC@ CA AAH Z AA AAJ ZAA AA(fLNCKFFK C TfOAA AAC? AD AAC V AA AAF Lg'C @`gPAA AAH AA AAA @g`V*AA AAFF AA CAB gL]!$gh]CPHHHHY($h]COGTh C (PhD^CHNY F |h^IAGh^FADh_h_#C0_(h_pAC E0z  AAC  i_  i_4i_?AC yA Ti`BAC b AA xi<`?AC yA i\`C@HIFi(i`@CDIMHJ E (iaCpFRZ C @jcAA AAH  AA AAF (Xj\heCPPHR= F @jjoAA AAF$ AA AAF @jmAF AAC  AA AAH  kXsFC0B($ksyC@MMNp E PktOAC0IA(tkuNAC0o AD TA4k4uwAA C@B  AAG d AAPk|uqAA CAE(I AA AAH LAA AA<,luAF AAC@x AA AAH DllvbAC AC E A AAH FA AAl@v9 llv?Ai F F B lvVC o F mv"AC XA(mvM AA AAF qtTAE J AG (r CFSV F 8@rvAA AAC0jAA AA<|r؎AA AAEp AA AAB 4rXQAC AE0 A AAD TrcAA ACE` AA AAH W AA AAA ,LsC@FJ] H X H a$|s(CPFIFLXsAF FAC3 AA AAH  AA AAE DttC@QMH H ? E w E [<HtC@MQH B  I k E tt) tġC0JKn B (t`C0HO E $uAA  AD ((ulFNN[} F ,TuFMIIK D $uplC KF\ H s,uAC O AD X AG u`AC d AG vT'AC aA( vdJCKJFs G (Lv5AC T AG OA0xvAF  AF O AH 4vuAC AC  C AAH (vаC@HFHH\ C PwDAF ACE(r AA AAB MAA AA0dwn_AC AC0SA AA$wCPPOn H wTPAC ` AC wPC HSq(xC0HHHV E (0xrC@HHHH C \xh*AC `A,|xxC0HHIb B S E $x(C@JN F @xAA AAF AA AAE @yLAF AC p A AAB CF AA(\yoAA C g AA(yvC LHS F q G y0-C i<yHAA AAC`  AA AAD $ zC HHU H i(4z _AA C W AA(`zT@CKKP, C pzhAA CAF AA AAC  AA AAE  AA AAH ({CpIFH  E T,{XAA AAFD AA AAF L AA AAH {%AE ZD{  {,LC FMuH{XZAC CC@ A AAC AF AA(|l1C m@|'C (T|hFIIeK H |%|-|,| HAF w AA FA<|( AA AACP> AA AAG h,} $AA AACPh AA AAE O AA AAE OAA AAT} AA AAC@ AA AAH V AA AAF (}KAA C C AAl~(qAA AAF CA AAH h CA AAB P CA AAB ~8TAC0~ AA T~tAA AACP AA AAB  AA AAE T<eAA AAC`5 CA AAA C FA AAA (`TC0LHWv D <UAC AAEpX AA AAA @1AA CAH  AA AAF @~AA AAH  AA AAA TT0`AA AAC0a AA AAD  AA AAA <8AA FAE0 CA AAA .CgTAA C ^  AAC T  AAA C  DAA K  CAA \HXF L A (x_AC C q  CAD @OAA AAF AA AAA 8~AA C M  AAD T  AAB 0$ AA AC zA AATXl AA AAC@b CA AAA  CA AAA 4!AC YATЂ4!AA AAC  AA AAF a AA AAC (0'C <!)C e(T!AAE _ DG OA(!=AC Eo CA$!MCFI_ G P(ԃ"C0FPFFl G 8"AA ACE@AA AA<x#,P#AA C   AAF hT$wAA AACP? AA AAF R AA AAB JAA AAh&< AA AACP^ CA AAA  CA AAA p AA AAA H CA AAA ,t 2AC | FB w FA 202AA AC0A AA 83fAC0`A 3yAC0f AE 443AA C0  FAF C CAhl4eAA AAC@ AA AAE f AA AAA \AA AA(؆5C@FFFJ F T06AA AAE`v AA AAE Z CA AAA (\8CPHFFHL E <:,C h0T:]AE \ AE S AD [A0ԇ:C FFx A R F f A (:C FJS J  A (4P;}C FD^ E @ A ,`;C FHS D Q A (AA ACE/ AA AAB TAAC ACC@] AA AAD e AA AAA @B AA AAFA AA AAA 0dKuC LH] TKRAC LAxKAAC0{A8,LAA AAC@CA AATԊLAA AACP( AA AAE j AA AAA @,OVAA AC } A AAB FA AAp4O2P`OAA AAC0~ CA AAE ZCA AA؋OuC0HFcT,PAA ACC0S CA AAF k HA AAB ,PPjAA E T  AAA @QAA AAF AA AAE ČSXC p A (SC`KHHHs G  (UCP} A 0(UC@QMNn C {(\hWgC`PHHR E XC s B p H YeAC _A̍hY"AC XA,xYAA E0^  AAA <YAA FAH | AA AAG (\Z-C0IFFD F [5AC jF[ C [HC HH\ A ,$\C HHLV C r F \$$\F Nd A L]+C gd] (x]eAC K CF GA^1AC kA$ď0^yC@MFHZ<^AA AAC0k CA AAH (,H_FAC E z AA,Xl_C HHP[ B c,`BC ~Pd`}AA FAC0f AA AAB AA AA(a&C`HHHH G < bEAA AACp< AA AAA T`eAAA FAC AA AAA  AA AAF ,lC HNz E o A <mAA AACP CA AAA <( oAC AAE@ AA AAC ho"AC XAo9AC oA@oAA AAK AA AAB sRCLHLnsC [@(sAA AAF" AA AAH <luBAC CAC@ AA AAA v.Ae B AГvAA FAC@a CA AAE ^ AC AAD } CA AAE jCA AA,TxCPWKgE G (pzCpHULB B D{MC0I$Ȕ|{C@XHH[ A ({gC T[ F ] C 8(|AA AAC`AD AA(X|FNg D @}AA AAF5 AA AAE (ȕ\;AC Ii CA(pgC T[ F ] C < BAA AACP  AA AAC 0`ĄLAA AC BA AA<AC AAEP FA AAC 0Ԗ]AC g AD O AH SA0C FHY F h H a G ,<HkC0FKFk C w A Tl7AA AAC@ CA AAC b AF AAE ėp4C [ B S<uAA AAH0+ AA AAA X$Ў AA AAC AA AAA   AA AAE >AC xA-C $CPLHH A ܘx<C (AC y CH JA(AC `C(<(lAC t CE fAhlX$|C@HTHM D @8LAF Ap  AAA Z CATkAA AACP AA AAG  AA AAA Lș (`ę CPFVP B 8AF C L  CAF K  AAK Ț ?AC wC,84JAH,h2(@8CpFIFL G lNC FKFs'C TAA AACP\ CA AAG  CA AAE PhAF AAE@U CA AAG YAA AATP@AA CAEP AA AAA S AA AAA <AA AAH AA AAE TL)AA AAFt AA AAF  AA AAE @$BT`AA AACp AA AAG  AA AAF  AA AAB z AA AAB <؝AC AAC` CA AAF TLAF AAC@B CA AAD B CA AAH @pĮ AC AAC AA AAG @cAC0K AH (؞FWINS G TuAA AAC@ AA AAD s AA AAA <\:AF AAC@ AA AAA 6CHH^Xȿ`AA AAC AA AAC n AA AAA hAA AAC | CA AAG C AA AAA [ AA AAA ,`wAD | AF mA'C TȠAA AAE@y CA AAH  CA AAH < pAC CAEP\CA AA<`$~AA AAC@ AA AAL 4dAA AC  A AAH <ءAA AAC0w AA AAA < P,8AC AAC@ CA AAA KFC AA"<C0HHHHs J c E  Ԣ ^C HLc F (\C@HLHJI F $0cAC0]A,H|AA C0  AAE TxAA AAC@ AA AAE s AA AAA 0УAA AC qA AA4AA AC Y A AAF 4<HAA AC z A AAE ,tcAC C@T  AAA (CFky C PФAC AAC@ AA AAG [CA AA $p^C0HLe D $HC IZ H (p$SAC E0G AAXh4C HHHHB C Y G L~C LHWO( FILIR D (8lCOHKJa H (dCGHHHp F $CHGHHi8vAA ACC$fCA AA$@C0HHQa4RAA AAJA AA8TAA AAC0uCA AA($C HL_ B ^ VAC0PA0P\C@LH_ E d L ((|^CpHHHLS F @TAA AAC AA AAA ,lCKHE A 8x AA AAC@AA AA@LAA AAC% AA AAH <<AA AAFO AA AAC |XC X`# |cAC ]A ̩GA} B FAA AAFF CA AAB V HA AAG  CA AAA D CA AAA dx<AA AAC0Y AA AAL N AA AAF GAA AAPtAA CAC@ CA AAB WAA EA$40C HHHw F $\_CPJ_N F (C0HHHP F !C ]<ȫAA AAC` AA AAG dAA AAC0| AA AAA S AA AAA JAA AA(p-C0PHO A HAC BA,$AA C@  AAF C FHFr0"AE ZA$4@C@IJHc8\HAC AAE0xAA AA5AE mA(C@QFLG A PP AA ACEP AA AAD @AA AA 8 mC FFJ G (\X C0FGIHU B mC FFJ G  mC FFJ G ЮT mC FFJ G h GAA CAE@M AC AAB  CA AAD T CA AAF l` JAA CAE@| AC AAC G CA AAC V CA AAD TЯd yAA CAE@| AC AAC  AA AAH $(CP_ A <PAA AAEP AA AAA <8AA AAEP(CA AA$аDCKKZ E K=CKK_<AA AAC`j AA AAC Xl.AC hA$x|C@HHHJ6AH kA$8Ա0HAA AAC0xAA AA<DAA FACP! CA AAA PP bAA AAC0F AA AAG CCA AA< AA AAC0b AA AAC <@!AA AACP AA AAC P$"RAC AAC0z AA AAA CCA AAdx"AC AAC@` AA AAC C CA AAG NAA AAdT"$AC AACP AA AAG C FA AAD [AA AAH#\#'AE _A$|(#C0HLLz C (#;AC C q AAд#"AC\A@#AA AAF AA AAD P4P*AA AAC0x CA AAC CA AA+(+>4T+XAA C {  CAL C CA<|+[AA AACP' CA AAD D(-lAC AC T A AAA CF AA(p-C@NKB B <.JAA AAC@ AA AAH @ܶ/"AA AAF  AA AAB H 1AA C@i  CAF [  HAD o  HAH lx2/C0kT2AA AACPv AA AAG _ AA AAE (ܷ3AA C@ AA3 (3{C0H[U E $H4C NLv E (pt5C0HLTb C <6AA AAC0 AA AAB <ܸ6NAA AACP AA AAE 7HC HGu<<8sAA AACP AA AAE 8|H9AA AAC@AA AAh9|AA AAC@ AA AAH C CA AAG C FA AAD l$:AA AAC` AA AAA N AA ACA C CA AAA (=C0HX\ A >sC TD A >]AC WA ,?AEPxA,'C @@t?8AA AAH  AA AAA 4pAiAA AC0 C AAD <BAA AAC AA AAA (DAC0~A( DC0HHX` E (L(EUAC A AJ CA(x\E{C0HHOz D (ECPHHf C ,мDHC0HHSn D s@H$AF AAK  AA AAH DN @XNAA AAF [ AA AAA @OAA AAF AA AAB T$SAA AAC CA AAC ] CA AAE (8TCpMPr F Td@XAA ACEa CA AAF W CA AAA XVAE NAlX#AA ACHK CA AAA V AA AAF  AA AAA P[6C0oh[#C _[NC0@ E E\7C0p<,\AF AAC@k AA AAE |\8 x\AC ACC@AA AA(H\uC@FFWf D $t@^C MHFD F _AC OE,_AA C0b  CAE <`AA AAC`) AA AAD <,cAA AAC@ AA AAF lXeAC0Z CG ,eAA C0  AAC gEC HGng7C s gLA@ G C<hAA AAC`N AA AAG <\hl<AA AAC`  CA AAF 8hmcAA CCE0QAA AA8mAA AAC@wCA AA'C T(mAA AAC0e CA AAF y CA AAA TnAA AAC0 AA AAF c DC AAD <o$AA AAC`  AA AAA (pAA CP CA D0q\AC@VA(hlq=FKR]q G (rC@MHMM F s9C r<,s\AA AAC@0 AA AAA 8Lt`AA AAC0TAA AA0TptC0^JS B o E @uzAF FC | C AAG \C AAXu-C tuLAD C C8uAC AAC0tAA AAP@uIAC AAC@ CA AAB CA AAXvDAA AAE AA AAA  AA AAE hzAA AAC` CA AAG o CC AAA QCA AA<\(|AC AAF AA AAA <|AA AAC0Z AA AAC $h}C FK_ E O(}[CZIP B ^0~AC OEP~%C L A Tp~#C \,,~yAA C   AAB <|AA AAC` CA AAA ,̃aAA C M  AAA d( AA AAC0 CA AAG O AA AAE RAA AA4tAA AAlA AA(C@FIFH\ D TAA AACp AA AAA Y AA AAA L1AC kA$lC HHH G ,C0ZHJ_ J n PnC HHH E 'C c'C c̊+T,mAA FAJ,_ CA AAA { FA AAA (CPHFJX E <dAA ACE@  AA AAA (IPLFJJ A (ȎCPLQA G (H%C@FKHH F @tAA FAF AA AAA ,,iC Wd B N J L@lAF AAF AA AAA 8,AA AAC@AA AA<hAA AAF@~ AA AAD ,C Tx A N J $F\Yh E @TAA AAFF AA AAD <DAA AACpJ AA AAC <AA AFCP CA AAE $UC Vc D T<HAA AACP CA AAG , AU B G<PAC AAF  AA AAF TiAA AAFO AA AAC  AA AAA 4C@LPV C S E T( $FIF]0 F <LAC AAF AA AAB TBAA ACC` CA AAA C CC AAE @AC CAH4 AA AAH (,<(WAl C D L I G F<lXAA ACCP CA AAE (8C@KV H 8AA CAJ0AA AA<@sAA ACCP CA AAA (TCPFFLo F @yAC AE y A AAB kC AA<PAC AAE` AA AAA @E AF AAFP AA AAE THAA AACP AA AAA Z CA AAA lxAA AACp AA AAA ( AA AAA )AA AA,8=AA As  AAA Th3AA AAC@R AC AAA C DA AAF 8NAA AAC0BAA AA,AC fA00GAC AE yA AA$dC`FFTk B <aAA ACE`q AA AAH PeAC ACC0H AA AAA FCA AA =C HHi@o'C TBC HHn$t C HHIP D 4AA AE f A AAA (WAA C M CA(DC`OIrS H @,AA AAH!' AA AAA <p4AA AAF` CA AAG <AA AAE@^ GD AAD <EAC AACw AA AAD (0 C@Qg C $\CPMSm H '(CPHHJKk E ,pAA C@b  AAG $bC TJu B <HAA AACP AA AAC \+C S B R4|(AA AC A AAA 8AA ACC@CA AA,6AA C0  AAB ( $C0MHHH G 4LAA ACP A AAA ,C0QTx H a A 0xC Ys E (CPM\{ A 4AF AC0 A AAA <(AH  AA <`wAF AACPn AA AAB <AA AAC@O AA AAA 0DC@LHTH E x H EC A,"AC XA LHAKzApDC f G C o F M C @C R C g 8C0FKHz B  A  H  taC0](8~C`FILW C (d yCPLHLg F t48AA AF C AAA +C g(WFlX C  C WT8 AA AAF AA AAA s AA AAD (FNYfP E <8AC ACCpCA AA%AC _APAA AAC@ CA AAE sFA AA(pD_FSNKl C 8xAA ACEAA AA ,MAE EATXAA AFCT CA AAA  CA AAA XTAA AACN CA AAE  CC AAA "ACOC" "fAC@]A""0"D"8X#%AC _A x,#xAC c AH ##>P#AA AAC0x AA AAA GAD AAl $MAA AAC0 AA AAA  AA AAH E AA AAA <%AA AAH@D AA AAD \'2<'AA AACP AA AAF (ZAA VA@@T(AA AAF4 AA AAF )XC0FIF|<,*AA AAC0m CA AAF *LAA HA@ *AA AAF AA AAB (P/C@FR A (|//AC E a CA8/AA AAC@CA AA00?C HGl<P0AAC CAC` AA ACF @D`4 AA AFF CA AAC h ?6AA AAEP AA AAB p AA AAD M AA AAG ?AAC0{A<@0AC AAFR AA AAF $TFC@HHHH^$|hFfC0HTV C $GC PHHz C @HuC HPL` A w A q G  F D ę \ o0 ' _ Ԕ oooXb _  *:JZjzʚښ *:JZjzʛڛ *:JZjzʜڜ *:JZjzʝڝ *:JZjzʞڞ *:JZjzʟڟ *:JZjzʠڠ *:JZjzʡڡ *:JZjzʢڢ *:JZjzʣڣ$   0 /bad-path/X ϳ B L ϳ B \ L k }  K]Bn`K֒I d d   p       K  = z }             CC            E C  A$) 5 @BO U CG h '   z        l     l   h       |         ! P!  !   0"  }   ) Cv: .shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss TThh !$4o4> P F00 'NoXXJ[oj  s Ԕ |ę0w #l\ \  4; 4d&a _ _ _ _ _ _ b  k