ELF04X 4 (444  TTT  NN|"x< NNhhhDDPtd$ $6$6$$QtdRtd NN  /lib/ld-linux.so.2GNUGNUXETXx%WȆ$ a  ߄t.ZUfqXK|R #g>N]8CE嫐LcV*tVgUai OG)o2N]!'PS5  ;  INq`U${ F~c.V*@3Oc:Gh%@!ci[G(mjHjV+/rC]PcywMAvI3Ic\Zu1, |xq @n $hqM  5\q1DAXtqq{> Blq.\q`qdqRxqurpqrlibresolv.so.2__gmon_start___Jv_RegisterClasses__dn_skipname__res_query__dn_expandlibz.so.1inflateInit2_deflatedeflateInit2_inflateinflateInit_inflateEnddeflateEnddeflateInit_libbz2.so.1.0BZ2_bzCompressInitBZ2_bzDecompressEnd_finiBZ2_bzDecompressBZ2_bzCompressBZ2_bzCompressEndBZ2_bzDecompressInitlibreadline.so.6rl_catch_signalsrl_cleanup_after_signalxfreerl_instreamreadlinerl_completion_matchesxmallocrl_free_line_statexreallocrl_attempted_completion_overrl_attempted_completion_functionrl_inhibit_completionrl_outstreamadd_historylibdl.so.2dlopendlsymdlclosedlerrorlibusb-0.1.so.4usb_bulk_readusb_clear_haltusb_openusb_find_bussesusb_initusb_get_bussesusb_control_msgusb_claim_interfaceusb_bulk_writeusb_release_interfaceusb_closeusb_find_deviceslibc.so.6_IO_stdin_usedsetuidsocket__stpcpy_chkmkdtempfflushstrcpyshmgetsigsuspend__printf_chk_IO_putcsetlocalesrandstrncmpstrrchrregexecpipe__strdupshmatdcgettextconnectgetpwuidftruncate64mmap64__read_chkstrncpyforksigprocmaskregfree__stack_chk_failshmctlunlinkputcharselectmkdirfsyncclockabortstdin_exitmemchrmemrchrgetpidkillstrspnbind_textdomain_codesetstrftimechmod__assert_failgmtimestrtokstrtolisattyexeclpfgetsgetpwnamcallocstrlensigemptysetmemsetstrstr__errno_locationrmdirtcsetattrmemcmpmlockttynamedup2clearerr__fxstat64__fprintf_chksigaddsetputenvstdoutfputcfseeko64getrusagefputsmemcpyfclosestrtoulstrcatumaskstrcasecmptimegmraiseremovenl_langinfo__xstat64getenv__ctype_b_locsscanfregcompstderrsystemsetrlimit64munmap__snprintf_chk__memset_chkgetuidstrncasecmpfilenofwritefreadgettimeofdayiconv_closesigactionrenamegeteuid__memcpy_chksys_siglistwaitpidlocaltimelseek64strchr__vfprintf_chkmktimeiconvfdopenqsorticonv_opentcgetattrsleep__ctype_toupper_loc__strcpy_chk__ctype_tolower_locfcntl__sprintf_chkunamememmovefopen64ctermidbindtextdomainaccess_IO_getc__strcat_chkstrcmpstrerror__libc_start_mainferrorstpcpysysconf__cxa_atexit_edata__bss_start_endGLIBC_2.2GLIBC_2.0GLIBC_2.1GLIBC_2.3.3GLIBC_2.4GLIBC_2.3GLIBC_2.1.3GLIBC_2.3.4      0ii Fii P=0ii Zii P'si dii pii zii Fii Zsi ti ii PO`qdqhqlqpqtqxqqrrPPP PPPPP P $P (P ,P 0P 4P8PP?P@PAQBQCQD QEQFQGQHQI QJ$QK(QL,QM0QN4QO8QP4$xUWVSl}EUNjUeE1Mԉ$E@g1ۋu vot'$ׅu$Uԅt$ot uى0ۃu1$= EMEM&o$ׅu$Uԅt߅7f, NFEЉUM$ UM<T$ $}ttUM܉\$ $D$ T$D$D$lE܉4$D$moNftf Ue3El[^_]Ít&M $]MEȍLƋẺL$$= UÈ8t&8uf }Ef uMȉEЍ t&M̋EU $D$UEЉ$Z@ UE)v Ei; $@D$D$Ф$fD$D$$fÐÐÐD$D$t$tfÐÐD$D$$DfrgD$D$ط$e 1$Pg rÐt&rD$D$$pS S$ T qrfrD$D$$ q H$`q )rfrD$D$$?0|Z$}rÍv'UWVS$;< ƍx +t&t#$; D$-<$D$t$$ D$É$u4$b; D$$D$D$L$E D$Ɖ$[4$; [^_]ÐD$.<$D4$: D$D$$ Zt&D$D$L$ D$Ɖ$n$o: [^_]Ðt&D$D$<$|t$$ (vUS]uu1jB t8$$8 wtB 4B fu$ u1ۃ=r먍&'UH]u}9sE׃eÉeÃsEcEc} }]u}]Ð}T]u}]f}V]u}]f+}t&uЉ%념t&t&}\} H}ހ}D$D$ $$u $'UD$]Éu5lqD$6$t$$lq1u(T$ T$(D$&D$$lrT$(u(T$ T$(D$'D$$ET$(u(T$ T$(D$&D$$T$(_VM˦8 $7 $F* ʯ赦D$0L$w D$$D$$T$T hlH\`d`Љ$( 00؊$tD$ D$$($ tD$ D$$P=v P=v ̉$ ..=ML$<$ D1ۣU$$$DŽ$ADŽ$D$4DŽ$$D$ S $ F$#=M===z==Q=a=Rs$ D$$p $i8OT$ D$>D$$tt $]8 D$$w1҃‰փur̊DŽ$DŽ$$=ԉtD$$A$+4 @gD$,P9D$D$$0 $Ԋ ԉ$ 8 D$1$wÃf8 5D$$wH$ Dǣ$|$Ԋ a$1 $D$8t $0 ËD$D$$ӥ$HD$,D$ "D$>D$$訥%,%0$HD$/D$ D$D$$j$HD$/D$ "D$D$$? , 0 d$ N$ 1;$  D$x$ lhĈ ,rD$$ D$$T$j s$DrD$$ D$$X$ D$lXI$ 8)'$D &$D %$D,$D+$D*$D$$D#$Dy"$Dpc!$DZM $DD7$D.!$D $D$ 8D$$1$ $ 8oD$$W+$  E6' 2$D1$D0$D/$D${荢.$D-$DyȉPVȉG$ >t$<1$ tL$4T$$3$ $ $ $ $脨$ D$$_ $`s$ $'U$ D$$V_ $'1$$$  $$! $ $! x$b! x|$ 48m8D$@YJ;$ *$ $HD$D$ D$D$$趞 ,$ D$$L$m $ D$$P$N $\@$ D$$P$! t$ 8dGxU$ tDx$ x|$ ɉ$) D$= $ ǃ $ $cD$$$ 5Њ$ߋ$ v\$$'u$ve< h< u]f< X< Pu1rT$<$D$ u$ $ $ $ $ $ T$L$ D$p$ L$P$H\$D$D$ $ $C $A$ 8H$ 47Ċ(Ċ Ȋ$ <$m<$D$ 5Њ1҉$FƉ|$$3u߉ڋ$FBF$ 4$  `QB3$ $ $HD$D$ yD$D$$譚 $$ % b`D$$HT$D$ Q$D$2eD$DXI:+$  D$W$ $HD$WD$ QD$fD$$g$ z$2 i%]|N|?x0x!$ $z$2$ $r$qrr$  $D$ $ D$$W $D$ eVG$ $ 0$ D$D$$t$$I $ 1~F91v w Ⱦ!Ƀ9$ $ D$\t$ D$D$($-M$HD$D$$t$\$$Z $ D$D$$$$HD$D$l$t$\$$ X$ $]s  q$ P`$4󥋄$ $D$ T$D$0$˛$HD$D$$t$\$$( $8󥋄$ $<DŽ$<$D$ D$,$$$L$& ,$<YL$ 5rD$$ D$$X$ $\@TrD$$ D$$X$ $\@W ~$ $G8g[$HD$D$H$t$\$$t '$H\$D$D$ $ $:5P$$ $ $PPLLTTqXb$ QD$xDD$T7@LHD$hD$h $~ $ D$dĈ<$j$ 1u$ D$$vQ T$ C$ 1]D$|,$ D$$-Q D$|$ ${^p$ l$ h$ |3T$(?T$(t&| DQu4$ D$td$ $m D$`L$ $U $1$ $: $ȉȉȉȉȉ  x|ЉLH\`dȉ%x|ЉLH\`dP%D 8$ DŽ$$8!$1$蕻\$HD$X#$1x脺ۋXu9wڅ\$Ht9t$Xv$D$D$$船$ $$lD$ $zHq$HD$4D$ D$HD$$$HD$4D$ "D$HD$$%,%0$ $HD$D$ D$D$$蔍$HD$D$ "D$D$$i%,%0$HD$D$ D$}D$$+$HD$D$ "D$}D$$ , 0%$ 8D$$܉ $HD$7D$ D$D$$莌$HD$7D$ "D$D$$c , 0$ 1蒿u$ 1$ nQ$ X;v$$ $ $t7$1 DŽ$֍v:t&$1Ȑt&$H$볋$ $虷$$c $$1 $HDŽ$DŽ$$M$ $ $DD$8$E$D$D$$wE$$D$ ƲD$D$$課D$D$$莲D$D$$rD$D$$$V$ $HD$D$$t$\$$g $$$ $ƉЊFF5ЊZ4$\$ D$tfZ$ T$tD$$!D$D$$$`\$$ $ D$D$l$,t$$踲 ;$ D$z$輂  ̉ $ D$D$̧$ʳt$$& |$, D$D$l$蒳D$ڼ$ $ NL$DŽ$P$ $ ؉MD$4$Ձ  &$$ L$8 $ |$x$t~$$ $ \$t$D$6D$D$ lq$%$qD$D$D$ lq$=R|$0t =X$tG=؉t4D$D$[$D$D$$舰 ؉u= = = $w |$h t t t  t t Ȉȉu $t@$$_H$$ H$ _$t8$ $|\$${ \$|t|$tt2T$t$3L$t $dB d$Ud|$`t2D$`$|T$`$`  `${T|$\t2L$\ $^D$\$ $3^D$t8$${$ $ $1{=U==v$D$D$$l$̮ =v$D$D$$?$蟮 v$D$D$ $$n t1t, D$D$L$Ӯ$c 4tD$$躤\|$pED$p|$PD$ptD$PD$$脤OT$pD$$h|$LtL$LD$ $E$t)$DsV#db=#c)#$辫 l=hu d=ȉtQH9\D"`"dt D$D$$7V"|$Dz|$@$DX$u =u=t$Ds!=~ $$D=vq= =5|$TS$PE$P‰$\t5D$B$D$Ķ$\҉$\uҋ$P$ $LDŽ$P$ |$|DŽ$Lt D$|$9N1ۃ}t$t=rt $D D$d$D$t2$> D$D$Ь$ȫt$$$ $D=/=/c&s=O="DŽ$\$\*rD$$$D$ m$}uЋ$D==(D$$\$Fn$D$' D$D$h$豪\$$ $<,$$` >1 &-ɀ `Ƅ `utr< <,ut&v< <,u1D$ D$$|`Ƅ`u$c F$ 0Ѐ`t 2yj:UD$D$($$y t&裤$ D$D$$$ۨt$\$$3 $WD$D$$裨$T$$ D$4$3w D$D$$H$訧 [$ D$$v ̉-D$D$Ϻ$$Q D$D$$ȧ$( D$D$$蟧$ D$D$»$v$֦ FЊD$D$$@$蠦 S=$t!6 =\ =g =%=&}~!D$D$$Ȧ&$  "!$5 $1o$ =@$Du$Dt$$:t$ $xD$薥 4$! $X$O $TDŽ$X$5 DŽ$T$~$ D$D$H$蹥D$˼$A D$D$($舥$ =|$l=D$D$$<$̣ $DD$D$H$ D$~$蔣 =t4D$D$$פD$~D$$' =؉$D$DD$$聤D$~\$$գ D$D$$L$謣 t 8k@L$d1}L$$, $AD$| D$D$@$ã$S 1$a׹~$P $ @T$d$T$c=+f=&~d&KW*c&}~!D$D$ $$ِ$) $o D$D$<=$Dsƒ$ ==}uecc"e$PL $Љ $. $$$ $ d$D$4$fp G%$ D$D$ئ$tt$$Р $ D$$p $̉ULe&s$DŽ$\j'$\}'$$D$) m$=%=N%=}~!D$D$^$jm$u/$ $ t$$qD$藟 D$D$ة$$n cD$D$$$E sD$D$,$輟$ D$D$$蓟$ = = DŽ$\$\%rT$$D$D$ mEuԋ$D1= = D$$\T$$h$\$& D$D$$͞$- XLi=ET }~!D$D$$`c$T$D$$ $֣ t$$̮D$肝 $D$ $l t$D$$l $i=sl}t!D$D$ξ$蚝蝼$D=DŽ$\d=D$D$ $0蹝 == Q}u!D$D$$ËE$$\DŽ$\E}|$4$D$舶 m$== =$M1҉D$ D$E$L$$4=LDŽ$\$\*rD$$$D$ m$}uЋ$\$$\$ D$D$$ƛ$& "$ D$D$ئ$薛t$$ D$D$$R葥}|$T $Lt $L$\+D$D$$>$\$\u=d<(<Ĉ\= =t =D$D$$oD$.\$$Ù T= v=j=B}t $$Ë$T$D$$ =,f='wk=%+=&} $$U%E$Eu]="l%t&==*] vP}~ N1}t $$腐$u D$D$ ]=(}t Un%=/=-=.}t {買zD$D$Ы$脘$ D$D$$[$軗 D$D$$2$蒗 {D$D$$ $i D$D$:$ǚ É$]iD$$՗ $} :$D7$D蹴!D$D$$l!H$Dø x oD$D$ $t$\$$裕 ~o=tfvS<DŽ$\$\*rD$$$D$蒸 m$}u =$= $D$E$<F$ $SD$輕 )D$D$`$3$蓕 M&J=1s2}t rD$D$$ =2ER  譴zD$D$ة$脕$ E$$\DŽ$\E}tD$$D$ m$׃}t $$\$$\$ $}411DŽ$L賳it$$M¡r$T$(D$T$($B 1҉jw$$ )$E؋$ t~$$b $ucD$|$$i=$7rD$t$D$ $$謖Y=r$ D$Uj$1D$ D$$}~$$D$ D$@$1҉$qEbUGr$=D$觘r$=D$蒘o}t пű$跚É$]$e rkh$:W} gu$8*$^E$EtX}$ڋrm$؃}t6$1ҋNE$Eu-11$D$D$$蝑\$$ f1ۀx7 }~ $s1}t $$J$$ D$D$5녃}~!D$D$˽$ }DŽ$\$X$D$D$ D$$TL$D$$\$ t&$ $D t$$D$ $\$豩 N1у $6 \$$\$舒QE~BD$D$$"D$D$$0a =zȉLDŽ$\$XD$D$ D$$TD$$D$$\$ߢ$ $ t$$D$ $ D$D$Jx$ D$D$/Y$\$/$\$+4$Ga$$T$D$P4$ 1===c*$\D$4$0 D$4$ YD$D$ Ë$\$D$$TD$9K$ $\D$4$ŧ 듃}~ 1}t $$JD$D$$Fٗk$VDŽ$\$\*rD$$$D$ m$}uЋ$\$$ $D$蔌 Et8D$D$$$$D$D$@$C$詈Ƌ$@$- D$D$$gt$\$$迋 ,DŽ$\t+$8trD$$\$T$ $\$ag$\$2 $D$D$@$DŽ$\dD$D$cD$D$Xg8DŽ$D D$D$$T\$VøDŽ$Dd$faøD$D$$G`$Vø͸Dٸ:0(}~K$D$ D$$5)u }IY}u8D,$4É$$ m$}uDŽ$\$\*rD$$$D$詫 m$}uЋ$\$X$\$٢ v$D$ D$$+D$$@D$$ʲ'$D$E$ $ $lD$ $n| D$ D$Ë$@$蒈D$ D$Ƌ$@$nD$\$ t$$D$fBD$D$r$b r$ D$0rD$\$$a $W} }$D$ D$@$·D$ D$Ë$@$誇D$D$ \$$D$AD$rD$$Ua }S$D$ D$@$<$A묃}$D$ D$@$D$ D$Ë$@$$@T$D$ \$$D$@D$D$r$` r$ D$蝌$@D$D$r$S` D$D$$蚆$* _^D$D$$d$ D$D$($>$΄ $`4u;$Dcu"$$ $7 $D$D$p$ͅ$] $Q"}t 謤t4$ -$' D$D$Do$\D$D$ $D$$TD$CB$\$T r$TD$D$ D$D$$BBE11ۋ$DŽ$DŽ$$d<1$T$()$$L$ T$($T$($D$T$(DŽ$9$1҅ƒ=,$$71$oD$ $#$t $D$$R 01D$:$yR uJD$$贀rD$ :D$D$$跒 $ D$$R u/D$$$VPg 褒$ 蠀D$0$Q u/D$7$ T a$ ]D$C$Q u4D$N$pS  T 詑$ D$^$MQ D$e$`q ґ$ D$q$Q 5D$$= q `q $ D$$P u/D$$~}C$ ?D$$wP $4D$ 4$~t"t$wD$$~uȋ$$@$^؋$DŽ$\$\*rD$$$D$芢 m$}uЋ$\$y a$9 D$D$ ǃ1fD 8=r${$qr${$Tlq${$7D$D$T$3$~ kDŽ$\$\*rD$$$D$l m$}uЋ$\$KC$ D$D$$Ë Њ$$D$$|$1򮡠rT$D$ :$уL$x $:|$rtr~ !%tDJDr)T$D$;D$ :|$$褌 t$;*|6u$ |$I$$u'D$$&M D$$]{rD$ :D$D$$` $ {D$$${Pg f$ b{D$7$z T <$ 8{D$N$zpS  T 蝌$ {D$e$z`q $ zD$$kz q `q D$ zD$$}~ Ù1}t $D$D$$誹g}t %腙D$D$$y6=Fȉ(RD$D$ĭy$uu}~!D$D$ҽ$yD$$X$D$h$ $d t$$D$y }$XD$$D$E$uW}~!D$D$$[y^}t,1у $ \$$\$d{$T$D$D$D$$\D$ T$$?W$/ $D$/x :DŽ$\$\*rD$$$D$h m$}uЋ$\$S$\$蘑 5t$$ʹw f}D$D$$ x#YD$ D$D$$w$Mw UVSÉЃ$D$ $D$ $D$ t$$ [^]Í&Uu։]Ɖ$D$l t$$` ]u] U8@]Éu΋M}T$$ u@0 w8D$$ B]u}]Ðt&D$$ u؉D$$ uÉ%D$$q u뎍1$D$N ]u}]Í&T$UM$ UMf=v~tK@V9w]9ˍ4)ÅtPVK=u~/ B JR  ЍK9ȍVv&$c UB;ErdU+EB1},[^_]Í&Y9wT)ÉT$U\$4$hU)UP,1[^_]ED$ D$oD$)$~c'UWVS<} uE\$t$$|KwAu$U\$B,$IM\$A0$7Cw$$E8U F= Ew =҃CEw E E؋EMy,OML1;vA <$U؉MԉD$0 MԋU؉ljEOMVTX Ut$$T$ dEEx0<[^_]Í&Ex0eM܉U؍ A Mԉ$c MԋUEljEOlUDUP UP U܈X P VP Mt$$L$vcEVvMy,<[^_]fM䍖A@TVAP X t&U @=t&MI,t&Et&E8thU t&UEPfUMABAM $*‹EP UMh U9wUJfM!t&Mat&M!}D$D$$)!a UWVS<]eE1u܋CU܉U݉UވEߋCD$ t$D$UUUE$^C D$ t$D$U܉U݉E߈Uމ$$CtBS 9wV1E1UUȈM݈ED$ Uމt$D$$Ee3u%<[^_]Í&)Љ‰ljUct&UWVStFE^]E%&ZۋXtyރEuEE E$4y Gt&fvOEUt&OEd$貮 ufD$D$P$gY$X rD$D$$>Y$X IU$^ G@D$D$$Y$bX EU餯 t&UWVS<}UEUG GurE<$D$;Vu}uMW)ucD$D$E $ uzGut}u<1[^_]ÍMD$G$DL$ D$Y kt&T$WD$ E܉\$T$$xfY Es$LY <[^_]Í&GtD$$QW \$$AW UWVS\EU u^Et11u U\[^_]Í&$8 ~ljÉFqD$8D$B$I[)F $ FG1MċUKS NtTfD$$HV'Ksk{V tL9vHuF)T$FUD$E$ U9<9~ ~{SCD$C$D$iW 4t&FPEUԈEٍED$EEEEU$$8\ ljÉFhPvt$T ~D$ 8D$BD$<$STF $ 1 FMčFUKMV$L$\[^_]fV$1h4$EҋE\[^_]Ít&{1D$ ST$SE$T$U EKV)ʋMET$$DU E11&F8Ff1롋V |$EL$T$ $^U {EpvJST$$\]S t&D$ 8D$BD$$RvD$8D$BD$D$D$ D$D$<$W$O$ FF$ FMEVMCFL$$$:S멉D$$vR Wt8T$$JiR $hR D$D$$S "t.E묐t&USEMU ]xQB!|t]UE PNM[]R ft3D$D$j$R &B볍&]UE 0VM[] u[]Í&'UED$ D$E D$E$)Í&U]] uuC$b)¸t]u]Ðt&$(, @$MSPSD$T$C$gt#ED$C$C]u]ÍvCD$E$ؐUWVS<}UEUGGurE<$D$KOu}u MW)ubD$D$E $% uyGut}u<1[^_]Ðt&MD$G$L$ D$Q kt&T$WD$ E܉\$T$$8vQ Et$t\Q <[^_]Ã9\$$fO UWVSLEU MYEt11u ]L[^_]Í&9$0* UÉBpD$$D$U<M1A $$ UBCEċMUCKBEvUɋB tG9sCuRU)D$MB $D$ EиEEč42sEċuĺD[$[P*4}Ks1Ʌ_]S)ʋM~ET$$DZO EL[^_]Í&ExUEԉEEEEEEED$$$0E MlAJÃv E$L ED$ D$T$$I&E@ $  UBMEċU MCE$L$كL[^_]Ðt&U>EP$1ME $ҋEL[^_]Ívs1n&Ktqtms}t&D$ ST$SE$T$M EKCD$C$D$fM 1B Mĉt$$D$ L$:M sy$k K K$N$O MAA$: ]CEMUCEL$ك$N$NR$ ]CC$١ CdD$$8J D$$WJ $hJ D$D$$K Uu1]t2 $蟟 SƋCFKFT$$L$K]u]Í&'U t&U(]]}uC $ t+~1D $? 9]u]}]鰠 C $> ߍvUWVS]C$( ti~1D8$> 9C $_ C,$T C0$I C(t@$7 C($, ][^_] t&C8$M> 롍t&'UWVS,]Eti;t0t& UBpS\uNjC`tD$D$$5H t&k$՜ UkK`B\S\L$$T$0IE[^_]Ðt&$蜜 Et&UUE JHJHJ HJ!HJ"HJ$HJ(HJ0HJED$}D$ F,$a1ɉ|$D$EȋF,EUMUԉ$gaM|$D$…EEEЋF,U$=aMUNjC<EMMt $] UEEԉEEąEC<cHED$D$F,$`t}uKCHUCHT$D$F,$`fu[8RcHIftCHCH먍&C,t&$8<8{ pt&C0\[^_]ÐDU$蹍 UEEҋUC0>0/!>0v)>0C s t&$s  s VD$:$U=EM1U9U]t&>9v\>$,D$uFs  1s  ht&(]8}]uދ]<$E F 9wu E])P t&D ~ C D$D$4$" CU}ۉt$D$ <$Y= D$D$<$9"C D$D$4$" C ~x f1  lC14$ D; u pC (51v4$ ;D; u 1U뤍v#t&'U]]}t S1׹ C<$0{@t ]}]Ív]}]]u U1ux}]]EE$.1EUEEE̋CEЉ(4$.ۋu]}DE]ÍUWV1SÃl@HUSMEEU]ԍ&UD$ MBDL$D$B<$L4Ez MԋADt yH pEUԉD$B<$/EEMԋA@8 UT$@$M $EUԋEMԋRAUċP:] MċA8 }EftnP}ЉNj guEċRU̅u+vC8upỦt$$tu؁~8C GuUċMB AUԋB MEY4y؃uȉكFE# O9E+ Eԋ0@,Wtt&F6fuj @]uE1҉]Ш@tGFDD$A$fUЉ\$$T$ D$[ ƒ@MЅ]ԅDFPBXtU$UEU$-U9BXs,t 3E}ЋG?uuԋ}Ѕu t&?HG8 u@HuP,t݋xLE3&EЅK B8uH9t‹uMЉ<$d}Mt&$ tp ƍ@D$G@$ rAVM t&tz9PuN9Hu@t $< E4$p ECUC}C$acMCK0ȃl[^_]fM̋ \Eԉuԉl$z $D$ Eu[UԋB$cMABu5E$~ D$D$$X\$$ Eĉ$bE둅MV:A9ƒ@tu u̅G@X0V5@8 @EW1jD$F@$$,D$ AH F#D$ LD$ D$$\t&F@$$jo ƋG@$D$D$$EUt$T$$ 4$n h]̅Dω}EEutW:t=tS;:t5uUu}duƒ@]ىϋMrɹE@V0t$s rt&Ẻ$D$D$8$\$$ $Eǁ=rG$k UԋMЉPƉx@ |$L$$0rr5rEdCUĉEԋ@Ũ8yUċ}ԋB8C]&~?tWGuM̋X9}ԋp$t$$OEԋXt$$#C?uMċ] $<_EV($! H($ @$ qM̀a WD$4$ $[D$ @~$<U;p=c>$e (x$@ EMЉD$$L$% @(]ԃvEȉ$t $ND$ }T}EE A5rrF4$j -rPUԃ:}1z $c @f$A }E6uvE5V UMЉT$$<L$ $ @$d @.Uĉ$\ ЉS1Ju:9UH]U=҉n$Z @T$@ 볋Uċ@EЅu_tYC8upMЉt$ $u܋EЉt$$UЉ$_t$$CD$hD$U $ D$ D$9 D$$>!D$ D$3 D$$ D$ D$2 D$$D$ 0D$f D$$ D$ 0D$ D$$5D$ZD$$ D$ LD$ D$$lQD$)D$ $ D$ 0D$e D$$D$ LD$ D$$t&U1ɉuu}}]@uE tt G,U r؋u]}]ÍvUWVS] u$itc &tRC8 u@4$D$uߋC@P0u@4t˻<$xY[^_]ÍGPBMt 1<щ$艐ʼn$1$`D$+ 멉'UWVSBu@u x8t݉D$E $eCC,1[^_]ÍvC $uFCCC t@C$CuyED$C$S Sh4t&C$뾉U$tR U$A UCC CCC$& C U1ɉWVS<]5rFt}tr9Pu{9xuVD$Q V $UUt$<$D$ T$D$D$D$<[^_]Ðt&6ru\$$ru B$tP $Z<$D$ D$D$D$<[^_]ÍUE]u$$$D$D$ $Q ]u]Ðt&UWVS<}E_5rt~Ftq t&tb9Pu 9HuF$O ÍF D$FD$GD$$D$ D$D$D$<[^_]Ð6uuu |$$ u EQ$O ËGD$$D$ D$D$D$8<[^_]ÍU1ɉWVS]5rt^FtQ t&tB9Pu{9xuF$N VT$ÍF $D$FU [^_]Ë6uu\$$&u vü$KP $} [^_]fU(ED$E]u$"D$ËE$D$ $O ]u]ÍvUE]@<Ðt&U tP » uÍ&UWVS&E$%;tD$$ tD$$ t$ M D$$ ul 7 t&CtA;3uuCW$T$puԉH[^_]Ív{0D$%$0 u {D$S$ u\= D$$ u 2D$ D$D$$rGt /1EU‰WVS1ۃ,9Z ~~t9Z 1,[^_]ÐD$FU$?UDžCu 뮍&4x>uD$F$ލ&'UWVStE_ ރx5 t&x ;uD$C$y[^_]fU1WVS/D$/4$4$D$1ƋE uE-1ۃ=puËE̅D$4$ۿ MUE K<$3U D$D$M$\$t$$E4$mK <[^_]ÍvED$:$M1$L$fD$4$ D$ ED$D$$<$1ۃ=lu&D$/4$D$4$t3tuutu4$D$4$l/4$ EED$$3 t$$&Eԉ$; Mԉ $ 8MED$4$L$Z`u'E m]rǁrǁrrM`uJ Ulu1vu<$R D$D$M$r\$t$$t&4$I t$D$$/#vpu1Z&U<$UUȁWΚWM$L$%E Edu]dufD$14$v$?R4$tqÉ<$/$0D$D$$\$t$$Zt&t$$p@4$cd <$tc=t/$11l t$ D$D$$q` 6D$D$7$ht$$UWVS,$ F E@`u(Mr1195`u~Z8u{uK}}G EOU܉D$ $LGUt)}95`uEhux E,[^_]ËE$=F EE,[^_]1D$ cD$YD$i${KvUWVS]t^hu~]hus ~01v9{ ~~uF$9{ ][^_]E [^_]D$ UD$|D$i$U1UtBx;B }D8t'fBx);B MD8uً@$tÐ1뷍U-SUM u []Ít&Zx;Z }\tӃt0ʉM CE[]U]]u-u]u]Ít&Cx;C }ߡ1uԉuNjCDu#멃uU T$@$J܍U(]]u-}tcf1uW{x;{ |{x?;{ }:u-Tt2uE D$B$Ɖ]u}]Ív'U]]u-u]u]Ít&Cx;C }ߡ1uԉuuNjCDu멃u@$㍶'UWVS,`u}r195`u~ju{uC|$$'tӉ$K D$D$ $EUT$$95`u&,[^_]Ð&U-WVS}t>G1G &9w ~%{uC$t[^_]Ðt&1[^_]ÍUWVS]tp$xuW5dut}Sx:{ 9~3BL 9tOT(v9~ 9t3yC$!t0[^_]Ðt&-[^_]ÍvC $t1ЋCxD;C }?LuD$?D$$ivtP҉ЉSx9S {A$MuCӍt&UWVS]u}Kx9K ~zu!D$1D$$it&t K뻍E |$ t$D$B$t6uSS[^_]Í&[^_]Ív-[^_]ËK똍t&'U WDeE1UЉET$E D$ D$$Ue3uD_]=t&U WDeE1UЉET$E D$ D$$Ue3uD_]t&U WS@U eE1]ЉEE܋BD$ D$\$EE$Ue3u@[_]mt&U WS@U eE1]ЉE E܋BEBEB EBD$ D$\$EE$Ue3u@[_]UWVSÃ,UM$$@< \$lj$f~$$< \$Ɖ$t.tmp@$?4$|t@Ub$Et+UE:0,1[^_]Í&4$ Z UŐ$D$D$$S\$t$$4$= <$< ,[^_]Í&'UWVS<}EԉUE&ED$|$$ 1C8 t׉D$Eԉ$rC8u@1t <ۃED$$g ED$$g ED$$tg Eԉ\$$eg M$f1<[^_]Ít&$pE D$C$mD$g<[^_]Í'Uuu]Ӊ}EMt)T$ D$D$$T uF\$ D$D$$aT u]u}]ÍD$D$<$<$D$D$$UT$$D$D$$\$$yD$D$t$$U]u}]ÍED$D$$D$ mS UD$D$$T$ JS E$׫U$T$PEȊD$E1$1$U$T$D$=cEUD$$gQf%$U$T$D$ ED$UED$$T$VaE@$QD$D$$#U|$ %\$T$$oE$t Uh]ӋUuƋE }M̉UĉEEED$$t]u}]É$V EEuz} $lD$D$$>t$\$$E$7 E܉$7 ]u}]ÍvE$M܉؍UsEut}N} EЉ$'\ 72$$\$$D$BfE܉$ը|8$?<NjE$ϨE<$ E1]ԋ]Et&UD$T$$*GD$E$ltɉ$? D$G$mD$E$p vEЉ$Z 8E$Z ty$$M$D$E܉D$ŰEMMRUЉ$Z ME܉$l&UًE$UEUD$ D$D$$9<$> \$$D$ E܉D$EЉ$Y ]cE$o fEUĉMD$.D$ET$ UD$D$$e8Mu}iUEЉMD$ :D$T$$7M$> U\$$T$D$ 3ED$ SD$D$EЉ$v8$= \$$D$ E܉D$Fv$P E&D$D$$\$$E]ԉ$X Vf$$\$$D$;/$D$D$$t$\$$D$ :D$9D$$xUVSÃJ%t# &t;Pu;Hu[^]Ð$ 1 PVPV [^]UWVSӃ,t:u ftt(Sut$B$$Ku؃,[^_]Í'UWVSuu} uu(t"Ct$$#tE1[^_]Åul4$$I0 t$Í@$`1CuCC CxuutE[^_]Ð4$H$ 0 xuD$vD$$&U1UtD$$Ít&U]]uu t:K…8u)$8 0 1҅ƒuP]u]D$ jD$D$$US]tBu~?uC0$0 C4${0 C $0U ][]c0 v[]D$ ZD$D$$~U1Uu]f]JEÍt&UWV1SE ut~$t Cuu[uu OtB$RtC uD$C$u C uō&u [^_]Ëuu t&t$t{ tC$dw uC ύ&CD$$볍v{<$mp C|$$CD$$&t&'UWVS<] }t E GtU$ M EtNW GT$UD$$-g tqG $/D$E$R <[^_]Ð_ D$D$$<\$$<[^_]Ív$1*, @G,$EEEEEАED$ D$\$$2hW,JO, t qc u>MtUB8$CCEbf$@U܅҉ED$E܉$tDt?t:t5 t&$* @vEE;G$űUJÍv$$茔CfUUjt&SB PKA ȈUЉƉ$E܅1E Et; uEP:E܋U $$+ U$eP <[^_]ÍvEE;G(UJt&$ 4 $D$EЉ$@ZE܉$$e$-+ U$O G C@8JC@ ˆt&ƉW,s&'U(]]u}CC,u%D$$C,C $,O C,SC M D$ s{ t$|$C$u-{uxutU YCCC ]u}]Ðt&]}u]Ít&$`3 $<D$`D$BD$$BfU(]]u}} teCtspC $-N C D$ D$D$C$uCuxut]]u}]ÍCuu܉'U(]]u}SC,u%D$$ C,C $\M C,1ɋSC D$ s{ t$|$C$uCCC ]u}]Í]}u]Ít&$1 $<D$D$"D$J$v'US]tDC C$L 1C CCCCC []D$ D$iD$$v'UWVSEU MEeE1EUL 1Džl1Džp1DžxEf; w$`Ev{EE$9uwΉxωlUR҉UMA A A  MIDžht}$\ M- E1ҋu$t"9v1۹8uX $uޅ Mq04\$4$ EE$UDž\Dž|DžPBDžTHvUMED$D$T$ UL$D$B $)EEčPt vFpEȃ|҉txhEEt=|uMaMUEL`UdU E-Lt ELl>}MPT}AAQ A\|UB$1}E\B(Mĉ $PH$Ue3Ep [^_]ËE@D$@DDžpEf$EtEEE$9EU1ۉ$菋Eu ttɋu}й ufEu ttu}й ԋUutzEU9P kM9H_AfUMMdIMMq i^HdM}E1Ʌu+gv< \)ME1Ʌtm뱋]utUM9JgD$D$$ t pEȃ|ExDžtEEML$$衿Mĉ $衉UMDž\Dž|PTEDžtEKtML$$ U̍]ЉT$\$$Ẽ&uEMȃ\EMDžtxu"|u^}Džh EM8hH%UR 9P勵`1ۋ}t&FtUML$T$V$Ѕu $9w;]~E1ۉ$RxuUUU4$ UB4$ $ MA01щ $ tu*u t/Սvtu uEH4ADžhDžx}MyL<qM1ۃ9k:tU9:9>u+U T$Ut$$vUvtu)} 8]1 tt8u9w9Eq} u< t u9EAU̍]ЉT$\$$ẼuE}^UEPGDžl1DžpDžxEt;}t5E8PL1Md t8uM}zYfk1tEUB $}A MEA AA1у9EL$t$$;HDžhUdt$T$ $OMhA=|uu…tzuM9tBtxu x|uEx‹BMq UB$: MA YD$D$$\$$EE@D$ D$D$$)SGD$ D$D$$@#BEE@@ED$D$U$/R1vUWVS|eE1EEEEED$$ U ׉U1E D$$EE1EED$ D$D$$y1E t PE9Et$c> EUE$NjE$k EE$Y E} t E$MUE$ ED$$NuFt^U D$D$$fPu<VED$t$$ZE6tF8t6uUE2EQEk29UOE D56D$D$$JUT$U$T$̿U u t2D$D$$UT$U$T$脿Et$e< EtUE$EE$p EE$^ E&Et$Q E$6 E$+ E$ D$$$XEUe3k|[^_]Ðt&D$D$$pD$$ 茾E `E$ EE$ E=&D$D$k$蜿t$$(vBU$Ut"EB$辀Um׃$ $D$莾uƉ$l $D$lut}l菺$$SD$ED$6E$:MUWVS1ۃ,u~$nFD$D$$oD$EF<$D$˗vF|$D$E$ptvD$D$$'$跼D$F<$D$puD$D$$D$$&EE,[^_]oUWVSD>U$T$UT$mME } $D$`M>$L$D$B}9EuN$δ$lj\$t$<$D$ 輖4$4 [^_]f$ $$耴$D$ )D$D$$(D$ )D$D$$D$D$$TѹUWVSLu]W}  F{Ct$g=4$D9U <$至$ËMt$ $ΈD$ |$$D$fL[^_]Ít&ED$ED$4$2ۋ}CpUԉ$fUԉ|$t$T$D$ ED$E$RLÉ[^_]Í<$ز$L$5D$D$3E x$D$D$$*\$1ۉ|$$耷L[^_]ÍU BdiE $*pvM A`t&D$1D$$躷$t&M $խPD$ D$D$$zD$ D$D$$+VUut1u@@@ @Ðt&$ fUUPÍ'US]SPS P []ÍUVS]u?&uut'C 3uC$RuC$ ͐t&[^]É'UEH ]Ít&UU‹uE ]É'UVES]u …u fH;u!‹u2[^]Ë0[^]Ív2[^]Ð&UVUS] M9t6t21r9D‹9tt uЋ9u[^]Í1t&UESU t8u2ft&t.H 9tt uH Yw1v[]Ðt&H t tu1&UEM u tP9 u]ÐUESU ]t&tt@ tu؅u[]Ðt&UEt@u]ÐU1WVS}t91%9tTt3uutS uӉދu[^_]ÍvC$ sC$ 뵋37몍v'UWVS,E} t;1&ދt(9u;tHC tuuuf,[^_]ËSE$rS$O Ef30fUWM VuS]t!ɋ;tt9u v9tЅu[^_]Ét&t9t[^_]Ð9t؋ ̐&UWVS\]G&BxT҃mx0縃vx(漃rx$ɃɃeMH MHUD$$MU܋M|$ t$T$$UԉL$D$ lqD$T$UD$$T$C05?w@D$C D$C\$ D$LD$D$lq$虮S tO?-flq$ D$脵hf\[^_]ËrlqD$D$$fD$ hD$ FD$FLD$lq$~,羃p~@Ƀḃv~0҃⼃r~4|$L$ɃeD$ lqT$D$jD$$蘭vBP T$PT$@D$D$D$ lq$Zit&BPT$D$vD$D$ lq$#2UWVSÃ| eE1rC0 $4 T$C,$MU$ U҉HNHN PH KHCHu-=~$D$D$$蝯$-<$nEe3|[^_]Ðt&N Qw|K,_*,u$4D 4$C,D$JvC,U$ UC,ZfQx=ȉXt&F UD$FD$$UD$ ߲D$D$2D$U$T$2 *t&4$`D$D$@$E9UT$$¬t&N4$|t&UX]Éu։}zj@,tCD4$l]u}]fGEЉ$![EtuG$x)EC0tut{$4 T$C,$KeC,$ C,ND$D$R$UԉT$$sQED$GD$ ED$D$D$D$$ua‰C,EBOB$輫&D$D$$$(|$$脫C0MD$D$D$D$$߫UЉT$$8F$ C,ɍAv3MD$D$\$荫M̉L$$QD$D$M̉Uȉ$q\UȉEԋBD$BEЉD$Eԉ$]ED$D$$]GM̉D$D$EԉL$ $aEԉ$,]M̋UȃJGtBUЉ|$D$$T$vUэUWVSÁeE1ۉU5L&KC $Jj$, SDƋC FT$U4$(U $賳4$Eȡ4$E蝣D$D$$EM|$L$M$L$ ML$]U$°D$D$l$蜩E茦U|$ D$T$$<$9 4$fCtuSuEe3<Č[^_]É$D$D$x$EU|$T$$v4$fCmmhCD$CD$ <(D$D$D$E$ML$$At&$ D$D$$Jt$$֦CD$D$ 2D$D$ED$2$语ML$$Urv'UWVSÃ\ eE1UuKsDD$D$$荧t$$CHCH1$)uwC,UD$B$D${{ƃtOS$4$_ D$D$?$t$$EC,$EC,$eC0$*eUe3\[^_]Ðt& D$D$$n$$ =~$D$D$$/$迤L(C,@D$ EċC,D$ LD$D$D$Eĉ$4{,G~D1Uĉ$]T7D$ D$EĉT$D$${,9wE$D$U$4T$nvC0$4T$C,$B6C,D$D$L$ܤ$l&[D$D$|$蟤$$"C$7fUBx I$!E5H4$QD$D$$#|$1$譢D$D$D$|$ t$D$$XC,@C,$C,$Qt:5H$D5`o4$QD$D$:1=uE}ED$D$$/D$.$跡襦'UWVSÃ=81<$D$D$G|[^_]Ðt>,^@HD$$ɹTDD$C,r$ D$vF,t@ A P1tD$D$ $pC  uڅ2EЉƍ,r4$4$E5EF$覂4$E蛏DыMȉT$D$O$L$MԉD$ L$M̉L$賒i1} ^Cuڅu"@x r$ D$ډ붍t&@x 3r$ D$蹚t&<$<$薌EG$臁<$E\$t&XE؉D$<$MԸ$t1UЉB@D$D$?K$jMЋA@lG$<$?M܉‹E؉EGUM<$E词UMt$D$T$ỦL$MȉD$$T$L$ Eԅt r1$:D$t(@8 r$ D$I8@@D$$D$eE؉D$4$)F$ގ4$E蓏NU؉4$MĉUȉEԋE܉EŌDыMT$D$1$L$ MԉD$ L$M̉L$MȉL$MĉL$Ϗr$ D$b=8D$t$$EChD$$t<$蔌D$D$%$>\$$D$:$]莏r$ D$t&tD ,6@T@UD$$DD$ƎCUU ,UOrU$ D$?ULf8D$D$<$ Br$:D$S&vrf$ D$觖f$f蠕v&vD$ D$D$$蜍Ct&D$$|<$\D$D$t&r$:D$Uv8D$t$$@D$$Pvr$T$莕}$茔{&UD$ D$D$$虌CU=u=ED$F$誕á,\$D$ ED$r$w$,<xD$ FD$$D$ <$rT$$蚔 D$<$CrD$D$$D$ 苑4$覈FU$膁U\$D${$T$D$ kr$詎EЍMD$$u5%U؉T$@$߂N1 9MzF9EnEbD$D$<$|>3FD$ FD$E$D$蛊<$D$$D$v*- tC!#r$:D$r$:D$В?U؉T$@$WfU‰WVS,E@Uz(MA $.E [3uC$Rkt֋C$$$x@x @C<$D$xE$e0Ur( t$<$, tYMQ(8t3BtIB,[^_]ÐU$0M1A(,[^_]Ð$EP(R(뻋MQ(1D$ D$D$a$蛊vUWVSӁ|eE1BDžDž@HF4HtiZ?D$1D$$$[Ue3|[^_]ÍHu싕B$JK}$}¸DA $HD$D$$>|$T$ L$$趈1ɍD$$H  DžuEDžAAu/DžBuྃF$zjAD$AD$ D$2D$D$E$诎11t& }Sur獶D$1D$$$ڈ$jt&HU vHt?oQ:cYP:M1 fP:u u9$HӆQ: P:?R:P:u%?Q:8A $蓔D$D$$艇T$$$hzD$D$$¸D2|$T$$贅&BP@P0P4P,PD$4$EC@D$PLD$T$ $T$C@D$PL$T$薨 @ D$D$$T$$螄$0  $S踂D$LD$T$ $>yh = C8 u@Hut =uEC@D$PLD$T$ D$$?C@D$PL$T$/ƅAD$D$$t$$Mq蠁$ D$h$ABTr=$輠t&{1=%C8 u@P0x4H, PtD$t$$00C@D$PL$T$貥D$D$_$\|$$<$0 C@H0)P4D$D$/$|$ D$LD$$0@ $#0D$D$$x(0D$D$$)0 1ҨƒЃЉD$ D$D$ $+b0t $mA?DžD$L$ D$D$B,$KD$D$$]$B~t$|$$"-~$ D$ \$DD$ $-4$Dv  ((t  D$( A D$$AD$ AD$AD$AD$AD$ D$2D$D$E$者$T$ E$L$<$+D$D$$\$$A$|D$D$$v\$$~ A$JB<D$D$05$D$D$$~t$\$$}D$D$$b&`D$D$ $$x$rD$D$$l~\$$|D$D$3o="{$ D$ڃ {D$D$S$}\$$ky9D$D$D$ D$D$$'z$ D$aD$ $k-1ɍD$$JD$4$+$#D$D$$}D$D$$|C@D$ t$D$P T$@$$}T$É$s$9iD$D$ D$$D$t$xDA˃8 ut&C8 ulD$ D$D$$BD$ $-<$1ɍD$$ mD$D$$F{&O|$(A D$$AD$ AD$AD$AD$AD$ D$2D$D$E$B$T$ 4f18EЉL$D$$w1D5Ѓ<$D$ D$D$D$9wɉH@zR@p 4$g|$(t$T$$L$ D$D$ xT$L$D$D$$~1{LэqtA1D5Ѓ<$D$ D$D$D$~9wɋ$D$k1ɉD$$R|u$ D$w|D$D$3$]D$D$$AD$ D$D$a$iJwCA?P:%F?P:6u $pCHu &0$sHuC,CHC4C8C0CLCP$xC,L[^_]É΍&C@ tdt_tZ?ts $[D$D$$Gv$u4$/K4&4$uK4ΐt&C@ @8uC8C$u5 T4$D$du덍t&K8t]C$t;D$D$$u$tK4v4$D$u%C$5D$$BCG@@D$C$A<$D$蟿uыSD$C(D$ C$D$D$C$N$$D$tK4@D$4$E"ttUJzPM׉R:JM:J]}!&PR:Z:JD$$趾uҋ]EPUD$D$$sU҉T$$hrl74$D$Gum]D$1D$L$s$rdC8tqC${LBt=uD$D$$9s$q\C<$) D$ D$CD$C$[1C$K3UD$B$T@=ЉCt#MQMA0={tcExD$C(D$ C$D$CD$C$1K4;$(qK4'UCEVEuVVD0EtTE̅ FH9]1ɋ] f9FDV<9ˉFHMw݋]9FDE9EvMu)t&C0C SS(UB9ƉEvCuS(;S,r̉$uԋE]ɉMЉEЃL[^_]Ít&}* F(FV@NL99uU$?`gUD$UA}0$ `g }$t&    fz=u=V ʃ)ʉV u"F13v%F؋u]}]Ít&    f= F FuсF ffu? NN NЃ)ЉF É؋u]}]Í&1-DfV V 91 f w   g\f둍v G tj te 'f  t& t&t&t&t& NV Nqwt&~V9t?UD$D$$$AU|$T$$o@ۃ 0*v FFF  NV NN~ f ?1 NNs ^F1X ^F1=D$D$($@\$$#@ N^f1OU8U ]]uu}}t.1t]u}]f]u}]Ðt&WuqD$Et$$V1ɉ¸t>t:T$t$U$W1MtL$Et$$ME ]u}]Ív9G눐US]$C$CC[]ÐUWVSD$N$C>븃 F1ۉẺUfF 9Fv0Uv;Fs#  9߉F w1UIUEF T$ UEND$t$$%MɉFuFtxTUӋt/D$ D$ $[} Ft/9Rxt&D$ D$ $[} FuыF D F빃6D$ &D$ID$$<'U1WVS< ЉUE$TDЉUUEE1ۉEEt&ML$ M E܍UEND$T$ $}UEfE+t7UBыR9MD 9ЉAsMD AEUEп  EEЉӉU11EfD9uv#MЉD$ $9u19uw݉U+E̅DE1ۉ$D$ẺD$ EMԀ| À8-t}v@}t9ƹu)ED$-$*UD$ $EMԉD$EL$$螾E1ۋUD$E$D$ EMԀ| pf]ȅt,D$D$$;D$N$ :<1[^_]D$D$ $ UBjD$D$ $h UBR.UD$U$u\MA;AtMD A>D$D$ $ UB͐UE e M1ɋU]]uu}}tFD1t%Me3 d]u}]Í?CC eAKS CL$T$D$ /D1]D$D$2D$$W?\$$2蟗efUAUEt$$D$C 1E9C(S sT$D$ /Dt$uD$D$2D$4$>t$$2 C UCSv1$uS ;SjV$q4;rB 9-A1Ʌtx1t x8X<L$<$D$ D$D$3<$60<HVtQTD$A$Dž}<$/9_|$$@0<$/<fz9-D$Bvz9 %D&4$1fD$D$D$ <(D$D$$2-tIL$L$$* D$(DžDžDžDžDžDžTA@T$${!)Aux0H u1x$u*1ωDž($NjA<$ D$txDžDžDžDžDžDž<$ >xXD$L$<$(릍D$$}))DMo.'UWVSwDžEܸt^D$:<$t|$$"$x!f/E$D$S$U$T$tuU܉E؉$Tv$LvE؃,[^_]ÐUEU E,[^_]pU(E]u}$t؋u]}]ÍUD$$uԋuw tË u$0ۅuuD$D$$UT$$&Pчu8D$1D$$$D$诉8$UO뺍&UH]]u}$ƌ$DE*EԹtluԿt[uԿtJuԿt9tlt uZ$UtUD]u}]f$UtUD]u}]E]u}]tD$D$$L\$$]1u}]É'U8]1ۉuu }}t؋u]}]ÐD$D$&$$z 1$q\$D$ tD$D$Ɖ$"$CMt$$C#|gM4$/s;<$sF$N9؋u]}]Í&Vt$<$D$,,$6<$D $q|$\$D$ 9D$D$Ɖ$2!&t&$1trI UWVS,}E$t 1۾w5E$$Dp} t} E*EE$D$VވP6t&D$$8$q4$_tÉ4$S8-$D$D$$EdUt$T$$E4$qE*$pt D$ D$D$$E,[^_]É4$萍\EtD$D$s$t$$Nx$=t>E_D$D$`$n$0$bD$D$$4\$D$W$EUH]]u1}$tt]u}]Í&$vvٍDEԹt8tt t!uԹ18u$UoU1|n)$蝍tr$o$uK=t(D$D$$\$$E u*$nt&4$`s1אM \$t$ $t&'UH]]u}u,̊u#$+vt;tt&]u}]ÍvD$$@%;u‰$$'l/usr@/sha@re/g@ nupg@/opt@ions@.skef@lD$$$$Ei\$<$/gpg@.conf@f$?z<$$ERUԋ$UD$D$$'\$|$$4$&}]u}]lt&D$D$$\$$`v[$D$D$$\$|$$vD$Cw<$$EcE91}؉EE<$t"1 Ɖ<$wuދE}؉$4$D$D$$|$$hE܅D$D$$|$$5E$D$I t<}9 0 '#EEEDE܉EE4$Df$D$D$$t$\$$~USÃ4҉UxPE$ P T$PT$@$D$ ED$lD$D$؃4[]????C-??-fC??C 4[]ÐU?Uw@]Ít&UWVSlu ]F$~҃EFptU$; UCK9lD9ȉEC4}D;}9ω{GT;9ω{FD;9ω{wD;9ω{D;9ω{D;9ω{ D;{~wNV1EtкE.+fE9UT;9ω{D;{9FD;G}Cu&Fpt$ l[^_]Í&~U1US}ȉ}}}9‰UtgU T;ECLUCE<$|$D$W<$g9uwSCU9uD$D$$!{C}svE1EE؉EE]ӉEDp$žUUD$D$Dp$UU9}\ڋ]CK9UD$D$${CKUkt&MD$D$$MCMfEȉD$Fp$UUȉEED$D$${KEED$D$${KEEȉ$D$ED$t&D$D$${Kt&D$D$$`{^D$D$$@{Kt&D$D$${Kft&D$D$${KUt&D$D$${KDt&UD$D$${KU}t&UD$D$$m{KU UD$]Éu$n\$Ɖ$4$]u]ÍUVSÁ@$71t=CEC ExC|~1ҋL`L9uxQĐ[^]Í&Ủt?r-t#t&D$ D$$T f ÐÐÉ'U(̉Us7BD$ A(D$D$D$${${Ðt&tctD$D$$T ft:RD$D$ nD$T$D$${{Ít&BD$ fD$D$D$${{ÍRD$D$ <(D$T$D$${?{U(E v" t5D$D$$T rރ $ÍPH H H HUP H@  EU$1Í&{ÐUHuu ]]}~tlC(uMS,uF{ w`CPC,C(]u}]Ít&C,]u}]Ít&}u댉EtD$$P @  A A ‰AQ Q Q ЋUԉEЉ$EЉS(S,e$}1tt$C`$S(S,.&US]D$$(][]UHuu ]]}~tlCDuMKHuF{w`CPCHCD]u}]Ít&CH]u}]Ít&}u댉EtD$$P @  A A ‰AQ Q Q ЋUԉEЉ$EЉSDSHe$1tt$Cp$SDSH.&US]D$$D][]&U]]uU}CT} ty`1 T$4$E D$Mu!\$4$C]u}]Ðt&$T1]u}]ÍvB J  J J ȉBJ JR  ЋT]u}]ÍvE䉅T] UU Et H HJ@]ÍvUS]Ct[]Ð$[S҉CtK$T$L$CfS$T$SLT$C뮍'UEPpT$@$fUEP`T$@$tfUE}{Jv'UEm{*v'UEP ]{ 'UEPtɸM{t&D$D$$fUEPtɸ={t&D$D$$LfUEPtɸ-{et&D$D$$ fUEP tɸ{%t&D$D$$fUEP 1t {St ƀ{Ct ƀ{Etƀ{Att&ƀ{ uƀ{{]ÍvU(EtCu E D$D$ D$D$${ {ÐÉ'U( Eu Et&D$ D$D$D$$z z U(Eu Ett&D$ D$D$D$$zz U( Eu E4t&@ D$ D$D$D$$z]zÍ&'U(EPtH uEmt&T$D$ D$D$$zzÐÐUHuu]] }~wMF<CCC E؋u]}]fD$Eԉ$NjEԉ$Q$vT$UЉ|$$KG O  O O ȉFDGO O O ȉFHEԉ$dU>t&D$$F$~uUT$D$FpUЉ$M<$L$D$E>Ẻ$WUD$T$Ft$I<$ƋEt$D$4$W<$tPD$<$@PSPS@ C <$Z$U't&$tU렉$EeUUЉuD$ D$D$T$/&UHuu]] }~ wMF<CCC E0؋u]}]fWD$$'<$E$TiEԉt$$D$<$F농t&D$$F$~uUT$D$F`UЉ$lM<$L$D$E&Ẻ$UUD$T$Fd$1<$ƋEt$D$4$tU<$D$<$PSPS@ C <$at&$lSgt&tSCCC CR$$Sit&$S$RD$ D$D$T$UWVSÃpu @(;C,$*}Ku C(;C,$ }S uC(;C,r[$|C u,S(;S,s$C0C SS([^ _]Ðt&$|[^% _]ÐS0C S<C(S( ;S,rčt&S0C S4C(C( ;C,rVS0C S<C(C(;C,rvUVSÃ@uC(;C,rW${ƋCu+S(;S,s#C0C SS([ ^]Ðt&${[f% ^]ÍvS0C S4C(S(;S,rƍ&'US؃{uuƃ{[]Í&D$D$$\$$(U]Ӊu ƅtt5th{t$ D$$D$$u]]fȺ*)R9tS{$ D$u{D$D$$$D$ u]]Í{L$ D$$D$$G5v'UWVSÃ,$OEtDC0C SS(t!CuS(;S,r҉$yuߋE,[^_]Ðt&UWVSÃ|E eU1҉EċCu C(;C,$yЃ#uIuD{D$1t$$Ue3 |[^_]Í&WB#|$T$$D$t$$融뛍t&S0C SC(M{D$D$$%D$ uvt&{$T$tZCS(;S,C0C SS(PZvD$ {D$%D$$4u{1D$D$$uD$ Xv Ew(|$$#%f Ev؉؉UjNUMEEEC!s(;s,C0C S0s(Eu{tn$t$$t$t$EȋET$UL$ D$ED$D$D$ED${$UȈEMăMP M@0@HHM@H UPM $EE$}Eu {E}nMă} M 11MЉ]ӉMt&D9]UEuD$$D$u{M+uЅ҉D`t{\$ D$P%D$${UĉD$D`D${${$ D$MċD`V$u%!U$euU%Et&MăMPM@L@!HHM@ @(@MHU@D@HPY&Eă}tu11ҍEЉ}ĉω]ӉEUMuD$T$ $&+uЉDp{DpEEă9]ENj]|؉M؃{1MąfAxD$ {D$&D$$$ou1{`ED$n&D$D$ {$5M{D$P%D$L$ ${D$D${$`{$ D$s$F&1VUԉU{Uĸ&z8&D$E‰D${$MĀyLtC]]1u;D$$D$D$ {$FL9|Ћu]{$ D$MċUALM$D$ED$e`{M$PnM1`+M<A5{bS(;S,VC0C SS(UĈB4{S(;S,C0C SS(Mă{A8S(;S,C0C SS(UăB<}t z8eMċQ8G>kҐt&={}M1A4U}$&1M $.D1EALE։}M+U$T$L$WD$ {D$D$D$$MA4Q8$"&11DD$ $D$UMĉD`N1t$1$D$MUĉD`{{D$D$$,&D$ KMfF׉ЈQL=$k3$k%$kL$$U&f1={c$OD$ {T$D$%D$$5&tQE1E(C0C SS(U:t8CuS(;S,rɉ$jԋEċP8EԋMĉA=E؉AAYMċQ8{$S(;S,C0C SS(Uă={BHB41R8={{D$ D$$y%D$ x={Mĸ$QED$ )t$D${$U멡{UD$D$D$ $X(AUv]]11UАD$%D$D$ {$9rҋUЋ]/{UD$D$D$ $G(U]]11UЍ&D$%D$D$ {$09r{{UD$ D$D$ $SM&UEx@ NjEH@ DEи';uWuġ{MD$ )uЉt$$|$&{$=D$uĸ'UM>uС{D$ )L$t$$UEĉU$Mĉ $٨t$D$.(D$D$ {$Ut{UD$D$D$ $( }ġ{D$ )t$|$$4U${UD$D$D$ $h(U]]11UЍt&D$D$D$ {$(9rs&{UD$ D$D$ $(;Up]]11UЍvD$$D$D$ {$9rv"MăUD$(D$D$ {$eED$ )t$D${$U&{UD$ D$D$ $(SU]]11UЍvD$D$D$ {$9r <}ĉU<$fUK<$S$D$z'D$ {D$$bUuĉU4$ $3D$k'D$ 붡{UD$D$D$ $(U&U}GD$D$(D$D$ {$U]ЉӋUăD$D$D$ {$9rωڋ]{UD$D$D$ $'U]]11UD$%D$D$ {$9r[{UD$D$D$ $(-&Ul}GD$D$(D$D$ {$U]ЉӋUăD$D$D$ {$`9ruĉU4$U4$$+D$'D$ EĹ8&D$'ED$ {UD$$U[9']uFD$UD$D$D$ {$U EĹ8&D$'ED$ l'}D$'|$ KD$D$$zUЉT$$;]lEtu}Ѝr\$4$|$:t"15}t}̋M9E$D$^1{UD$D$D$ $'Uuċ}NGv{UD$D$D$ $'pUU(ED$D$ D$E D$E$ U(]]uu }}t$|$C,$t]u}]Ít&}}u C0u]E]cvUWVS^ ~v qMM;]Ht&u>]}܉CE܉{ <[^_]1EUM܉BE܉J <[^_]ÐE$ E뮍UVS0]} F7C usC8@D$ H!D$sLD$D$4$m !%tDJD)S0[^]ÐSD$D$ #)T$sLD$D$4$듍UT$UT$$]tFEuD$$]t$D$ ?)D$렐t&CD$ $!D$t&sLCL[invFalidF imaF ge]D$ (.D$-D$($)UWVSÁ E TMdUu`EL`XeU1҉Hd@Q t $YVCu C(;C,$IM@GG҉PCC(;C,S0C S4C(ω?Mݹ~QCS(;S,C0C SS(Eލ0@&"„Dž\TXFE܉D$XL$$K\ u4;vD$XxL$$K) ddFƍxD$T$$ IuJt&S0C S C(MTL$D$)$h!ЋUe3  [^_]ÍσDž\ӥ\\\1U݉(։)t&C0C SK( Ѓt7‹CuK(;K,rȉ$$JG$ Ѓuɋ\Ƌ(& $ G qD$)$)v t 1Dž\ u Tt&EtTt}PDž`Y)t$ |$E``E D$HD$LD$`D$CP$ $!D$ $d8$(-v|$D$)$!t&/&\t$$T$/Z`v{8҃ ]3   t$$WVAXxt&D$dt$$EcD$t$<$GtϺt&$DfD$)$)[~KS(;S,C0C SS((EދS(;S,C0C S4S(EߋS(;S,C0C SS(\EK(;K,C0C SK((U \  {t:{$t$|$ D$|$D$$|$\t$$L$WB{@t$:tP9 ={sD$t$$W$_dljA{ Pwu+t&C0C SS(9CuS(;S,rω$oBڋd $dBz4$dGApAxu-0t&C0C SS(CuS(;S,rΉ$Aف |$$%*$/dA‰0@@ GB B\J  w={tAF{$t$ D$$D$$2$B oZ ' D$ $%*>{ C(;C, S0C S<C($(dB8@uCu>sS(;S,C0C SS(1u dQB {D$t$$TCS(;S,C0C SS(P1TS(;S,HC0C SS(X{ XNT$dGBHPX`P \HP Td XT`1dCC0C SS(FdT))}9XqCuS(;S,r$>$ d ljA_CDS(;S,8C0C SS( D$$"-$D$t$$R$(vKyS(;S,mC0C SS(D$D$$蟽m$@dBD$ t$D$$Y$d ljAICS(;S,C0C SS(PGD$D$$$ <dB ЃD$؉ $$ CdAKƅS(;S,C0C SS(FG^V{D$ {D$A+D$$L$|,B$+|$D$)$!лdB$UdD$GA${OdBD$*D$LD$ {$蚸$;S҈(E%$i;S҉ƈE3$Q;S҈\EA$5;OD$)$) P$ *xҼXt&D$dt$$;[D$t$<$=t$:{V{D$D$$*D$ ʽ,։؃`B{`҉1YP?D$PD$#D$ D${ZBP$T$ X`1dX'&{$T$ۿ9d3PZvD$ {D$%D$$耶Ë\It$D$ $* CD$$#%D$$#%D$$#%Ƹ$|$$#%螸\$$T$D$bM$8V$8%$8%X$i8%PCk$N8%d{D$D$$+D$ q\ `D$6+D$D$ {$mFP$dBpBBL`tNljXC0C SS(tCuS(;S,r҉$m7݋X``{dBp{D$D$$*D$ pdytSL{$T$t4PZvD$ {D$%D$$³ǡ{D$D$$uD$ Džp+1`;S0C SC(9>p;tp`<CuC(;C,r$6봍F$ dA0QtK`C0C SS(tCuS(;S,r҉$5݋`{,dBs)0d)E‰D$ {D$*D$$hdy!{$T$]tPZvD$ {D$%D$$É$41C]C(;C,QS0C S<PƒC(ҾC C(;C, S0C S<GƒC(ҾF{ C(;C, S0C S<PƒC(Ҿ ={{D$D$$+D$ [{t$ D$+D$$߰$X$薳{t$ D$o+D$$裰{Džpt$ D$+D$$s\pdu*C0C SS(dtgCuS(;S,r̉$ 3d߷u`A($x1P$$_1$.={ F $d{ljACC(;C,7S0C SC(dBpBk1d)C0C SS(d995CuS(;S,rȉ$0ӋCfS(;S,ZC0C SS(GC)S(;S,C0C SS(G CS(;S,C0C SS(G 訲蟲GCS(;S,C0C SS(G { 1҅RD$$G D$ G D$GD$D$GD$$D$ #D$D$ {$[$pSC(;C,S0C SC(TCC(;C,S0C SC(`CqC(;C,eS0C SC(P``1`)‰ЃX$dljATG`PdWO dL%1.K0C S C(L CuC(;C,rÉ$$-$$-%B{DžpD$D$D$ $+̰\pdu+C0C SS(dtg{uS(;S,r̉$-du1$藓$3D$| D$$2$[$3D$gD$ږ͒$3$3D$| D$诖袒$$3D$gD$臖&=Ut]Ðt&1=ԉ]Ív'U=EU u# ԉu U1111>&'UVS]=u uYԉt7[1^1]_&xu&t;t$$4$8?tԃ[^]Ðt&[1^1] UE ]uD$E$Rt$$Z؋u]]ÍUVS]=u uQԉt.[1^]|t&xu$$4$8?t݃[^]Í[1^]t&U=t Í&ԉuy'UWVS,]=} uxԉt51҉ع,[^_]Ð~u'4$B$Z<$Ɖ$h>?t4$64$E E,[^_]1҉ع,[^_]fUWVS,]=} uxԉt51҉ع!,[^_]Ð~u'4$$<$RƉ$踰>?tN4$4$E[E,[^_]1҉عR,[^_]fUWVS,]=u }11ɉ…t>|$$UU$,[^_]fzu+$$4$$EU:?tωUU|$$띍vԉt11ɉqUWVS˃\EEKt&S(;S,C0C SS( ƒ CVN9D 9щV.DV}tMQ;Q:MDQKDžh$hx\[^_]Í&C0C SS(Uu#CuS(;S,rՉ$tUt݋MQ;QoMDQ뿍vuLVN9D 9ʉVu7&ED$D$4$M_VE t&V;VtD VV;VED$D$4$_VE $ED$D$^MEQ&U1׹ T$D$f$ ED$D$4$}^VNEED$D$4$T^VNED 9ʉV $ED$D$^MEQhv'UWVS]E eU1ҋK EMME1Et{ U1Y;&SJJ(;J,B0B RJ(MtJ;J4D J tbt^=U t6| |9ω| |9Ut&t$$d<\ r9w4$ r11$谎t$$H$h7D$萍t;5rt4$$U$؋Me3 I Č[^_]Ít&UeEt&SzJ(;J,B0B RJ(MtJ;JD J tt=U t6| |9ω| |99U0t&t$$K趈$$57D$ED$XrP;PD PUP;PD P Et0 Et$UP;PLPECPkP(;P,_H0@ P<P( U tW||9ѣ||7}-MD$7$57L$Mrv9Er΍vt$<$脑U=}M} nP;PD  PMP;P$D$D$uYUP$ $p8D$pr$ CM$ED$D$XMEJt&K$6$ED$E$褌E$U:}1D$$m8<$<$jtÉ}M $Rt~苅1$D$D$6$蹉U\$T$$ r?&5rM $RuMD$7 $蠇$WD$D$6$)U\$T$$yr&11&$>f$ED$D$VMEJ!t&CC$$$jE CD$C$7kEt&r1&$D8'菇rt&Et&$D$D$(VMP+v$D$D$VMPvru$CD$C D$ 6D$2D$D$4$D$Ct$$ID$ CD${{ D$ D$2D$D$4$蓌t$$Js$E&M=G‰D$L$C$ UtM|$$L$T E td|||9щ|B}8D$7U$57T$訅M $rv9ErÍvEt$ |$D$$9)E$S&$D$D$SMP/vD$CD$$ѧE-$EUD$T$C$MtU|$$T$wStn M E t5|||9щ|9Et&Et$ |$D$$Ň9}AE$~K1$誀$P7D$ED$r!$D$D$RUPv$QD$}4$r1t&sugD$D$8$$wD$p8D$+E$rV9UV1S0ED$E$jt.EًU $E$14$)0[^]Ë5tNt$D$D$7$($踁$l1뀍D$D$7$$T$$|D$D$8$訂$7D$@艳D$$d$:4$tt$$J$}$<~D$D$$\$t$$at&}u$8P4$$|D$D$8$訁$7D$@色D$$d$:>D$ 8D$D$7$7KvUWVSLu}FEĉ$jtg$<$Iu@Eĉ\$D$Eԉ$GU ًE<$*$R6uL1[^_]f$8K|Eĉ$BD$D$7$|\$$L[^_]ÍEԉD$E$IgtU E<$$1D$D$7$$s뙍U(]]uu }=؉ti4$D$؉$É$^$$IVFD$\$$$C]u}]Ít&t4$_$D$胁둍&$耞4$6<$D$Z<$]v؉2$@nUWVSÃLueE1tt 9vy)Mԉ$\v}D$D$H9$E{~ŰMԉ$T$L$| (uUe3L[^_]ÍkEԋ9EK$C1Uى$ỦD$D$ D$ D$OU$ T$$@xtC(1@+Eԉ$E:u}D$D$9$EY}ŰMЉT$$L${(K$ Cd9E[t&1D$D$9$E|Ua$踉$E}tD$D$:$E|ŰMȉT$L$$({CD$D$9$Ei|U t&UWVS˃LEMeU1ҍV EЋE $t$É$Y]\$<$Eԉ$WEEf|<[^_]ÐF4<[^_]Ít&;FH D$ <D$D$<$X; ovN`u!뚃t'vfD$<D$$<pD$ <D$D$<$<n&U(u5]]}} u D$C$<ƋE4$D$\|$4$\D$D$$ttR#4$C]u}]À vC$L:u]uD}]Ít&뤍t&'UWVSlU E]uUċUEMeE1} ]҉uttt]ċC8u^;[]XCEuntit$uEԉUD$4$XdC9EԋUES $u DUe3sl[^_]fCUM$.uEE$8UMuC< <(<<AuċED$ Ut$$Mq?EԉD$E$ucED$$r:EċED$Eĉ$YFUM8 pF5{vREыFUMD$EEEEEEEEE߉D$Eĉ$:FMUvUMD$t$uĉ4$:UMC9EcEUMċED$T$ډ<$ƅ Uĉ$@ uv~u؋v,tы9΅t@WrMfJ qv t׋uMP: ut&z? tPЋuD$ >BD$D$b=$_4^t&v~2v,'QftEft9t,[^_]ÉrD$ >BD$D$b=$v=]D$ >BD$D$b=$5]t&'UX]]}}u|$$OS<$ge$MX<$ERQC$J$EWUԋMЉt$|$ T$L$D$$=胏4$˴]u}]Í&'UWVSL] E}D$$2TCXD$PL$T$ƅtw$oWEԍE$PCUЉ$0J$EW]ԋUЋM̉t$\$T$L$<$D$ D$=D$Y4$L[^_]É$VEM̉$PCUЉ$I$VM̋UЉt$|$L$T$ D$$=G4$菳L[^_]Í&E$c&'UWVS<] u]vtKSuRU$RUEB$Hu4$UN8#t> EыK9D$ET$ E΋uL$$|$t$D$=U$UD$D$=$[t$u4$D$ِ4$D$ɐE$UD$D$%$h[Ut$$D$荐u~1t ~8t+uD$U4$h<[^_]ÍED$=$=D$D$=$ZU$D$FL<t>t]}1]vD7MD$$D$܏GL9܋]Qu7BMu] ]} t D3LD$<$D$臏 ~D$ <$pD3LD$<$D$W뭐t&UWVSL]u ErUԍE܉EЍUEỦEȍ&UЋED$T$UȉD$ T$UB,$us$}~!1ۍvr$ D$8_9M܅D$D$=$MYUt^D$$}mWEUԉ|$D$$iE$ D$\ED$ |$$7D$־D$D$}m$UEUԉ|$D$$hE$ D$w\fD$D$>$X2L[^_]jUEyfUWVS]EeU1ҋu EۉErUEEUEUEfUED$T$UD$ T$UB,$q}~!1ۍvr$ D$x]9M!D$D$A$WUD$$}m VEU|$D$$DgE$ D$[}]U\$D$D$D$ />D$(D$$k\ED$\$ |$D$$MvD$D$}m$SEU|$D$$fE$ D$_ZrfD$D$>$lV&Ee3uČ[^_]$>UUD$$}mS$V\$D$E$dE$=D$X_$V\$D$E$dE$ D$XEu#EԉE<[^_]$>V\$D$ $5D$Z_$VD$ 2\$$6D$3뎐D$D$}m$@QvD$D$W>$ TPEfUWVS<u;}fE!&}$UɃNED$ E|$D$D$F,$JmuEv}$UуED$ E|$D$D$F0$lu;Q<[^_]D$ nBD$D$b=$l>R'UWVSEU MDeE1|40DB Dž<Dž@t&#44H}ЉD$|$$OH1ۍNt:t&4$D$ D$D$D$rW9HwʋD1<@z,8z0Ӄ Ãz4Nz։$`SD \$(‹A8D$$A@D$ A ND$D$D$D$$VND$$CD@B|D$T$ PT$@$SD8@ <9A `Ue3uJ[^_]Ð<8f0t)0H}ЉL$|$$wPDTD$aBD$$b=PUWVS,}G\W`E}t&k}D8D$>$D$%MEp\^D$$D$L9uދUB\~m8D$>$@DщT$ D$LEEU9P`~@\b`u,[^_]D$RBD$$b=O&US]Z[1]LUWVS\} EeU1҅EEO(9O S3$Eăj}0rD$D$>$NE3E̍uЉD$t$<$NEą:E\$$IẼ/1uAo&t >D$D$$D$ J9}v0uąt  >$D$u9}wЅ\$$ SMe3 u\[^_]É\$$ xScvW,9W$$Eă}}ND$1D$>$`ME=,\$ D$ D$$>PM̅t+1>D$D$$D$ I9}w؉\$$:R$UL~&$$LE&ME̍uЉD$t$ $IfMQD9Q<NQH9Q@B1>t& tcD>D$>D$ ?D$$D$ H9}uƒ =D>D$>$ ?D$L}f\$$ Q닍HD$D$>$KEt&$|1BÍG D$$CEĉ\$$ D$$PvD$1D$>$KEOf$ t|&U$}mT$U|]D$D$>$JE$  |$1mËE$ EыM|$t$D$ L$T$D$?$nFE@MAR $ FEEE=0E}Et&D$|$$ DH T5<tuuuUqD$D$$5E# fE!ME%AF<(s`@@ERU$AM $?UB$4M $lxAl|$t$D$?T$ $D$DE@(@MA$H UB$ DEEJEUD$D$$+&5~UqtF4UF0J|tFtME4$L$D$ F0uF4uMS , F Ut$$wl\9D$$EUD$ D$$5FMlD$ D$? T$)1(FD$$[CFD$FLD$r$Vr$ D$K,EFUMt$T$L$ V $T$,@E&qV(F$4$g?4$l9=Fh$%24$E>hlD$?$L$MT$D$L$ ?BF(F$Fr$ D$J}~D$D$4$0Ev,E&r$ D$CJEe3b[^_]Ëq4$U>4$E:EF$04$E=N8#t >DыMD$ T$D$?L$M$L$ML$@Fr$ D$I}D$t$$mFЃD$$芎v@@EMED$ $?8UB$>M $l?MNjEEE@hEE$D$$L>4$,$]Z>t&E EF<(< <0~Љуt1<t-<t)T$D$A$=Et&r$D$D$D$ BC4$b:xF|$;3ETtF< wE F<҃ȃX<@҃NɃЃPM Ƀ2 ME Ƀ, MNgw g MxT$ UD$ED$L$,tT$UD$E$L$(MT$D$ L$$ML$B<- D$$!<}% r$ D$D@t , y , (EF,D$D$4$"t&@@EED$E$4rD$D$$&?D$ 0AUz0"MI(oEP$"EEvMA$9NjE$9M‹EEE@lhEE$I7lh|$D$T$UL$MD$$T$L$ :u Gr$:D$CEEr$:D$Br$:D$BUًE>r$ D$BEt E$_}50EEf1ҨƒЃЉD$ D$D$4$>0ECD$$N9E$k6D$D$?$r$:D$@EEE U$8M $7U\$D$BD$BD$ BD$d$D$7Mfya $:8EXt%$41ۍv$UD$ D$D$D$rU9]wUe3u\[^_]iUWVS} EMeU1҉<$ SH.1ۉ vw9uދytt w׉؉Ӊ$+t&<v)< wYtU<+u$D$D$ mD$D$5v&$ڋD t tL$R$ЋEe3u/[^_]Ít&+6.1ۉt&'U]]D$ uu}} $eE1 t&$HCJ Ee3uw]u}]Ð۸ tW\$.D$|$D$ED$ D$D$$5tt\$V$닐t&fUTt&Udt&U8E uu]}}EED$4$EtXE|$$D$&$4$t$$h|$D$E$M u]}]]D$HD$$WE t&UE$ɅDÍvUSTU] \$ D$T$$ []U8}}uE]u t?uu#thEU]u}]&E$T$rEt1ۉEfD$D$H9]uu]u}]fE|$$. Eft&US|]$)a1t$a|[]Ut&UWVS<] }UҸ-E GD$_EMtYWutB01ۍW4$D$ D$D$D$9_wEU 1<[^_]Ív<-[^_]ÍvUVS]C1$`CC$_C C$_CC $_CC$_CC$_CCqCpCoC2C1C0D $_D u[^]Ít&US|t!C |t$$>_[]ËC$Mt&'UWVS<eE1D$$X~1?\$D$PD$D$D$ D$D$E4$ЃwM1$1A4$ x1Džt&4$(D$l$_pÉ$臿ǡt;$D$B$Gd4$ D$D$|C$D$$ED$^s1҃‰tf$n]&|$)D$K1$G8dD$D$E$T$)f4$( 됅>|cu!Ue3t<[^_]Ít&CD$ [f3 @st>11fS<$D$ D$D$D$ 9swȋ$GD$Jc$<\N&<D$v$Gc$$ED$jt&D$l$\Ép fD$v$Gb<$4eD$D$E$|$$J4$ $1h[z&&'UWVS˃lEeE191ɉ|@$ u{\$]D$ FD$&D$$? \$$GaK)Ue3rl[^_]1~D$D$C$X\$D$ $4I&$C념t&U1 7v҃0LC9BɃ09ƒ҅uUPC94~ÀF&LC҃79~FɃ7뷍҃W떐t&ɃW뙅d1|@$) D$D$8D$KD$$ FD$ny~~UH]|eE1uu}} C 4$P DžSCD DžGETADžTTR ƅD$t$$%|$D$PD$T$D$D$ D$C $l:FRUe3uL]u}]ÐfDžPt$D$$SD]t&UH]|uu}1?C t~t$D$PD$D$D$ D$D$FF$XFxDžt]u}]Ívt$$E]u}]ÐED$EEPu܉D$$u}<$|$D$D$D$bpD$ E؉$E$yVED$D$$S8Gt&3- UWVS<|eE1E]} ҋu@ $ =v#ЋUe3<[^_]Í\$DžSCD DžSETADžTTR ƅD$$k XtrE9Ér/v<v,<%t(< tE;<+u$D$D$ mD$D$uD$D$D$D$D$ D$D$B $bF‰Љ&+2t&3RpvD$ t$|$D$p\$$PHt&UWVS,|eE1E u}ۉDS t$D$hDD$ D$D$4$wUEC D$T$D$D$D$ D$t$$nFÉUe3,[^_]Ðt&t$D${FD$ D$D$4$E$E|$D$D$D$pD$ t$D$S\ct&cM2v'UWVS<|eE1EuUۉ1 { MFD$FD$ D‹U D$D$D$T$<$Et$D$D$D$D$ D$|$C $FÉUe3<[^_]Ít&-뽍E D$%D$ D$D$D$<$D$D$pDž$|$D$1}D$ D$S`bv'UVS05|eE1E ]1ɺQc)‹F kd)ӅɸFD\$ $D$D$FD$ D$D$\$ED$D$D$D$D$ D$F $FÉ Ue30[^]ÍS f\$ $D$ %D$2D$\$D$D$pL$ D$4$VdZU8]|uueE1}ۉC 4$=v"Ue3]u}]ÍvDžSCD DžCHECDžKPINfDž D$t$$|$D$D$D$D$D$ D$C $bFHljO@f %&D$ D$pt$$Sh[vUSEAt+D$D$$][]VM[]Ív'UWVS\} Et ?|EEEEEE]Eτ}11f}}D$D$G$}Gt}Gt}KG8GDэML$T$\$t$D$ <$蒨4$XL}D$D$G$bUT$D$D$GD$<$D$ /D$$4$1K$DKRt:}tMt 8EкF$LFE‰D$R}D$D$cG$t&}Ƀ8\[^_]Ít&D$D$G$\w&D$D$yG$4O&E|$J\[^_]É$ $ IMЅɹF‹E$UĉEȸFED$JMȉL$$U$LT$pQUĉ$eJ}sU1$af4$8JM1\[^_]Ð}1M,t&_D$|$Mtw19Es-1NDу9t Au9uuЋMЍxu ME׈MM"MԅE΅UEUֈM|$DK$aI8 &UWVS\uE U}e M1ɉ|C SCtՅt?Љ:{ `ЋUe3\[^_]Ít&U|$D$T$L$D$ D$pt$$STt{f+GfUD2=hEDžSCD DžSETDDžATA ƅto0҉}1Ӎt&D$ D$D$D$]$F9߉wȋL$D$D$D$D$D$ D$C $GV$D$7$t$D$GD$ D$D$L$ ED$D$D$D$D$D$C $ GtD $D$L$dF4$|$$bUWVSluEU}e M1ɉ|C SCRtՅt?ЉC ЋUe3l[^_]Ít&U|$ D$D$E T$L$D$ pD$t$$SLttv?v&UD2=XEDžSCD DžSETDDžATA ƅto0҉}1Ӎt&D$ D$D$D$]$9rȋL$D$D$D$D$D$ D$C $aGGF$D$ H} tH} Gt=} Ht2} %Ht'} 4Ht} CHt} RHE$t$D$D$^HD$ D$D$&L$ ED$D$D$D$D$D$C $cnHItD $D$襐$B4$&|$$g7 UÍ&'UE ÐUWVS<MM M$E9E9)ڃYɉ˃MXxrv'tbuzvu7_x r z} cpE̍Mډ $MЉD$7OUM't&trx뮐E1<[^_]Ít0t؉˃u ],t&M<[^_]ÐU(uu}} ]M]D$$t)ƺ<>9;G‹]u}]ÐUMEU E MM>&'UWVSM EU$}0E }1ɨ ϋM9}ۉ> ǀ tpww۸tf1UEEU E uًM fE 8}uEu U M1} 1[^_]Ít&0t4σ uދ}ۉf뭐Uw1bvUWVSE} ]EEu;Ѓ-[^_]f<(tI<)te1ۉU\Xt<:t`pЉ wmu؃-[^_]ÍvE1[^_]Í3-wE+ƍvU-9SE)ډEىE14¸HUt1v7*Ht%vSHtuHHv]ÍHtrHtHu]ÍHtƁH05E]Ít&'UWVSÃv|$$O$ QB<^wPJ^vD$<4$uED$4$tWD$D$T$$ 4$U<`D$D$S$l$̓[^_]D$D$S$<$띍v'Uu $PEÐ&U8]Ӊu}ωED$$$*$Zuf۸EÉ$9($U\$t$ D$4$ۋU؋u]}]Ð4$`$HD$D$$U\$T$$z؋u]}]ÍvU1ۉ4$Uqvsj$D$D$I$M\$L$$U$G:${D$D$,T$M\$$4$D&Ut,t1Ƀuxqu Íxpu1ɉÍt&xot$UN$PTb$U6D$D$JI$$gID$MD$ aD$D$I$1Iw UWVS,EUUtq}OD$D$T$U$T$d $IljD$KL>u><$184$8,[^_]fD$D$T$fD$ D$4$H<$V84$N89]uP D$D$8U$PD$ D$D$I$vD$D$I$\$$r9]y1fD$D$T$&HD$D$`U$\$$|D$D$U$|Y$,[^_] U]]up}׉|$eU1҉t$D$ID$ dD$D$d$ڋ !%tDJD)ډ\$D$ T$$E,uUe3uV]u}]Ív$?D$D$lV$tFt|$t$T$ $'U?(]1}߉u\$$bpCt!I u$s D$D$I$D$D$V${\$$]u}]É$>D$D$V$:\$$]u}]Í&\$$.Et4$R>D$D$V렉\$$EuΉ\$$Du\$$ Eu\$$E|UM uE tq1fUWVS,] EۉEtZ5}@`6&C 5}t|<$D$ED$t4;u˃,1[^_]ÐE1}$|f},[^_]UWVSÃҍru4i&FD$ FD$ ?$D$S uD$ $FD$ FD$ ?$D$pD$I$^$D$UH[^_]UV1SÃD$I$ Sr{oD1D$J${pD1D$J${qD1$U [^]ÍUWVSÃt-zt&D$D$$D$ 9uډ\$$:[^_]Ív'UVSÃT$D$}m$ t,>t'tc4$D$ t$$D$#)D$D$*J$$D$$D$U[^]Ð4$ D$4$D$$fUuÍt&D$ D$D$$4Jt҉$p:$VD$pÍ&'U(]Éu։}ω$1>u#$u[]u}]Ít&D$D$$4JD$ t$9$WD$륉$9$AJD$]u}]Ív'UWVSÃ,D$ )SD$?KD$$t >=,uoD$D$*J$$D$ 5,uW$D$U [^_]Ðt&D$]JD$}m$ 뀍\$$:5,t\$ D$D$$I[^_]Í4$P/D$rJƉ$t# v ttD$ $ ,u74$D$ t$$D$4$.f4$D$ :t$$D$Pύ\$$:농<$D$ :|$$D$!@$u<1t5<2<3<4Dž4$L$fD$\$4$bD$$g$ a&D$ D$$KL$ t&Dĉ\$ D$MLD$D$DD$$v4$]D$MuRt 1D?D$ CD$N<$D$9uƋD$U$&D$D$M $rCqft&D$D$M$:/9!t&D$D$M$t&ɃWffWkt&ɃWf҃Wt&D$D$$KD$ :t&D$D$ M$$ *Ot<$ $PD$:<D$1D$jP$R$PD$T$4/$ɭ= D$D$ $ ED$脬S$11?󫍍L$$D艩D$$.Ek~t 81#yD$D$&$r.UD$1D$"P$$?PD$$<$蘬=MD$D$4[$D$$)<$qD$D$O$航¸ODD$D$O$Z¸O9u 8 $ʫ<$D$L$Ɖ$pf<<@|$$ $<$t'&t u<u4$<'D$ D$t$$Df4$1pED$D$2$m$UDž< $x\1U$1& $]D$&$\1#~O9u*O8Bu O8Ju O8Bt){D$D$Za>>$$]17>D$D$AR$誦$_RD$1 $1E$D$D$p1$X< r< jst&$1f$d[D$f$I$ PD$I}R f t t1(O$$PD$ߤ $,D$D$\*D$D$]$3$%RD$D$Ɖ$虻4$$1K$[D$K1Oу $ML$$*󤋕$k$C&$$]D$ƣF~< < t< t򍅨D$D$$Q褸$X$x]D$X1$譾D$ 1D$D$$v#D$&D$$&<$D$1D$Q$R$QD$ T$4/1эAbD$7<$($6$fkt-t$ D$T$ $艥4$蘣D$D$Z$gD$'$4$1h $1<$QD$D$[$1$<$4$葝膝$D$D$$辡t$|$$&Dž < ?GD$D$\$1eD$$$D$D$ \ D$D$[먀 JUt&補$ D$D$ R$נ|$T$$94$ɡDžtG ut&t;tEЃMEĉ$MENEЋUBEBBŰEUЈPUUPE̋UEBEBBMUԉEB EB Uԉ|$t$ $U誛M؋U<:GM\$<$L$xUċE$T$ UD$T$菍Eԉ$U}EȉuEȁEUD$\$D$ D$B$g}w#ЋUe3Č[^_]ÍUED$t$UÜEED$UUȈEED$ B$cgt$E2D$D$pb3 $ED$D$Hb$臘\$$U UWVSӃLUM uu2M1҅t A,tQ8ML$MT$L$ |$$seEMEM EԉE^p1 9u ;xuEԉUЃ$UЅt-M@ $L$ML$EUЉ~F0L[^_]Ë69~uF1҅uM 1҃L[^_]Í&$(EtNV T$$L$~UEV1&ppD$ rD$=D$Pi$hi讕UWVSl} U؉MDU1ۃ^^tp&9t uxv_  ptO1҃ML$ML$ t$T$@$scEMԋ]Ul[^_]Ív pUȍUMӍMU̍P0MĉUE}SD$EċMȋ]̋U$EL$ \$<MEʋ]Eԉl[^_]Ít&pJR EU҉UU҈Uu 1E‰UčP0UUĉEEȉT$UD$ EẺD$EUĉ$ULE܉D$ Et$D$E$תEME܉+UUUU9Er[UvJ &H0A,Q8pl1[^_]$blE$EYt&U^WVSÃ<@0M`EːTщT$E$iU E:u}}wv0u}4[4ur}ur uċuĉw@zr u}}ĉ~DFHRt ftft҉}[tHu[LHit$ititiEы}ċMT$ [|$T@E$iT$݄Et&|$E$i荏E$\[^_]fFHWt&|$$iXMD$ rD$D$Pi$i׎ U8]ӉuM}U$D$tP}vJE@uD$D$i$S$4$  ]u}]ÐD$D$b$$t4$]u}]f4$D$D$b$Ɏ|$$UHD$D$(c$蜎|$$8…ҸCu0]}]D$D$j$T$UW1V uSDlEU EeU1҉& $D$螔uڅupE1vB0HHPD@@t$L$ T$D$D$.jD$ D$D$<$|$\$$uf1 t&Ue3l[^_]ÍPD$$1tX/fD$D$\$D$ D$$}ƅt`1f1F<$؍D$ %D$T$D$$e9w<$菍D$D$|$\$$D$ |$ot&B01H0@tက҃T$,P0T$(P1T$$P0T$ P0T$P0T$@04$D$dcD$ dD$D$D$d觐4$蟌t$1D$D$\$D$ ${1D$D$$\y]D$ D$2D$D$$Ϗ$$D$D$|$\$T$D$ D$bp$-{$D$D$$<$ef1D$D$D$ $|$\$z$2RE1EOPENEPGP.fE3D$D$D$ D$\$$Fz Wf1 Bz J u; 1f1ډ$au<$t&Kku"D$ D$2D$4$D$趍4$D$D$t$\$D$ $&D$Vjt$$롍v'UWVS1ۃ\EMeE1f A<vA< vA<v(tUe3w\[^_]fu0,LB9Y~ YɀFyO\ЃtB9~ރpƐ]UMȋEL$M̉ $n0D$ D$vudEĉD$ ED$D$Ẻ$豚t}k$uU܉T$UD$$UaE$wËE܉$wD$ntkEu܉$D$st$$rw$vM\$D$D$ A$A$vtڍt&u$]܅t$$vtfu]܉$Efv}MUG,UMEB,U}rMA(A D$D$k$tet+EUE<JEE}|Eк$EMD$t }D$D$b$s$r<$5]D$D$ d$Is}Uĉ|$ T$$q]$vD$D$Ik$s\$$\r]OE@,D$1D$,k$r]܉$\tD$ D$xe$rD$$q<$D$D$c$Gr\$$p]UB0X0EăU܉؃EĉT$D$ D$耉D$уL$UB$=}D$\$ D$D$G$@}7]܃1ыuуMEċ}\$t$耉|$҃T$ D$lU܃1ىT$UD$уL$ B$Y>"MA0@0$U܉ى}T$D$уL$ G$>E@<$ExED$ D$W$p$o]U܃؉T$UD$ D$D$уL$B$;CU܉؉T$D$ D$D$уL$D$D$Le$oMUT$ $D$ULUE1уRD$ D$xe$zoD$$n]xf}D$ sD$MD$Pi$dk5n'UWVSEUM] E}E UU$Me M1ɅۉE-}UU҈E}k MUE<EpE-<+}]$kƸ|$<>D$4$]lME<$L$D$ouUB0P,11}L$MT$U\$ |$}D$T$|$A$>4$EEt&}e3=Č[^_]Ðt&$8ov̿I uM1 A<vA< vA<v UuEt/qu}1U}5t&TC9J~ JɀFzOLЃt4C9~փpƐ-+}GvUzr}EUEvuQ1ҸIP8;E-w +}E-pw +}]11{ovUWVSEUM] EEUU MM$EeE1ۉUM-҈Ut~}ewxQ $$mvPI u@M1 t&A<vA< vA<v UUe3Č[^_]ËUzu׋r}uȋMtUEut&MUEZuMQ01B,tB8UD$EL$MT$UD$ T$UT$A$@=KvEt/4uM1UM4TC9J~ JɀFzOLЃ C9~փpm&UWsVDS1ۃ<7E 4$D$qpu݅stUB0@0sp @x1-.xuuDž<1ED$UET$ UD$ET$$jE9}uUT$EUD$ ET$UD$$Uj@Et } ]UT$EUD$ ET$UD$$jE;9~2<X1k\ B0p@Et U$Ã=tE\$$TgD$"P9XB0@0 u]D$D$|g$OQt$$PD$1-D$|l$Q${PvLًPD$X$\uXk\ F0p@9ZXx0k\ tD v G0 DU҉8|89rwvrk\ t@E414tx4蹯9tQD$D$g$Pt$1D$%E$nOiD$D$gU1҉0tt0D9D$D$g$Ot$1D$E$ND$ D$$qlKDED$UET$ UD$ET$$Yg} 1,MES00J0ῈMMMJ0@MMMMJ0 MMMMJ0MMMMJ0MMMMJ0M߈MM MJ0vlxM J0pH fJ4pH J0 J0pH fJ6H@  fB8u4$譚EU Ѓu {ׯ Q1҉pdX=p^1ɉ׉]G uD$E]؍u܉M\$t$ D$$M1p<GM$nD$AE$D$E܉D$7MGp^1t&C9tK9JuD$E؍MԉUL$ D$E܉$XUtMԉMM)M;M} pD EU$nL$@MԋEUWL$$n@UOC0H05v׋E܉M$讘MEg&E܉M$nD$ E؉D$GD$D@Mt&]C4 EC8C<C@CDCH<CXC\NC`JCL>CP:CT6Cd@.Ch+|[^_]É$耡$nD$GD$?MD$ EU$nD$D$?U($b<@Ut&UL$D$$y5U]$h@t&$m?E$D$ED$25Mt&s0F0U$UmDljD$>UF0$kmD׉T$>F0DljD$$m>F0$mDljD$n>F0$mDljD$R>F0 $mDljD$6>F0@$mE|$>F0@tlmIЉT$$m3F1$nD$=F6$nD$=F8$/nD$=F,$EnDljD$=F,$[nDljD$z=F($qnD$f=F<$nDljD$J=F<$nE|$.=$m=E$D$ED$23t&$,h=E$Xh=F4$mD$2F0D$D$h$=D$*m$Q=]D$D$h$=D$;m$ =,U=lt~~4=t ~~= = }T=~M9]Ít&=it~z=jt=jt=kt=j&뱐-]Í&0=t=t=t=udrf=gt=hR=i E=hu)7&= 8 =%1=a&=j-=iu=b=eu=m=nuUhE܋E MԋM]]uu}}MCM}MɁMMD$E|$\$(L$ M܉t$$D$D$D$ GD$T$ $'E=tF$]u}]ut&]-u}]Í]1u}]É'UEt]01]ÍU(EU D$D$  T$UD$ED$D$T$$E'US4E UM҈]Euau]1=?t }҃ED$ET$D$D$ D$ D$D$$DF4[]4[]É'UWVSEe M1ɋu U}wwEEM<1vfT9uUD$EL$D$ D$D$ D$D$$CjMe3 u(Ĝ[^_]Ív1Mi]u}]]-u}]Íx |$(x|$$@L$T$t$D$ ED$ D$,D$D$$8>덍US$EM] Uu$-[]Ít\$T$D$D$D$ ,D$D$ $p=$[]U(ED$D$ ED$E D$E$UX]]uE }U}ۋuHM}wzL$ ։<$\$(t$$D$D$L$T$D$ D$D$;=tS$詈]u}]ffOxf]-u}]Í]1u}]ÐU(UED$ D$T$UT$ĉD$E T$D$E$;vU(UED$ D$T$UT$ĉD$E T$D$E$;CvU8UuE }u]Mҋ}x^=wWOɻE߉\$4$L$T$D$D$ "D$D$%;]u}]t&]-u}]Í&'UhE}} ]MuUEE}ԋu] F׋}D$Eԉ\$(t$$<$T$ L$D$D$D$ *D$D$n9=tU$K]u}]t&]-u}]Íb]1u}]ÐUxEM ]]uUE؋EMMۋu$}} EĉM vEMFЅCUЉEԉ$詃UЅECME܋Mĉ\$UЃL$$/E܋MԋUЉt$(D$EL$M؉T$ |$$D$ $D$D$ *D$D$7ËE܉$̈́$跄]u}](-]u}]ÍMMċE\$t$(L$M؉|$$T$ D$D$D$ *D$D$ $77ÁX]1u}]fk&'UhE}} ]MuUEE}ԋu] F׋}D$Eԉ\$(t$$<$T$ L$D$D$D$ D$D$N6=tU$+]u}]t&]-u}]Íb]1u}]ÐU}} M]]uu}}EU uu}}] ]M1]v'U}} M]]uu}}EU uu}}] ]M]g&UWVS\E] t\-[^_]Ít&uED$(ED$$ENE|$ D$D$D$D$D$ D$D$$4=uDu9s}})Et$|$$8,<$hX\1[^_]ÍUEԉ$BE\[^_]fU1WVS|u}] EtMiU->MЈMfU1ωL$MEDӉUUT$(UT$$UD$ EED$$D$D$D$ D$D$t3Mȉ0ҁlM=k$=bE%E$D$LUUT$U$T$*EE$EÁw-)9ƾG}t }t EЅ1|[^_]Ív|-[^_]ÍvEME띐U%T$(UT$$UD$ ED$D$L$D$D$ D$D$$321f=UEȉ$~M$~UE[#E$~M$~E UVSP]U Eu}=DD$EML$(MEEL$$D$ D$D$T$D$ D$D$$0=bu*EEP1[^]Í&-P[^]Ít&=tϋUE$s}$i}E¸vUt~ut Ҹ(u,t&]Í=vt%vtHv]Ðt& vu̍t&US]$,1ǃ }[]Ðt&UE 1]U=t~v$= tvV=tg=iu]Ít&=v=t ]Ít&=s11҅t= u뽐t&=  t= u뤍t&] U(]uw> }t0@}t$]L$T$$\$] \$]\$ ։É؋u]]US]T}$4`}${1ǃ`}ǃ }[]Ív'U1҃(u }Dƒuǂ(}ǂ,}ǂ0}ǂ4}ǂ8}ǂ<}ǂ@}ǂD}ǂH}ǂL}ǂ }ǂd}ǂh}ǂp}ÉE$|+#EÍUuu]1ہP}Fu؋u]]fD$$0t[vvt& D$T$$0|"؋u]]ÐȺ]viwʋ&F؋u]]D$ yD$'D$v$v!U(]áu}t,H}t$Љl}t }u]u}]Ðt&\$$v!}t}t$$D$]u}]Ít&'UE$T|D$ Ðt&UUl}vtɸvvED$T$$vo Í'UWVSÁ\eE1D$D$}ىT$ƅƅE EEE܀EfDžt$|$D$ $(ufv ɀ t@{\$$x|D$W  Ue3\[^_]Í&T$T$ƅƅE EEEEfDžt$|$D$ D$$(u]fvx=tc1\$$|D$t$$wD$ u\$$|D$Q !v\$$|2 K#|$t$l}t}$$!1} UEUX]]uU }u}}tnEEfEuoEۉT$|$ $D$ED$ED$ED$(U<% ]u}]Í؉UUԅtڐt&T$Uԉ|$$"wiUrUh}}UÉueE1ED$ P}]T$UD$!$lUu&ET$}t}D$4$HUe3u ]u}]!&UEP}Eht&UHeU1ҋU EEEUUP}ET$UD$$D$ D$T$UD$$T$UT$ UT$~Ue3uÍ& t&'UXuu]M }U}]}ۋD$ E|$$D$C D$CD$CD$T$L$D$ P}$E~tD$E$}E]u}]ÍUM4$UMuavT$L$UM$-wۋMU>D$E|$T$L$D$ P}$pT'US$EU] T$P}$huUt҉$[]Ðt&$[]ÍUEP}$c1fUS]P}$e1ǃ }[]ÍvUSEP}St4D$$(}C u5uQu=EU[]t&D$$L}[]f$8wlf$@w\f$p}UDžx]E $?fu EE $fxÉt|DžstEx|M GEx:EGEGUG$T$L$Eƃ}DžtE7UT79` 7)St&TL ʋ 0ɁlT7DžD$L$$z D$$L$X$^$l~T$D$  $e$e t&ue35Ĭ[^_]Ígΐ~$}uDžDžt&DžDž&EUM \$D$ET$L$$0~D$ T$L$ v}l)t&}bt&u~Dž#} st)UEx|M OGt$$T$p}}M 7DžDžu't-lh4$Ychl4btblD$DalilL$\$$ ll$blD$$ yD$Olt&}@hDžt%Džot|xDžDžDžDž+v$$l~D$D$B $da $Vat&txME |}Dž?uEJ Dž%$`=3%=al$^lƋ0= 4$lD$\$ lDžƅƅƅ1tftL$D$$T~tT %=a‰ttb1 )9sL=C $D$4^+D$\$$/ 6ftDžx|DžT$lhD$$~hҋlt%=awlh\$D$$"yhl?&t$$~D$AD$t$$t%=a\$$!yD$t$$4lL$ltb) lL$$%\l= $g\l$I\lD$ qD$ D$v$xbfQƅ01Dž$[D$S$~\$D$I4$[$$~\$D$ $_[D$ qD$C D$v$ y|t&UWVSlrt 8=4D$$XD$Fy$3D$\y$@D$py$4 D$y$8D$y$,D$y$DD$y$LD$y$0D$y$<D$y$(vD$y$TaD$z$PL@ңH54 8=,5D L=05< (=T5Pt4T}D$ D$D$$@U䍳P}T$ D$D$F$8EvvT$D$$/T}$4ELJ }$fXl[^_]Í}tED$ D$$Ë50tD$f$}$$\$$D$Ydž }JfCt,ED$P}$"Eǃ }EKU=1v(<:uu\$$l[^_]ÐE$JUEUԍED$ D$T$F$8]tV]?\$$zx$UH9Ѝ4$ujt\;u{uǍ&MEDE$7$T`}U$ҋUEUT$Eԉ$VǃX}ǃ}ǃh}ǃ(}@ǃ,}0ǃ0}ǃ8}Ѝǃ<}ǃ@}ǃH}l[^_]ÍD$$+8D$-y$D$5y4$$D$=y4$( $ɣ,(0&$$&Qt dž}ǀ0}ǀ8}pǀ<}ǀ@}ǀD}ǀH}Ѓ&}D$ t}D$P}D$!$&Ltuǃ}ǀ0}pǀ4}Pǀ8}Pǀ<}ǀ@}ǀD}ǀH}ǀL}ǀp}B}ǃh}뉅D$01=P$`D$,1=TD$(1=(D$$1=<D$ 1=0D$1=LD$1=DD$1=,D$1=8D$ 1=4D$1D$$)vvt+D$T$$pLJ }\Ⱥ]viwŋȺ]vi$,D$D$$4$ns$xD$$PT}$4ǃ }$ЀF$4ǃ }lU&Ð&UUwE }1]Í&'Uuu]w7 }t((}1ۅt4$Љ1ɺ$p؋u]]Ít&UEw" }t,}t⍶Ð1Ít&U]]uwL޸ }u]u]Í$u䋆4}t"]u]]t&]u]Ð뱉'UVS u,  }1 u뀃u [^]Ív4$Ct4$ōU]]uwL޸ }u]u]Í$u䋆0}t"]u]]t&]u]Ð뱉'USEw! }tL}t[]␃[]Ðt&1[]Ð&US]w, }t8}ǂh}t$Ѕt[]f1ǃh}[]ÍvU(]]uw) }t<}tUT$$Ѕt]u]Ít&Utt1}ủ18}0}tdžh}`}$RuFU(uu]1ۉ}v؋u]}] }t䋆}}tԉ$LtƋGt}t$$D$\WE 룍v'UUEMU1U(EU ]u}Uw+ }tD}t*]u}]t&]u}]Í'Uuu }U} ]Muu$]EE$uu(}(}0]]uu} },] ]}}]PUuu ]U]}} uu$EM]]uu(}(},E$] ]uu} }E] U8E MUD$D$ E$D$D$D$D$ E D$ED$E$EÐ&UHE$MU D$ EE(D$D$D$EE,EE0EED$E D$ ED$ED$E$EU]]E e M1ɋUuu}} }m G$(IT$|$ $v E -= E $HE $L$D$$$J8|T EEt%=abҍJE$G_T$$T$+ $UI L1t*T$$ yT$ Ue3t]u}]ÍD$ |$T$$\vDžDžt&놐DžDž v<$\$$|D$ $.H,"$cF‰=$D$L$Džnƅƅ ƅ(1tfL$D$$%|T %=attb1҅+9s\=CD$$E+ D$\$ $6Df$D\$$|D$@$ED$|$$~$t%=a$!yD$L$2`t&$E|$$D$sD$|$$t%=a\$$!yD$v|$$\$Nt0)‰T$$C $5E v" ~1? $ F 1ɨ881[ FC,F 1Ҩ.8H8b F$1Ҩ888 F(N1ɨ 8E7 8Q 8k 8  8@  8t  C*8}E~ 8F0< L ~1 F2F~3< V4Et/Eԅ C8K8σMEEC8M8n<6vy 81҅ 66vV6]&69v18t3$D$869wϋ]o Uu C8^ E܅S 1f{ <[^_]Ðt&1҅BE$E؋8*ҿE$E؋8f$UF 8D$$̋~F8D$$X8F$D$7F_ 8vD$$DF98PD$$p 82F$D$F8D$E$ČE؉C,F 8 D$E$qE؋8E$iE؋8E$AE؋8$UF$$8 D$E$E؋8jhE$E؋8PfLE$ÄE؋842E$ʄyE؋8$UTF(\ 87D$E$< E؋ 8EE$dE؋ 8vE$E؋ 8E$čE؋ 8E$aE؋ 8 {yE$9E؋ 8@aYE$x  8E GU@uUQ$ $D$=8tF $D$됉<=8u͉'=8tF $D$?~ 5=86F $D$i=8F $D$H=8F $@D$'=8F $lD$=8F$D$=8F$ęD$=8pF$D$W=8.V ·t$هttE҉D$T$$;(F =8<-t!<:t<Lt<ET$D$$\tM]=8uOF $@D$~=8t̍F$hD$]벍t&'UuutE}e M1Ʌ]ptZv"Ue3']u}]ÍvtEkEEA$EEoEA$ET$D$ Z|$$EtO U|EEE$^oUdD$D$ D$D$|$t9ptt| v |;} pU|$T$ $>UVSÁeE1C8tZtS$T$$Ct$CEe3Đ[^]Ít&C$ UEcEEƃC$EEEEEEEE $9t K8Jt&E$d؍UD$D$ t$D$v'UWV1SD؅tn1҉M f9}Vxu}t*xux9uΉA&xuxx܃9|Mt Eƒ[^_]ÍUh]1ۉueE1҉}u%Ue3=]u}]ÍFlj󫍅D$D$D$D$D$ D$D$4$) ~ 1ۍD$D$D$L$T$ D$D$4$9‰19v6uY߀]w%t:t 1эD $G‰~$D$1эq;sq=t 2=H߀]w<%t <:t2D$2D$ mD$D$$f:0BUWVSEE|U MMEExUMMEE UU$MM(EU1eE1|p1}!‹EUt M}t Ext x]t MMt EUt Upt pEt ERtEEEEċt ҉UEEE!EM$8y.EU<y G11҉M;WtCtC0= t{uҋMuËEl$lUMЉE D$ $D$ D$D$D$EM)}\8vMtM $X4$ D$#UtE$D$U$t$$$f ]E14$U$M ɉM$t҉tMz1M)}8LD$$ Et$($ P\$D$ D$ML$D$$EV8EtU$X4$D$PEtU$T$]M $t$$F$Nf E]4$i}E$T&MEA9Et&MEE!9EDEt6E3|%|t$ $EEt CMEtCS 1U}tCS ~MMtCS aUUtEMETU2EM1Ue3Ĭ[^_]á8κ$4$D$lUt$$T$int&}]x{<$/xS|$$T$,CUMЋ!%tDQD+Mă $OEЉD$4$w4$߿X:04$4$裹88N船$\$$ D$B&]t.Etd|tZ|t$$X}tMU }E01p Mp t&}]Et$$D$衾M $)4$E$EE%}M1U t}t M $螿E$蓼4$苼H}t E$rU$g$4$WD$ dD$6D$$^ٿU8Ut8]Ð&UH<ti1ҸMD$ D$D$D$D$D$ D$D$$1DEÍ&<농&UWVS|<}u EEEEED$:4$VE܉D$ ED$ED$EĉD$EȉD$ẺD$ EЉD$EԉD$E$M؉[8E t\$$+Eԉ$舺E؉$}Et$E܃t$^$TE|[^_]Ív諼<1fD$H$lU؉PUqU@fH fHfPỦPUȉPUĉPUP 8]MЋUԋ 8E $ 8E t$$X̺&8E$蠺pvD$ D$4$踸8E 7$4V&Eԉ$譸ESE؉\$$D$!t&U܃H8PUf@ ffP@*@, @0H8t$D$ D$D$$؈H581҅uXH8XẺD$E$ֵ&8E 6D$$0Q!E$=E8H8D$ yD$,D$$袶v'UVSP]EEEtoCth ESD$E1ɉD$E܉D$ED$ED$ ED$ED$E$D$ t? 8 uP[^]Í&C$XD$EP[^]Ít&EtEMUCECE܉CE؉C tN8 uwE$Tt$vCt$0CP[^]ËED$E$t8u( 뙋E$$ txt$ $0Z^t&UUtJtE B@EBD1]Ív'US]t t$EC$b$Z1[]f{uU]ÍUS]MU E]]] ]][]Tt&UWV1SLUeE1tI]D$D$ \$R $T$3E|;uq=8Ue3L[^_]Í;ntԋ8 tʼn$荰$`D$뫍vExE<<C4$ u"tVӮ$0謬&UWVS<E M]UeE1ɍHEC8Dž Dž( t~f{ ktGt:E }Ue3 <[^_]f{u}vzuDž Dž( {* (уDGDž0DžDžDž$E C(GS49U )Uщ4GWT$L$$1Ƀ,tf2u, 4(,(, AkFC$4FC$BNFFFF F NF(0хE$=8L$jʸ  D1@0%Rt  I0L$ D$$ԝT$臩L$T 4D$D$LT$$D$ ,L+(=8Dž4  E44% D ɉ01@ Rt  I4D$$L$0L$ L$ ,,4Ats(1ɉ0C)0@49}(Ȃ GG2 G Dž0DžDžoFC$4FC$FFFFF VFvЉցƀ 8t3Ѹ3 D‰L$D$$蹦,A?k i,yY8V$Dž0Dž&U4t&4C)tH9U9,T$D$ $)U0 ( C)Ȁ10&1 Dž4T F(, @@4,B(2A2A8Dž0DžZK(9 ȃC(Dž0Dž,x?  $ƅoMƅC$ƅƅƅǃC$L$D$ 1D$$誠EUMƅ ƅD$QD$;؍RD$D$ |$D$7 D 9]W=8M\$$L$ԢE$Dž0,zor(OW1GG29uW8c$ޣ;C;u(x=8#M(t$$L$膜vG8҃ vE!1EDžX8D$D$$fO Cƅƅݝd=8Džx D%Dɉ1@Rt  ID$$L$L$ L$ۚO)w(@9=8 $t$H]@GD$$o D$t$$33€=8 hù3 Dȉ\$L$$x躙/1lO)t69u(D$t$$s3 =8 $"t/=8 $d1ҨG(9t/=8 C$<豘&=8 $$肘UW1VSÃ,5ЊUMu JvtQ\$$胙u^1t'CD$E$UۉPu߃,[^_]Ðt&1,[^_]ÍUXeE1x]u}t-$uËUe3]u}]Ít&|1ۅt$|D$D$lj$莒UύEȉT$ED$<$觕<$PEȍD$0@xEȅY{D5σ<$D$ D$D$D$њ9uw<$gPfӘt&'UVSÃ` Ѓ= T$$Y$行D$D$4$˔t$1$U \$$6D$D$$OE$UD$D$$_$$UD$D$$/$D$WE[^]Ít&$l1$ĥz t& D$D$Ȣ$詓$9t&D$D$$j$t&$D$D$t$2t$$蹑_D$D$$h&UVSÃ۸u t"t$C$Ru1[^]Í[^]Ít&UWVSl}eE1]Ћu EED$\$<$Eȉ\$D$Ẻ$3]̅u-t&$vStۋSuօuHuIQ(t u҃,MEt&UT$ UED$D$D$$UEąt<<'<B< ]D$D$$5$ŏD$ѣD$\$ $詍1$ D$讖]ă]\$4$D$ LD$D$ۣ$)E觐$7蒍t$D$ \$$踟s$ D$+)]ą]ąt> p]名t&|$B$P$/苑Ẻ$p%uD$<$DẺ$IEe3l[^_]Ð$4D$D$I$螏D$D$$耏$Cc$D$ߊRD$D$]$>D$D$o${D$D$$XD$D$$؎5\t&UWVSLE$EEЃw خEԋMU1T$ $Eԃ/E̍vD$D$$\} ?=D$D$ا$$莿$U肿}@}b}}] D$D$$軍$+D$D$Ĥ$藍$$UMЅ 4$ D$D$Ф$K$D$É$94{ud9U}6} Ƀ59)1<D$ĮD$>$BfU tA:F:F<$r-t&1$^:F:F~:Ft:Fu$4L[^_]Í&UЉ$D$D$$/\$$蛽D$D$w$D$$dD$D$$Ћ$@4vD$D$x$褋D$$ D$D$/$xD$$D$D$F$LD$$贼D$D$a$ D$$舼)vD$D$$$\U$豄M $}UB$swM $EEUȉ\$|$ $T$D$E$苑D$D$l$e\$$ѻ$U$>kɉC8 u@p0uH4u݋p,tHt0t8pt1MD$D$ L$H L$@Uȉ$CUȋ@D$HLUȉ$L$٫D$D$#$胉t$$UȅDfED$D$$:$U赺<$=D$D$v$$1L[^_]þ$M $% ؉D$E$뾾ľ뽾D$D$̨$胈$ D$xD$ĮD$,$譈D$ĮD$$葈UWVS\EeU1$EËE$D$~E=EC,t.C(u'D$D$$談$;vD$$  @&€lMA(t ЃT$$諆$ D$D$$$諅D$D$ܫ$$臅D$D$$7t&$0,E $CEċUe3F\[^_]f$4tD$D$$)7뢍&$ ED$D$t$-$轄D$$mU€UD$D$$$zUef$E&$l4)f$ LD$D$|$x$D$D$ȬXv$ D$D$($0$D$D$L$ $蜃4E3rvD$D$v$ EyU{(,UD$D$$蕄$%UD$D$<$U9vU}$.ƍCD$D$8$袀ỦT$$+6;Eԋ]ȅ:E1&Cu${!UP!D$D$ D$|$$DsED$F$@FX4$D$‰ EЉG4$UЉ$1}EEEE11]Đt&4$E̅EE$ƅ>1ɉUut<$:$UP!D$D$ D$t$$oD$D$$[|$˭Eԉ$EE4$E̅*uE8]ĉ4$<$1@9xvED$G$<u]̅tSEЉ<$18D$D$ȭ${$*zEEoGX<$D$hMD$D$$L{$輬D$D$d$#{$蓬Eof$UlD$D$K$z$HuЅ]Љ}-t&PL$T$$uU؉T$C$pC$KtE؉U$kmNjC@$ gƋC$sU|$ t$$`T$D$螫C@X`UE؉T$$NƋE4$D$]4$B}D$D$$y$nD$Ɖ$跖Nj]ȉ$6<$D$D$&$pyỦt$T$$xẺ${UD$D$'$=T$D$ SUЉ$‰EЉ<$166D$D$$x$bwE$ UEEx1@E{}ԉlj4$5<$D$D$&$XxUԉt$T$$wEԉ$yUD$D$'$=T$D$ ;}ԉlj4$I5Eԉ$yUD$D$'$=T$D$ <$D$D$&$wUԉt$T$$v;EUԉD$B$#8EUԋEgD$D$ȭ$;w$uEv}Կ54$_4D$D$D$vUԉT$$uEԉ$xUD$D$'$=T$D$ _}Կ54$3Eԉ$JxUD$D$'$=T$D$ $ zUEx1@E2$ NUEPU@EЉo'UU]Eu] ttI1]u]Ít&ȉ1tՉ$#Ðt0t$]G19ȉP1{$@ft&vȉK$ M6t&CKB 901 &S0fv&$F1S11fvC1UWVS]EeU1Һۉ1@DžDžDžDžDž} DžDžDžv1DŽ r} } q} (OAX3X<9 .Ct&Ãtg;M u{ى߃ɉdtt狍d 9D׃uutƅƅx! 1v!uꋕ҉UxMU} } 1ۺ tgt9vٸtƋE \$L$$EEӃuu} u҃ЋUe3oĬ[^_]Ã=ȉtZBAXYPN1ҋO=ȉt-G믋Axwxc덋Bxxx=d}E |$L$${L5<_>V^ރAV‰煼t΋M D$T$ $tV5@u5Dsst&'U1Ut.RHttHQXuQTu鍶1]Ít&]ÐUWVS,]\$$Xd$`PftjC8 upFuLD$4$-rutEF=$ UPU@E܉U$'E$D$D$G$llt$|$$kSE$d'U$|$$GD$k$x?D$D$$lD$D$G$kt$|$$ljU$&]$YkEEU܉$E<[^_]D$D$p$mk$iE$r&Q$|!ECUD$$T$gEuRUT$C$+Eug;<t ptx$ X@E$%E$$D$jE$%E$$D$iD$D$p$`j$h$h%UWVSÃly1Et y8A` D$ E1\$D$A$0t E$^<$l[^_]ÍvED$ED$$&ENjE$^EE!1҅۹u9Yv<t9rQ9эDFU$`Uto u] uSDD$D$$EЉUMhUMT$L$$^g>]fFEċU$U9ED$|$$cjEt&L$ALM $D$iXD$ǍEԉD$C $CzE؉D$E܉D$ EԉT$U<$D$ou<$赾U$誾Eس}܉E#fELD FEDVfMċMD$T$ $"iF1҅Et]]1L9r]f9UM $}uĉߋ]t6VuM̉L$B$U]9EuӋK9MuˋF}pFVoF(tID$D$v$f$-ec$ D$@lD$4$Mĉ $ͯh$,2&1IU$U&|D$ D$$e$d6EvP: uJQ1&D tA>t$4$/uEE,[^_]1ۍv_EE,[^_]ÍvE>t܋E,[^_]ÐUWVS1ۃL} <$b$譶ƋEu؉0<&U<9~P tLEԉރ9|̓EdEԉ$tR|$މ\$$E^<$UЉ떍 t+D$޳=D<[^_]É11]t&$dfE$8D$M&UWVS<z$D$:$Y9XD$ D$$\Ft<:ut <:u1ulEuLE tE $TD$CbD$D$ij$\t$$c[<$豲1<[^_]Í&UD$ D$$j[UЃhET$|$$JW<$Ou$X … EW$,[X YGD$$]t $+D$$\ Džt\$$\$mEuH} tE $TD$`D$D$$`Z$YE$L1Ut&$\Wt 8mU1+} tE $TD$`D$D$h$Y$mX1t&D$$[t $ְD$$[ Džt\$$h[$E<[^_]Ðt&u‰$EGET_@PASS@PHRA@ SE }EM_MX U UxE$tƉ‰4$  UGUEċMED$$T$ $D$ D D$D$D$D$D$ D$W;ƋE$蚫U$菫uąM $QG}t E$t\$$TZ$CUe3Ĭ[^_]ÍEvE$E_}}E1]Ð3<$D$ D$D$D$ZYu͋E](S&@Xxt&MU҈EUB$sD$D$7$ǸDcS$ UEEUD$\NEFV ;;V $FD$D$7$ERUMD$D$T$ $D$ :XVUX7v}D$D$\$R$©EE(vEẺ4$D$XUE$[D$D$$$E4R$SM̉<$MESEDEE$SU$ESM‹ELsEEE$4$EDU$TKMD$D$$$MEQMUt$ |$L$(MT$UD$ ED$L$$MT$D$$L$VU$ M $EȉD$EЉD$E$NEEu<>D>$EGET_@PASS@PHRA@ SE E3t&fcD$D$$P$Pt\$$TV$<$1.M $C$ME$ $xS`D$D$IeD$D$$O$wNuDU6QSD$ 8D$zD$n$Nt&U4Bt&UWVSl]eE1} E*D$$v<$PD@$0CLEA@R_PA@SSPH@ RASEf@ @D$D$D$D$D$ D$\$4$7$ju64$>AEąt Eĉ$ Ee3Xl[^_]Ít&D$D$$LN$M4$@Eąu륐D$1$ʥۍMEEEEEECM\$$DM'ẺD$EĉL$$7KXf$;1貢MCLEA@R_PA@SSPH@ RASEf@ @uƉ]ˉEt&;4$D$ D$D$D$Ru͋Eu](1P UWVS,U}u ]tt  t/M1T$ 1҉|$\$4$KuED$:N$ǡD<$D$Nt?u $,[^_]Ðt&D$%<$UUIUt^<$)$D$E}E$ТU(D$D$$K$DKt&1nU|$$5}Uut(D$D$$Kt$$|t&E\$EE$D$D$$:K뺍&'UWVSEu UMEeE1UMt}=@]t *DžE1҃}t$ D$$E1D$^?}1>&T$<$pPp$9E1ɺt$ D$D$$u$y=D1щ $*ǡD<$D$K&?$4胟Mx?u }}<$JEExU$&xAUD$B$wxËAxMuEtڃUDž|}|MҍyVt&T$|$$$UB$1xQ+U9Љ׋UNB$D$tU|$$D$Ix}E;A|1$C|&D9C 9Cu剕pD$D$$Cp뼍t&}$RËE$uN$UxD$D$$CG|$$x<$U$T$>D$Ux$D=@1}I}D$D$<$0 E8-UBEHʃ9C9+U} &NjUD$$T$ME$L$D$E 09rĉ}pD$|$$Lp$T$UT$0$蟦$4UxhhvM֋ME$L$D$$H<$@DžxUe3x>ļ[^_]Ðt&}$5H$=H뺉<$=@Ut$8EEUЈEԉUxAh}6MytY uE8XU$I$;D$p{4E 9u ED$D$$?D$D$m$?|$$>{1C$u1t&D`$IC$;9|߉ uf9CxD$t&u $ Ue3ļ[^_]Ív$蔟$ vC<$4 {|$$=yD$D$$W>$<Ef{8{1+5E t=҃U Džp[ML$$2{0EEu C EC$EpED$C8|$MD$ T$C4D$C $D$suMt D$D$C4$|GD$GD$|$<$\$$f|lCL$D$CMD$s{ !C$}fEhtE|`&x$7 UT$$73ƋEV ʃ9:$| $4FCEt$D$ CD$|$E$D$Ƌ$1UT$D$$p$賒xfuEtB$9Eht| $Ef9Cxl$T$CM $D$D$l$mtPML$}$"0ED$ <(D$2D$D$E<$D$|@|$$Ę ] Džp:C$\HNjMc$5SUED$$411ɉ‹EvLMLf M`d$dT$|EE$D$ ED$U$9/E{5`}fCxbD$$kxEUxT$ $D$x$EMD$T싅xd$* dD$T$$5fEx $TpED$E`$U`fxETUUTE f9xfSxxfKxfUKxEfxf9E$菏thfEfCx$`8fE$7fCxfE륍C`D$C$l1$dC1>Euމ7&EUD$T$$ED`t0E)EF$9|xufM ufCxfEEUD$$fEfCx9D$ D$D$u$6D$D$9$u7:D$ D$cD$u$J6D$ D$D$u$&6D$D$v$ub7D$ D$D$u$5&'U1Uz1tJ8ttB4]fUWVS] uf1~1tČ[^_]ÍvF4$¸ uF4$}D$D$F4$AEC\$D$E$UF4$<ˆFLҍ^MT$D$$4FLU\$D$$~ F1ۉ$%EVf$/%D`TT$D$$D̋D`$iUDDTUF$(9XD`u1렍t&Č1[^_]ÍvF$fEu\`$UT$D$fE$)EE$t$.E$觉Ƌ$P;UUfUFEUD$ E$D$FD$'E$$2)Et$$D$8*UB$9 uEfFxF1U$1]vvDu=U1ۃDE$ uENjt̅t9DGD<$t$D$4|4$uuD$D$$#3$1ED$E$ffFxGF5EE9EUD$ ET$T$$F$AǍ\`$'F$9|F$U$T$ËED$(D`pD$D$ж$<2$0*&D$$EU$T$D$)$!D$$qPWPWP W @G$fFxF5D$ D$D$u$0D$ D$D$u$\k0D$ D$WD$u$\G0<ID$շD$K$u{1D$շD$w$u_1D$ D$ID$u$/D$ D$D$u$/USÃt;@(t:C(u*$C$gC$([]D$ =D$9D$ $#F/&'U8U ]]uE}u} t;1t]u}]ÍM]u}]Ðt&tzL$t$$tEҸt(1t T$ EUt$t$ $JEU]u}]Ðt&1Ҹ㐍t&1WD$ QD$+D$ $6.&'UWVS,EU ]}Et)X1t ,[^_]ÐI,[^_]fUB$~},%C0C SS(7,CuS(;S,r͉$uՋ]S ZGt$D$<$/C$Utt$ |$|$$M1QtE؉t$|$$1E؋U2,[^_]ÐE@ ZWfG*WfGWWWW"W W&WU}}U&C0C SS(M19KuS(;S,rˉ$uӋ}]7M܋SPQPQP Q PQ@C fA]C$! EPP WPWPW PWPfW7] KJH JHJ HJHRfPC$aE1&UMBM܉AGAGA G AGAfG}}MHD$ _D$D$ $1+D$ _D$D$ $*D$ _D$D$ $;*'UWVSlEeU1ҋ] }D$,E$;E@(t GM$Ee$EtU9C D$D$$WuT$WT$$)+fC UD$D$$3uEĉ}ljEu1$t&B0B RJ(7;usS BuJ(;J,rΉ$ީu֋Uu}T$ Ut$t$$u$GFEUD8D"EE;EUe3Hl[^_]ËUE1}ljEU3B0B RJ(7;uDC$#ME҉D$<$L$UC ^UMED$$pUMCu[EEE"$D$D$CP$D$D$CMP$UMD$MUEEE$D$ D$rD$q$E D$ D$D$q$! L$$[ $Ĺ U(]áȉu1v Tfu Xf1t]u]Ðt&$fU蹰uD$ D$D$$tD$ D$D$$tD$ D$ D$$˫ iD$ D$ D$$被U =$n%&'UWVS1ۃEC\$D$E$RED$D$$W@|$|$D$ E$E$M@|$ $D$:E䍴&9uEe3u5\[^_]ÉM$4KrSP$]MD$ D$FD$$<t&UWVS\UUM$UeU1G$qMÍUËECUCCFCFC F CFCGCCT$|$$$ED$EE]$谨t${$D$$rUe3u\[^_] UWVSleE1ȉDžDDžv1҅‰M1 LDž8Dž<ױ 󫍍 󫋅$蹏D$ D$D$$4$g$$$t$L$tL$D$f4$81EtEDžt @ DHD$1= $D$Dȉ$o‹EBBGBGB G BG<Dž8B8D$H$ D$oDžx $u8t 9 OAUDž8Dž<t9Et@ t Dž*D$D$H$LD$D$4$tGD$HLL$$UuDžD$w$D$Lt&9u4$ޒDBH$肨t B8 $ 4$萒$D$D$$ËE\$T$$ t&Ue3ml[^_]Ðt&4$踧E$-m<$%mD뽐t&Lt&$ lȉ1C҉EˆGD$D$D$|$ D$D$$E@1A DD$$MDžD$D$!$:T$$ $DžDk<$k4$艐D$KuD$D$@$\$$1D&H\$D$P$M=At҉A Dž8 @p<1u8$Et$$ k1H$耏$,tH8T$$DU$t$:D$8HML$D$ $юKȉDž8 p@<1 @D$4$U ~1|wʐ$D$D$$T$$]M$ s$`D$ 1Dž8 rBL9‰SD|$F,S$D$eG‰ljUvEEEMUމUUD$D$$Ut&SC9L9‰SD$D$$SC`t&D$D$$S9hD9‰S}DS11E D$D$$XSNCGD$D$$0SCct&D$D$$SCt&D$D$$SCt&D$D$$SCt&D$D$$SCt&D$D$$hSD$D$$HSCt&D$D$$ SCut&D$D$$ScCt&'U(\]u}u<Lu2Px1u2=ȉ@tP]Ћu}]Ít&x8uŀxLupMu@t8u븍v8PJw똍v@d$5@t^>uN>t@F$|9wVD&"x  v  0 A҃^F$k>uUWV1Suq<[^_]É4$Z$ܽD$<[^_]Ðt&UWV1SӁ<eE1% $Xhu 9@u~U VUV 1҅uȉ‰^VDž D$<$蜆FUe3]<[^_]ÍD$T$$^yD$D$<${u$9Y$D$9U9uf $T$x$X$D$#D$$蓆 u_u7=t.D$D$$2L$$}tDQ11~1v|ԁv1o&UWVSÃLF Mԋ}9vK)ƒUD$D$p$ỦT$$(C$<$MUԉ|$$VV4@F5{1t {8Uԉ|$ \$$T$.=tLC`D$ F8|$D$C$5<$EU̅O1҅uOL[^_]Ðt&UD$D$($UEԉ$ FỦ$:F$|C$D$D$$|$ t$\$$<$LŨL[^_]Í&$KǍFD$<$ N$U VD$D$$\$$<$ɲU̍$UUD$D$$O\$$ŨL[^_]Í\$CLD$CM$A<$E|$EԉM̉$UM̉T$UT$UЉ|$L$ $D$‹EЉỦ$KU̅?E$$ UF8T$U$D$ T$E$@KvFD$<$D$ EԉD$y:tGGpD$ F8L$D$GM̉$貼M̉ $E$U̅S<$QJ$0UWVSLxE UԋUEEEBM<t<t/H\u#Hwpta`tVލ}Ԑ|$F$YFvuߋE\$$hC$IC[uUB<tLt?Hd}ԅu6Htyt&h}ԅtgvCEĉ|$$4$E <҃@҃N< ЃPɃ2 Mԉ~Ƀ, MЍO1ɿ`}0T$UЉD$EɉMĹDMD$T$\$L$,M|$$L$(ML$$ML$ ML$ -$%;?t, t31ЃȉD$ D$D$4$FOFt{,trD$D$4$LXt&tc tc!EEC?EtEMEȁČ[^_]Í&C-EWOt& }&MED$ $Ϊ=!,$)҃DD$ED$$ St&4$$|mD$vD$D$$&Ẻ$=$D$M&UVS ] eE1uCCt D$4$C u1Ue3 [^]ÍEC D$ D$4$EED$O?[t$ؤ\$D$4$D$ %?댍vEED$ D$D$4$>FEED$ D$D$4$>Ct&'UWVSl@U8UB834$?FM@E̋A@$D$]}D$<$E觘rEEF8t->EEԅt Eԉ$]F8uӋ@@ ERx8>G8uʉ vC8u@xvuuf룍]ԋ}]t&?FG8u@$D$buۋG]ԋ@$D$\E1t_HuSvHxuQzvڋKIy9zMuɋI9JuMI8JuǍvCB$EAE$EUԋMЉD$ẺT$ L$D$C@$cA$EAE$@UȋE̋MD$T$UD$L$D$ D$C@$D$k$UPSE$_S$ECtC$ËE$D$XCG$^G${_>Ef1UЉ$FD$D$$p\$$7$D$D$lǍvMЉ $D$D$8$\$$>EE1$@Mȉ $Yt }ԉ<$YEăl[^_]É$$D$$?Eȉ$Y빉$$-D$͋]|D$ D$ID$$\D$ D$JD$$@8US$]D$C,$8D$C0$8E t#EED$ D$D$$9$1[]Í&'UWVSLD$E$@M@ɉEt0EP tuRz1thR8wZuD$1D$H$6$Eu܉4$$(>L[^_]ÍE؉$-f7D$D$F$Ȝ$8EE]u fҋtbt^K19uy1tO8vЉ4$=D$<$x[uu=1uljuM$D$D$$ $y$ =Egt&PD$D$$$1D$D$$蝛$D$ DˆCuD$D$t$\$ D$D$$ PBD$D$$$D$vEmE<$6D$D$u$\$1ۉ$*U؋B8==D$D$b$u$uD$4$rYc;EEt&Eԅ}ut&ҋ?tjtfO19uIy1tq8vЋUA4A8CA<$<$D$$`=~<$<$D$$UvtD$\$$|fE$-<,[^_]Ðt&f1^UWVSLEЉUEEX<$tEsZv<KSt <Ht<?D׉L$T$$uƋUBH/B$UL[^_]Ívɍ]t$D$D$$$`1҉ߍs]ȉE td<uG$4D4IWc7҉T$$EEԉEuvEԉڋ]ȅ$D$D$$ $}1҉ߍs]ȉE td<uG$aLdWc҉T$$$EUԉUuvEԉڋ]ȅ$D$D$$P$]1s}vtd<uC$\klSc҉T$$\{EEԉEuv}ԅUBH<tI$D$D$$}$UBH1Ҩl,$U}̅U̍ED$D$B,$谻t u_È8$wD$D$$$SD$D$$迓$gŨ|&t $O $^$}mD$&t $O $@$}mD$&D$D$$ $|&$.0dUBHwv$O <$i$}mD$ vE$O  E}E$O EE$O ED$$}mvD$$}mvD$$}m/v$|UBH$at&$h$}mD$<&$$D$D$>$萑$E$D$$UQWSv\W$O UWVS,UÉȃEE &tjC8 uC uEpt{t܋UE܅EۅE܅u9C F,U$ T$&,[^_]$FD$FL$$UES}IUzw ~D1҅t.H9u&Qtt&P:uRuu11ɉ} vE$D$UT}Ut$$w$.D$'C E$D$  D$D$$q$\UWVSЃ\ R4$jD$4$]ED$<$E@@$D$JۉE?S11E11E0tttt:Kt0tS uƋqMԅt1C Džu̍Ẻ$ Mĉ $RIEȃ\[^_]Í&QE؉D$$U{U{vIMЋI9MfEЋ@9EWMAD;FLE}1UD$уL$M $ԯUEEЀx.D$D$$mML$$UMU $UD$ D$D$4$4$EUU$5U$EgfD$D$$̌$D$<t{4$kE]E;D$D$($o$E!MЍED$D$A,U$óUt }}GM̋EĉT$UL$MЉD$ED$ D$t$ L$${UU$EGC$JC$mU{E8E$D$E<$D$$UݼU}D$D$H$$T$D$ E΋uԉL$|$$t$ǧ$pD$D$=$)vt$$蕧$艧C(~{$$+pD$D$?$ut$$A$5$pD$D$$ut$$$UŰB8=$uŰB8D$D$$%$U荦E̋Et&}UċEу$U|[^_]ÃsZ$jEC$ea$[nM̋Qq҃*>T$D$ E΋uԉL$|$$t$Υ$FnD$D$=$0tt$$蜥$营$nD$D$%$st$$^$UR{1|{8o$=/D$D$=$s$ CL<3t#1D3M$D$CL9|$Ṳ&$xmD$D$%HMA ZEEC( &C$wC$2$ƸDmD$D$$ErU|$ t$T$$ <$U$xmD$D$ eD$$ D$=D$D$3$rML$$舣$U|űF8D$D$H$q$D|[^_]Ít&D$4$TEM $1sD$D$)$)ƸNYqUT$$¢D$t$$誢UJuEEEC(>C$yut&ESM;ECUM$EMjUM|$D$T$UԉL$MЉD$$T$L$ mF8xr$:D$vr$ D$vD$D$$ $6xNƒttҋYUT$$WfVG?&?:rD$ED$T$ $rC0r$iD$Zu$@D$D$E$mo$ݠ$UѠsM  D3L$D$菠 ~t&C]ĈE{=m$rT$$tNr$rD$jtE} ?G8 u@EHEԅKD$$mkuԋV0Eԋ@4 EuD$D$$k&uԋFFD$ F D$$D$jr$:D$ssr$:D$^sr$:D$Is}w MԀyDuԋV<t{1<N}Љ׺St<Ht <Z?EЃL$ 4_T$D$$'j<_t(r$ D$r_SN<u밋}ЋUBHxuD$$ir$:D$jruD$$t$iEԋ@,Uԋr0MԋY4GucuHr$:D$rr$ D$qD$$&ir$mD$q롡r$sD$qG냡r$eD$qar$rD$qq9r$pD$WqD$$hr$eD$$qD$$[hMAHhD$$;h.D$$"hUD$ :BD$ЃLD$r$zD$$uEU$UrT$opEE}qUԋMĉT$ $_$ D3L$D$͛D$ D$ $jUWVSleE1l8Et 1ۃ}q=ȉDžPLED$ D$D$4$<U҉Љ`E U EDžpDžh ЉXXDž\u=h" hth$6$`B$D$=$hhED$$]ldlt&PPtuPuPu苵l1Dždt&t 6Vc u1FtۋBD$PL$T$ytF@P0P4d) MtdD$D$$gtT$$RD$D$$g$D$uf1t$^6t&l1 tP: uPu$U輘l1ɺD$$k$U菘pBd‰t9Lk D$D$$f$? $&D$D$$f$D$fDžtt35 D$D$L$pttPD\҉\tA=ȉu8uhDžPx vpDžPz> t&du  TM ƅGƅFDžHE$xlh$[D$D$$Bet$|$$誖4$ut0$U菖D$D$$d$kE bTTTu5$U1D$D$D$d$ t&$Ut u0D$D$y$Vd$D$~tblDžp w6tVu6Rpu狵l6tF t4$购6u썶`҉`rE$hth$Ue3<[^_]ÍRBB9EB9EG@D$PL$T$mdtF@@UEF@h$YD$D$p‰0$b0T$t$T$ t4D$D$$yb$uD$hB,D$B(D$ <(D$2D$D$E$gUT$$?߿gjRED$p$XXU9UaE;EEdE\d\2t&FpEEU EEFUGEHUEdf \pD$( ЃD$hT$,D$$D$ D$D$D$D$ F@T$U$D$x8P$莶UP$躩4$D$D$膪lDžpXh$VD$D$$L`t$$踑[vD$D$`$`tT$$肑d tJ$U^D$D$$_$yD$vfD$D$$_$vD$D$$\_tT$$d t$U螐D$D$$ _$D$2HGv@@D$D$$^tT$$'=$U D$D$$y^$D$f$Uď6&E$=eh$]TD$D$$^|$t$$o4$跴$U[D$D$@$]$7UE DžHƅFƅGDžTfp$WD$D$$T]|$$DžtD$D$$]$D$D$lj${st!pLDž\R)‰t<$艳t~@LD$$etQ$UD$D$$^\$΍Tn$U赍D$D$l$!\$葍1=`\$UiD$D$$[$E8D$D$$[$D$D$ا$[$$UD$D$F$S[D$$軌D$D$a$'[D$$菌$U背vD$D$J$Z$$D$Ɖ$w<1t<24$~묍t&~uƅG<4$c$UD$D$ $sZ$$U׋&D$D$J$D$D$$V$D$<8u%=$GtTt&D$.$%DžT4$UT$,t\D$(  D$T$$LЃD$TT$ hD$ D$T$FU@$D$pD$YD$B4$d$vDžTO$d衪H<[^>@]+[@f@.]@ $W@t}d։4‰ˋHt&tJJvJv0 v8\8)Ńd\$$Cu4HH8$vVHf>$@WE$ll t&t P:uRzvDžPDžPh$}JD$D$aD$i4$"FDžTD$D$$StT$$HD$D$,$S$YD$ܾN t$RD$D$|$iStT$$τD$D$$;S$;D$cuF@ xD$D$$RtT$$\=u_F@D$}E4$x!uDžTgD$D$N$R$4$ID$D$<$`R$"D$舽mN t$DždDž\lj$kD$D$$Q\$$QQ<D$ D$D$$PEU'UWVSӃ,RrU\$$T$5U %C1ۅtU VT$V T$VT$VT$VD$D$$T$ ,Nf~$:uN~t%<$RD$ :|$D$r$`<xD$ FD$$D$Mt4$,[^_]ÍtK tc!M?C1ۅUt&C1ۅ-fFD$ FD$E$D$M&UWVS|EoUr>E Ӹ&t{t'sKρ {tEtًuD$1D$s$XO$Ȁ|[^_]Í M댍&FUE$*UfE@SM1A@$FD$D$$N\$$1]}t*SK%C .tҋu$U]C tCxED$ \$${@P,>B#BD$ B D$$D$J$ MKE1ɉD$D$$G<$`HD$D$L$M|$$~D$D$l$bM$ D$芸KN]1K tLtrCtuD$D$$L$\~K uq$C~FL4$D$!$U%~uf1FD$D$$zL$JD$袷D$D$$~EM}ЋAˋ@E CtC8uED$ \$$AEUGG GCU؋@cE$|á‹C@$UD$)DU)D$D$d$jK$I5t& q$|FL4$1D$节$U|jD$D$$J$7D$&D$BL$D$lD$D$$EJUĉT$$|Mĉ $MU<$DGM$d=D$D$$E=JUMD$T$ UĉL$$T${YvA$Eq{Ej$C‹EU$$oEPH&D$ D$$=88$ 4ut& P: u`$E( {)()ED$ $Ol)$ҝD$D$$\=t$$<E4$2Eu}轓D$D$$=$pnu聓#"~EE3E蓓"$D$D$T$t-D$D$r4$S >uӋDPT<$D$ ET$ L$ME\ExTp1EEEDžxDž8‰DDžPDž<t&TD$|$$薅P t̃uNjRRсt0uUT$U$‹TtL$MD$ ?wtD<&<$3\$$aT$ L$D$j6uT$UjD$D$<$EHtEt3Ft,D$D$$8|$$WD$9j~u$U#jD$D$P4L-( MD$D$<$W8$QD$ybD$D$c$8$D$>ECE1,s<8yD$D$AuqpD$D$$u7$>D$蝢 uVE:1ɃZL$4$yEDž(Dž@v<8ED$D$@$v$F D$D$d@$M$F<$$.D$D$\$ "D$D$p$y $ $${ D$ D$@D$$J D$ D$7D$$& $`l$D$` $$$\$\$pD$ L$D$ |$T$$E=zUWVSLE]& Sur4$EF$ 4$S:$|$ D$EʋUԉL$$T$<4$D$D$=$ |$$[<$O<4$D$D$%$ |$$<$U<D$D$4$I$U;v] vtRC8 up$;F08F4eFL4$D$A$U;uL[^_]Ër4$-EF$4$K9|$ D$EʋUԉL$$T$";4$D$D$=$ |$$:$:4$D$D$%$F |$$:$U:D$t$$޹$U:t&D$D$$$D$L:&D$D$/ƐUWVS]eE1xDžt$}C$蓗$t$D$P<$菃t$D$D$t^t$Q<$艃؋Ue3Ĝ[^_]Ít&G0G WW(D$t$щGuW(;W,rʉ<$:uҋt$널t&<$$xD$D$$ƸD1>\$t$$ t& 'UWVS]eE1xDžt$%|$$KuWt$D$D$t$ŗ<$؋Ue3 Ĝ[^_]É<$؁$HD$D$$ƸD1\$t$$ait&릍tDž|E0t$D$P$ *vG0G WW(D$t$衇WuW(;W,rʉ<$ uҋt$UWVSlMue M1ɉEEUU EEEUufE}D$|$$PStu͋REЍ}ȉ|$D$$UU}uutuĹ}t:MtuĹ}t$EquĹ}^z1tZC8D$D$$2$t&Ue3El[^_]Ðt&B8==uBLu^f1QɃ09^ۃ0 9HHJLLG}\Gm9tM~FɃ79~Fۃ7뗍vD$D$$$$BLMB89EA1ɉUJU<9p~ xD$FD$<$<$ۉtEuЉD$t$$EtNt1ۍt&$lD$ D$D$D$ol9]w|$$D^Ee3u.Ĭ[^_]fED$puЉt$$a2v'UWVS4$}eE1<VEBEf6.V: uRZ@tZOÍUPt&UVSp]eE1VC4D$DC0D$@C,D$] v?G uGPuы vtމC uSHvtuًBD$G@$,u$<봍t&UD$$=tf@@$D$D$$\$$7,[^_]Ðt&]9E1$=UUD$$_=t@@$}wUWVSEEEpMtEeU1҉lD$ $< @]@\$x$0ED$ $M<át=X5XtW-O E$:$U"E$$U"D$$ s\E$E @h~E$s4$fBE D$D$ D$D$E$2vOt&1ۉ؋]e3ļ[^_]ÍE$6x$D$D$N$\$$`u$D$D$d$$ct1ۃ@\x$x $\PxA$<Ƌx$ \|$ t$$T$D$t!C@PLD$lqT$$lq$ D$wED$\$$D!UD$ \$$(4@ED$\$$dw =GP1L$D$уL$ U$jd`D$D$$3`|$$L$<$?@$D$Ɖ$  =~24$AD$D$s$\$$GE4$D$h$H4$D$D$$\b\|$T$$4$ T E txAB<wA pt,p$>typEPEU$E x]L$$k$}$U|$$EED$EwvuEM|$ $NA$lGƍE$D$D$<$t$|$$AU$@@$!BCPz!8Pu EB< <(t<uYUuRE$ZD$D$$\0\T$$<ЉуHfM $\D$D$,Ӎt&C}̋@E@Z$:x$EED$ED$ D$D$D$ED$E$E$D$|$]t?u1ۃt&4$D$ D$D$D$R;]r͋U$Mf E $LD$W]$E\$lB$d; i$<.bC5{$DM $ID$D$$#t$|$${Eȉ$p-M $EM9JE9BED$\$${=$CM $\D$D$t&E$eD$D$$?\$1ۉ$C8 PE$D$D$$t$${]$.CD$D$$\$$4$gu 두?tW tuB@<(t<t܋3u%+t&@D$G@$t6tF8 uى<$ &D$$ƉD$&NOEz]$D$D$i$\$$ E9G }tOUJ=t?M $KD$D$$\!\T$$ ]}1p]8u3t&?$W uBxuڋU2ut&6V uBxuڋWR$T$蠝u늃=E$bD$D$E]8p2K]Et&6V: uu 1ۍt&t'C8 uRT$@$蔝Vσ: ]CuvS؋ut&?tPG8uH<$#$D$$\D$@$\ÃH@O8uE몃EMpߋ]0\}Elvtk6Fut6 &t%C8uVRT$@$荙uً벍MĉE떐t2t(C8uVRT$@$uً_MĉE@lׅlGcGt Ppu?&t7)SuBD$G@$蚘t#SuɋBD$G@$7uGsM&t&suڋUJd!~JpguڋIFY9XűY9XuċY 9X wY8XudX?}}lh}u}u}u}u }EȋUD$$"|t==ttUPEAEAEA8EA<4t2}Ѓ}у }1Ѓ x U$EȋPUM $fsEfd$D$<$ƉD$L NKEEUD$\$ \lxD$D$$pM $D$D$LU<$MD$ $ƉD$NE=E$D$D$$pt$$w$5ƍE$RD$D$h>M $\*\D$D$$<$ UD$$ÉD$KE=M $]$D$D$$t$\$$ 4$4+;D$D$$K]D$D$$*$u4M $xD$D$$t$|$$JED$ED$ E D$D$Eȉ$y^'D$D$p$XE$}i}}ă|}4}}?}4$)1{D$ D$]D$ $8EED$ D$\D$ $E(D$ D$D$ $0tx11=uNU$LM $?D$D$$t$|$$4$(t1@.D$ D$-D$ $\WD$D$$ E|U\$V\nM $~D$D$`$\T\|$ t$T$$U$2D$D$<$ D$ t$|$$E$D$D$$\\|$ t$T$$@uM $D$D$$zD$ t$|$$/M $ZD$D$$4Ut$|$T$ $U$D$D$$t$|$$wE$D$D$$\\|$ t$T$$+8M $D$D$$et$|$$M $MD$D$$'Ut$|$T$ $U$D$D$$t$|$$jct&UWVSEEUU Me M1ɉEUΘ@11t&$#@MD$ tD$ |$ $*tq$ {.$D${4$s<$<$$ Me3  Ĝ[^_]Ít&t1G't&G@$a$(=#WBD$ WRD$T$U$z<$)G& iԐt&t&<$4$D$$!-vGx  <$1҉&Éy1$UwU$<#Fu @x D$D$k$/\$$4$EQkd9u t11i<$XD$D$$\$$H빍UMD$T$U $MNÉ4$Yyv1xD$4$X @@EUED$$D$ 4$áE@$#MY4n4$OE$账U$D$D$$EUT$$MA,,(U1<$x{E PU@$E UT$E$ $]MUȉT$\$ $EjEȃwfuEE\$$]UẺD$$rrED$t$$aE̋J ]t&K uAD$F@$>uʋ]f$P)D$D$I$Ut$T$$/$$)EM$վD$D$$E~MUL$T$$v $荾D$D$$E6U\$1ۉT$$t&M $EE$7UBM$裴EE$MU$.L$ MT$D$L$Pt!C@PLD$lqT$${lq$ D$>kq@E$D$$q$'M $EAD$D$<M$UMT$L$$jU$Ẻ$TM $)X$D$E$Mt$ $nU$YAE@( $EE$SUU$M $6D$D$$$\$1ۉ$jE$F&EU$D$D$$EUMT$L$$E4$D$D$Ẻ$vE̋UD$$ E$AUMB  $`)*E$n%M $ED$D$h1RU$ D$D$$\$1ۉ$ $$D$D$$z\$$U$&$$M $ED$D$$E$UMT$L$$vU$M $ED$D$$EMUL$T$$SE$xa$#E$U蛶D$D$`UE$IC=UEEU}]uEUD$D$$]xCt p$$EMNjCy8F GFGFG$BEC~D`$cDp9]U$ MtMD$ $F $ ۉEU1M $pD$D$B$EUT$$$U"‹EU$UD$D$$EUMT$L$$ }}]u:$1ɋUD$$D$ECM $ E}]u$ D$D$u$ D$ D$D$ $_t&UWVSÃ,EUM܅EtMEM؉D$ED$E $EEEuA@E,[^_]Í]܅-M"EE1t&4$O$EڋM؉D$ED$E $h4$E;\$ D$D$$/EtE$K \$$D$G;}EE$5ۉƸD؅>A$觻D$D$$yt$\$$Ѿ눍&U܅E4$:ۺ돍$o4bEvE؉$E؉$1'U$U M]t$uEM 1ɉ]$ut$U1]t&UEUM EE1E h&UWVS|EU EEUUEeE1EUt!uI uU$Ŀ tUe3|[^_]Ðt&EtED$D$Ẻ$觹t-E(UED$$T$~$]G\$EEĉD$E̋@@$Eă U\$$}EȉD$E$Eȉ$UEMT$U$E÷cEȋUD$$)G$7NjE$:D$D$$贼|$t$$ &}yED$D$Ẻ$FRUEEUt&UED$D$$VCt x$$|EUƋCr8Dt$<$UtGF G$>}uqu1ۉNjDp$bUD`9F1EF8$ut$UD$$6$uu܉E묍EUMEȋET$U$EǵUD$$t@$HD$D$$Һ\$$)&EȉD$E$nukEȉ$Ẻ$E$Gkf$D$D${)T$D$$j$U$I諽UWVƃ@eE1r$wg8UԉT$@$®P1w!$ & }Ue3@^_]Í w8t\U܉T$UT$@$S돍& }랍vU19V uE9F닋U19V{U܉T$UT$@$藶0UԉT$@$^zfUWVSEEUME $s1҉EEvu1$ ]EE t`Uč{<$D$臔u$#D$D$$E0U|$T$$腷uuEE܋UD$ uċET$t$$E}UED$$EED$$@uԋXt$$r}VE 1EEE&ED$ED$$n\K= E܋učp t7Eu }Eu&=ttuAx5?t&uL$4$Cu1.$D$C$mD$еEMtEt&؋$ uEĉ$ U$>U3Uu$D$D$ $$耴EČ[^_]fKat&E uA1DE Ax p$@1M& @9|M^t&a(Ty$|$NpƋCpD$D$L $$肳4$~Xt+F8=t!=tD$4$s.CD$E$ASz4$EoE&SUU-SYYẺD$B$EŰMЋE ;Pu9HufA@E1Bu8tsvH9u‹uU1VUuEu]‰'Eq]}1]$9V;utG tU4t9u]0t&D$ $ KƋyEut&hẺD$B$FE NE D$D$ D$D$E$h=vAUp8@8$L$?SRr8Uԉ$kD$D$ $Et$$ѰKE{1tR{ {84$ D$D$$ 9u E$?4$ҤD$D$ $謱\$$8FD$A$KvCx4$U~lU$D$D$t $=\$$虰UUFD$A$K4$ D$D$ 5M1Eu$!D$D$$諰\$$9D$$$>EE ]'UWVS@xeE1<HDDžt߱ 󫍅tD$D$$dt/Dt$D$P|t$+uitC^D$D$H$l|$\$$Ī]u}]Spv]u}]Ív$ D$D$$ME UM\$T$ L$$ZoYUVSt#tf$-u4$[^]Ð&U($]Éu}Ju]u}]Í$ 3[D$D$x$M|$ t$\$$衩]u}]0oUSdcu[]É$b D$D$$\$$H$lUWVS˃L2EU܅NFFzw+\f6NFFzuׅۋAt ;9xPʉσ0uMtHU t&t9Jux9zuED$t$$FAv ]N6Vt&U܋2S:CCBx P@}؋}܉UEH9Sމ]ċzVztlH9tdPtuߋI];Yuԋ];YùPW<QvQ 9UwHƋU؋yut&]GNL[^_]Ít&q;  ]S9P7t&vNt&U܋FF6ut&D$D$G,$ $p9E rEN6U+}; Cދx _uxQ` WQu{;] }v t&|Qu8I ƋPM؋zN;] 3y9U 4f뻉9U t&st&US]PSPxx[]ÍvUSD]eE1EЉD$$t?D$D$$裥\$$Ee3uD[]Ðt&E܉$]UlU uEp1t$xt1 UStD$D$$D$腣@$*D$p$d\$$3T$0HD$D$\$蔤$$[]Í&'UUw&$`vD$D$T$E 4$EED$ED$菟}fE $D$EԉD$]E;E SfvE $]D$5F&'UleE1t]pu҉}u6l\$$?\tEv Ee3]u}]Ívt{Xu`ƍcW5t/4D$D$$轠t$$Ib&hu}rvD$t$$P} uEԃuπ}u}u}u }D$E|$$ u<$D$D$$T$$uPD$D$$輟t$D$$;x$ st苽1 󫍅$t$$7ti4$;D$D$($|$$衝4$ D$D$\$t$$oZ$$D$$$$$F[듡xxh$$sD$D$D$$貞fU]Éu$t$bt!u,> tF!$D$g؋u]]Ív$@$D$@؋u]]Ít&UWVSӁ$XeE1ǖU`GPE؅t\Ud E\ {duӋEEC$EC(E\fXEՍETUe3Ĭ[^_]Ðaݍt\t&\1l9SDžt E MJMJMJ MRUU؉E؉UN`19E 4$EpD$ED$əEßt&'USDeE1EU1tuEUe3uD[]`jfUSDeE1EUs1tuEUe3uD[]`fU$]u4$@u9CË]]Í&'UEE'UE?wÍv'UhEUuu]]EE}} UeU1҉E1UtEĈtEȉ}tE̋Uut EUMt E‹UtEÈEe3u ]u}]ԝU$ Rt`Ít&UW1VS$ueE1ͭDž$<$|z$h$\6Džx t9D$t$$IuME u؃}tԉEEu EtEEEY똃=t2D$D$$ژ|$T$$\=h_$y# ‹|\FH ft%C8 uP1ɋ${uۋCt9211ftZC8 uPCuu tٱ&F@ $O|But&p0yD$D$$ŎlXdhT$$pL$ \$t$T$L$\$ t$T$$t9 ht; Džt?G8 uGtt$@@$\%t ft;Pu;Htu`NjGG@@$G@@$FG@@@hG @@@iG @@@lt$nGvttf; tn9Ut_DžDžlDžXDždDžhDžpDž[[$v{D$D$0$U\$$豋7$1|IFx $10tE\zo|dUe3| [^_]Ë`L$$L1Dž(DžDž8P"v҉P uыBH0uЋx4uɋ8t PRB8t ;$'C$C(D`uZDtP t> ~uB( B$$@T$D$ $D$[$uO,D$D$ D$t$$迆 $迄$1tIhpE,D$D$$\L$ TD$L$謉$T$$$=JɈT`B 9Fdp{ Ή8rCXaB`AiFAhB!Al8PskA$;}I(; }ut JJJ`Ft9>DžH11Dž4։@D\.tT \T 94tDDž4ɉ(O@@0D$$Dž4aDžtx$F1t\|t 9<$<<t;$kD$D$4$\$$QH1`Dž8F$3DžH119c$$ @D$߂$1$$AD$贂$$;$軌D$D$d$\$$葁=DžtQD$D$ $$Q(T|>$T T򮋽H DžHу\TD$ L$PA@$$|LD$舃$S`D$AhD$ BD$Ai$D$B$&USvJ05v0D$D$p$|\$$[]fǍ&[]AUSvJ05v0D$D$$ \$$[]fǍ&t t1[]f6t%9vމ$DD$D$dD$D$$|$ o&U`tXuĊtÐt&fzv'USTeE1EUu/u^}u01ۀ}u(Ue3uvT[]Ít&1ۃtDfEEE v붍E$D$E$D$}v뤍t&t&'USD]eE1CMt<Ue3uRD[]ÐsU@v D1ˍ1t}x CM벐t&CM`&US du =v []Ívdi4t辅9wًĊu0D$D$$\~$|1[]@D$D$$`"~$|l'UWVSEU deE1҉\t$v&ld\$$tdl9P<$hd<|$`$mt=v`UP1ۃtE؅tdX\{uEt6 tFuE9XCXXEuːX}HdBM`؃ J(E؋d9td؃@R(E؋`@$uidz$u\5`؀E؋d9`t`$9 CA1ۋUe3Ĭ[^_]Ít&뜋p9P@ed=``$v<$n$4$$1ۉnt$ |$$$D$z<$Rt&dˀ@M]}~&UU Mt`B0u9tA(u.B4uwɸtT$ $vRÍvD$D$$zfuD$D$P$zÍ$|D$D$$zfD$D$$lzfD$D$ $LzfD$D$$,zfD$D$$ zfD$D$$yfU?Ut%E $D$¸r u ?v Í&Í&UEU t@T$$t uE&D$D$$LyfÉ'U]Ít&'U]ÍU]Ít&'UWVSLU] u}B8`S: 0MEDRɋEEEMȍKM̋J@EBHJ4EtcH9u[UċUԉuủ}̉߉t2K9u*Au$@HHuԍUԉUċu}̋ECPEEȉBHt L[^_]ÍvUMB 8M~U܉T$@$7nE1ɉD$D$$;EG8]&PM9JWMtRuA/DڋMȋ@QR$LU8jUЉ\$ $T$D$u<$E?t+G8u#sWut?uٍt&EԋMẺL[^_]Ðt&M9JCWufJ0 xyfD$BUD$BL$裘UE̋B0B4ucD$D$$7vEċUB@$mM$L$ D$ẺD$tỦ$t&D$D$/$uED$D$$uEwD$ D$D$$tD$ D$D$$stD$ D$ID$$Ot&UWVS,u}4$tu At:Ct0 uE\$|$ 4$D$ED$E D$uƃ,[^_]ÐU($]Éu}u]u}]Í$3[D$D$x$mt|$ t$\$$s]u}]P9UVSPeE1 D$$D$#q $uX ~#&r$-D$y䡠r1$ uD$yr4$D$D D$t$$$tԋEe3uP[^] wt&UWV1S\eE1}z$5D$D$$/s\$$D$+pED$D$4$f#uR} u܀}t֍]vD$$D$o9uED$$D$o됋Ee3u\[^_]v&UWVSEeU1҉xx $=rDžtDžx|| $~m$:Z}Džpt&|D$$|$o<#tӄtωً1! t€D֍qD҃)ـ 2<:u *t&t!HvHЀ va<w}<:u<:uo)؃( D$D$$qD$D$5$pxt$T$$Ipt&D$D$$pD$D$5$pxt$|$$ovL$D$7=$uD$D$D$D$$/pD$D$5$px\$L$$co|$mvtp}e3=Ĭ[^_]Ë1Xt&TC0 v.Ag7WgGTЃtyC:tYJЀ vri(P$iD$D$$n\$$Onwt&Du}UЉ|$$0UM9~D$T$$XmEEDžpjxD$$lDžt|i$t&i$jD$D$0$mx\$T$$=mt| $n|$nAi$iD$D$$qmx\$T$$ltV$D$D$|$+mxt$L$$}l D$$k$D$}k1} E E8=pU14$u |$> t4$|$]Í}4$|$]Ív'U(D$ ]Éu}@D$D$0h$r!Ѓt~C D$0hD$($i(g$g[D$D$l$k|$ t$\$$k]u}]Ð3g$g[D$D$H$hkt$\$$j]u}]Íc1]u}]Ðt&Uu Í&$ uÍt&'UWVS,5}] 1EE&Dȋt!Pt9x+tvEu߅|I1yQ SQSQS QSQSQ SQ$SQ(S Q,S$IQ0,[^_]ÍvEdEE=E5EEVUUUE)¸DЅ}1ɋ}܉] 6FƒuD΃FuՉ}܋U܋}]UP EUu!(։tUPMP CACAC A CACACACAC A C$A$,1[^_]ËE3EgfffE)¸E‰E䡐x1҉]6t0F<u8eDހf-muʉڋ] LuJ1z J KJKJK JKJKJ KJ$KJ(K J,K$JJ0}܋E܋}]ࣘdD$ "D$D$. $@ ft&$4ļHx H KHKHK HKHKH KH$KH(K H,K$HH01D$$uj5ZU؉$U؅1uD$ "D$D$. $@ e$ZfD$"D$$. f&'U]ÍU|]ÍUWVS<]u CD$G D$4$D$ b  P&t$ 1D$D$$ hD;D$D$4$D$ lbu׋C,D$C)D$C(4$D$ D$D$ 8b<[^_]à tbu9t$ D$D$$R Nh<[^_]Í=4$D$ D$ D$a<[^_]Ðt$ 1D$D$$i gDD$D$4$D$ ua u؉u E <[^_]zjfC4$D$Y D$D$ 9a<[^_]ÐC $nD$(C D$$CD$ CD$CD$CD$C,D$C44$D$D$D$ `<[^_]Ít&C1D$o D$4$D$ `&DD$D$4$D$ }`uvt$ 1D$D$$ fD;D$D$4$D$ $`u׋C(D$C,4$D$ D$D$ _<[^_]Ð&UWVS}eE1D$|$$~`]؅U0hD$ D$D$$xi!уD$(D$ $T$YƉ`t׉dD$0huD$ D$$h!Ѓ0htD$(T$$_(]$*^D$D$l$a\$ |$t$$Pa$4|D$D$$at$\$$PatD$t$$E<$Eu<]4$xUe3Ĭ[^_]Ív$\|D$D$@$a\$t$$^`\딍t&$\2|D$D$[\$\D$D$H$`\$t$$_$|D$D$dc$|D$D$k[$0\$D$_D$ Z"D$D$. $ ^t&UWVS]eE1=0hs^U1  Eb CC$KEC(MKEC)M‹KEC0MƋK EԋC,MʉM։M׉M؈Eٍt&4$T$Du ; =Ue3[^_]à tRtD$k"D$A$. :_f=uۋCMMMEn1ߍt&L\\\L uՉ.cvvKC$MKEC,M‹KEҋC(MƋK E։MʉMӉMԉMC-EC.Ef&EgCfEgpECECECECEċCMȉMɉMʈEˋC M̉M͉MΈEϋC,M؉MىMڈEۋC4MMMEC߉MME1ML\\\L uՉS1840ÍLD8984:D$ LD$Ӊ,@$ ,)։<P94/LD$$EPETEXE\E`EdEhElEpEtExE|EEELD$ L $@!ZVƉ$$D$Z74L$PQ$$D$ZƉ$Y$D$YZƋ<Љ tG @!0L$ \$T$D$$8 Z$Ou04;d^~닅`toLD$ T$$ 1뻋`LD$ T$$ c1PT~밋\94D󫉕,DžL ud\4hL$,ub\DE$O$輹$D$X2É$蛹$hD$X\$y$D$yX4TL$ 4$7$D$7XD$k"D$ $. Y$$hD$WtD`ÍL$uD4󫍅LDžL \d$Q$$D$Wv'UWVSeE1t Ue3eĬ[^_]Ðt&UD$T$$zEt믍&0hD$ D$D$$ ^!уD$(D$ $T$ME@dtt&1Džt ]4$uJ;duэU$t"$2|D$D$1uՋE$|D$D$p$Vt$\$$VYD$ I"D$~D$. $ ZUQ$KR$D$U${|D$D$w&'UWVSeE1=0h|D$$BR0h|uډ$ t&0hD$t$$T Q8tԍxD$D$$Ee3[^_]ÍvPËf ]$ Q|D$D$$Tt$\$$qT[!I$蹩D$ D$D$á0h$[!ЃI01fED$0hD$($tS(}u9EkM0 M M ȉ:EBBBB BBBZzN|D$$#P0ht1D$D$ $mS$Q=0hLN8$Rt$$!Q0hD$ D$D$$Y!Ѓ1t&(u5}t=ED$0hD$($QuLN8t$ BRft0901҃v9}ǃ9uUƉWUʉW UΉWU҉WUGWj&0hD$D$$[U V t&#v1ҋ0@4ЉDž,t&9{t싽41󫉕(RDž@ PCTC XC\C`CdCh@$](,cDž,^ D,$D$O0$貧t&|$ |D$D$ $P\$$@PkD$0$զ0V0|D$D$c!D$ ~"D$GD$. $ ;OSK$'L$D$OK$L$5!D$|D$O|$8D$rO|$N!D$]O|$dD$HO&UWVSlE eU1ҋ]=0h}E1tBt;Zt}uD$0hD$ D$$U!ЃfJ$KD$D$x!$N\$$LNEt& MEYA 0t99t5t$ |$\$$N!Ue3Pl[^_]Íz B}FwTrĀ uWu1fD\ \ \ ؉D u1념t& sx>|\$ t$$ D$KM!AƿF*18UMRQ}UWQWQWQWQO W u O  O  ʋMQOW O O} ʉW NV N N ʋMQ,V%v""I w#} ʅۉW4}D|D$D$!$L}\$|$$L!]E ljHKHKHK H KH$BG,ZBJ Z ȉG(BG-BG.1<&}JuG O O ȋMA1ɍvD\ \ \ ؉Du1*UM]B Q Q ЉC1]E ljHKHKHK H KH$BJG(BG)BG0BR Q Q ЉG,15|D$D$$ K\$t$$aJ!W5|D$D$!$Jt$$)J!0hUT$UD$($IUƃ(F$FD$D$$RJ\$t$$IMt&'UXeE1E]uD$D$$^uUe3Eu ]u]dM$$|D$D$$It$\$$@IUXeE1E]uD$D$$uUe3Eu ]u]L$蓩|D$D$$It$\$$H UXeE14h]utUe3um]u]ÐED$D$$ uHU1;t 4h뵍t&U;uU;uE;K$詨|D$D$$-Ht$\$$Gt&UVSPu]eE1D$\$$Ou<9ut.u܉$udUe3uP[^]Í&17K$|D$D$${Gt$\$$G$軧|D$D$LUWSPeE1]D$\$$yu0@N$EءEѡEҡEӡEUe3uP[_]UJ'UWVS=0h1u 2ft*C<utf[^_]Í1tuס$uf1[^_]Ít&D$$u!Mv$$bEfUWSPeE1]EL$EEEءEѡEҡEӸFˆEcuUe3uP[_]H&'UWVSl eE1];/D$/$A$D$GD$$D0;@Ƌtb$@D$D$!$lD\$t$$C$!Ue3yl[^_]Ðt&U D$/$BD$$Dt $D,D$$C/|$茚|$?D$P <$D$?D$D$|$+|1$: =Bt&$`i\$D$$EHD$D$$E$t&D$7$A<$ECU $C|D$$%?0htrED$D$$1ۅ5|D$D$!$Bt$$@|$7t|D$D$ $A\$$lAOE|D$D$!ˉ$D$D$$At$\$$A$w=|D$D$D$D$t\D$ "D$D$. $$@U]]ut}eE1D$t$$6uPt twUD$T$$ E؉]Džt]؉E4$t Ue34]u}]ÐE$eѐU,2$(L>98D$ 鍅< D$Ӊ4$X uu)ȃ@0ty9,t|lj$蹟$D$>$$DŽ@<$:Y$h$D$h>lj$I$D$I>d ً$t80!4L$$hD$ (T$D$>0,vP;Dt8~싅PvUVS0u eE1E܉D$E]\$$8E܃wuEt$$IUe3u0[^]>UD$D$ $:$6:衕$UWUWVSӃ|EEeU1҉MEE$>JMUT$NjEU$EU  1Ƀ M#4$膚D$D$$:U\$T$$e9D$B$-豗<$JE$>Ue3|[^_]Ít&#EnD$ D$T$<$OHED$<$GKЃD$E$T@PED$$U .UEMtDE  "D$D$#$8$#8D$D$\#$8$/7f@M@L$ME$.E1ҋMK $5<$蜘$#D$ED$7?U$T$-$UiD$D$#$7"$D$EUuK<$KUM $eD$D$$$\7$5f&$蘗D$D$$"7\$$~6(4$XD$D$ #뾍t&u:$T$UHhD$D$#$6"D$D$Jt&$"5}D$D$#$T6$"D$|xMA9'UWVS#D$4UЃ<[^_]f11҉<$uv1҃<[^_]D$D$8$$E+5t$$4D$D$d$$5$3D$i$-诒UЃ<[^_]ÐUVSÃu4t$胋t#C3uC $h$`u݃[^]Ðt&USÃuru=ft,D$D$$$J4$.D$e[]Ít&D$D$$$4$.D$|efD$D$$$3$.D$Le]&D$D$$$3$.D$e UWVS,}MM 19tm1 9t`9|D$D$@,$3$1,[^_]Ít&D$D$$$2UT$$e1,[^_]È7M 11,[^_]D$D$$yD$D$$dD$;D$$%2'UWVSÃ\D$$6}@x<$@Et$D$(Ж D$$D$,E D$D$D$D$ ED$ D$|$$W`u9$腇UP$z$D$e{\[^_]Ív$Б$D$0\[^_]ÍUD$D$&%$91$/UD$n;D$$%u1t&U8$]Éu}<$2 @OU$衆FUPF|$FL$24$y$D$iz]u}]ÍU1ɉ(xEt EuXMuGMuUuÍt&ʃ ҈UtUD$ T$D$$%Ív M뵃MUWVSD$D$-$+|$$=]@U؅EUED‰Ef}ԅEUED‰EZfMЅEUED‰E2f}$<[^_]Ít&'UWVSӃ<ҍEDD$D$.$*$e\eD$D$%$*D$$1\D$D$%$*D$$\D$D$`.$q*D$$[D$D$%$E*D$$[H}ԉEËUȉ$ҀUȋĒ3Jah]ԅƒgvfupD$D$N$)$ZD$D$J$\)$%D$M;D$ D$$(& R}԰6/fD$D$.$(D$$,ZD$D$.$(D$$Z[vD$D$@.$d(D$$YD$D$%$8(D$$YD$D$%$ (D$$tYD$D$%$'D$$HYv}<[^_]Ív}<[^_]Í<[^_]<[^_]Ä<[^_]Ä<[^_]Ë}԰tm&UWVS,EU܃ҁUU܅t}} DE$D$D$.t&D$D$/$&D$$Q$%ljD$ c;E؉<$ }$}E9E$ D$D$8U$&Ut$ \$T$$gWE܅DD$D$8/?&D$ D$$`%^v9EpD$D$ &$%t$$V1}tEt tJ,[^_]Á} v } t}uu?t?uD$D$I$$t$$`V,[^_]ÍE UWVSÃ\M}p?&yED$ ẺD$t$$E$|z$yƋEFC Et EFCFCẺ$FpEЉ$FtẺC`EЉCdEԉChU؉SlU܉SpUC1C4St$fCxClU$UCpfSxU$sU‹CtfSxU$\U‹EfSxt\$$|UE t;U C4C8GCX$ (INCSECUCRE!)C m&f (C$D$f)X!vU؉$kE4$jU$jE؅x]ؐt&$jD$D$&$$&D$}É$0~|` t?<>v<<<>u0 $" D$D$2$M$D0E܉$iEU$iE]ܐt&$iD$D$$$&D$||É$/}t"<(t&<)t" f<(t<)ftu] ftD$D$'$p$C[v]=v5|u|$upD$D$&$&$C$hD$D$&$$&D${É$.|;z]5څ:D$D$&$$C&D$D$1$t$BW&]U؉$hE܉$ hU$gE$g4$g,1[^_]ËED$@$'o&E؉$gU܉$gE$g4$gEtE$0U$zg,[^_]D$D$1$$AD$:;D$$%t&'Uɸu Dt& tB;QuA 0< w: D$ D$ $PFÍ&Ð $mԍt&'USÃ$e$X$sY[]Í'UVSÃ1u It&6tJF uF$D$蝜t$oD$F$mD$[^]Ít&1[^] UVS0U eE1]uEBEߍBRUPUPUP @D$ t$UED$ $ʪ#ED$ t$D$$觪$61Ue3u0[^]t&UWVS]UUMM D$E}uUMeU1҉\$D$ D$$zEE܅EE9t$L3v E؉D$$}eD$|$EfeMËE؉AC }GCUE܉WtGp$;C`Gt$-Cd$"&dD$ $D$fC1C8Chu&6~u~ CL~ N F 1҉p^vw<9p~ xd$>4$>\$>`$>؋Ue3>[^_]Ðt&\ttp^lh$=(11:P@priv@ate-@ key(@3:rs@a(1:f@ntTD$ 8=D$7D${D$$T{D$$‹t$TD$dD$spTtD$ (D${TD$7D$$T{D$$ t$‹p$TD$lTpD$ (D${TD$7D$$T{D$$‹l$TD$\D$}hTlD$ (D${TD$7D$$T{D$$‹h$TD$`D$Th))(1@0:cr@eate@ d-at@X]$D$ D$2D$D$${$D$ )D$7D$D$NX{D$$F\$$:f))@)D$ E |$D$$YvD$ :D$!D$%$(qD$ :D$ D$%$6Mt&UWVSÁeE1ۉpttCtK t&FtA6up$ )T$EUe3![^_]Éލv1҉WD$lj$E#p$$G9@Ɖ<$ƮF {t/ t&~t"6uC trz tjul޺lj$rp($$8@Ɖ<$3F 놉ڀz fW zJuƅhDžd I fz ;uƅlDž`: fx,u1lhR d$p8l` $\1t<$\$7h@ @ td$T$$lt&f (@`$L$f)tf <@|$$f>{ t[ x tRu1D$$*{tBt:?u{ tof~ tj6uGؐt&1Ҁx H E먉߀ tƃ D$ D$D$<$w\ $[=8닉ސt&~ E΀D$ D$<$!E^F <:ut&<:tu<::1҃lӐt&?7 <$DЃul@hD$D$$|$ x4D$D$`8$t|$$pED$EΉD$$4$*X}\t61D5΃<$D$ D$D$D$q;ur 1Gh򮋽\D$$Q|$уL$ hL$&<$wd$虂d$[h $MD$$)pNjB G`t`BGpAGA$趄Et,hp1D`$չDp;ur苝hD$$x$ T<$D$ D$$hpP$ X $D$_ t$D$D$)6DžtԨtFp$c)D$L$dFp$)D$\$?Z8[D$;D$$%D$ F;D$ D$%$_)D$ ;D$ D$%$*`D$;D$$%D$ Z;D$ D$%$) D$ Z;D$ D$%$)t&U?WVS\E] UeE11 1QƋ$85@Ǎ@ t$D$ %D$D$$ 1҉$8ƸFF T$D$ ID$D$$7>$Z$$D$O@@ \$$D$8$@ƍ@ D$D$ %D$D$$>D$8$0@@ sign@D$8$@ƍ@ D$D$ %D$D$$->D$8$_0@@ encr@yptD$8$2@ƍ@ D$D$ %D$D$$>t=$$$D$@Ǎ@ T$$A7虤D$D$$A$80ljP @$8@>F 1败$&$$C@ Ǎ@ T$$荿ۉ71+$FUe3o \[^_]D$D$J$$G뿍?󫋅8E$1$K$D$ D$D$$',DžDžDžDž&D$T$ T$$N肼‹8 DG u<#tt<%D$:4$蘸98t:DG u;$1$D$L*v4:\$4$誉uޅ4:= $e$$pP \$$ɼ8lt&DG t>t:t&DG u4$4$D$_D$+$߈t$$觸f*D$ $S+T$D$G$@5t,;wt&tf;ptu*뀋$!t$8 0@@ sign@$8} @ƋD$ %D$D$D$F $߼>$89 @ encr@ypt0@$8 Ƹ"$2x$2t D$ D$D$$&pt D$ D$D$$&$] $O p$A t$3 c $$ 0ljP @$$ @ƉP 8Z8 $zuzu1聛D$+$+$ t41t$zu;z6u1&Dž$_0rDž*D$%+$QNtt$$;c$- 4$ Dž8$= ^&Dž*Dž+@¸DEEL$D$ ED$D$D$D$B $ :uDž9o$^+D$T$躲n*@D$.+$uwptt$$ٹt$ 4$3 Džt1z J E1z J E*t$\$$7+<*UH]ÍEu։}Mԉ$}}w?S|$$D$D;D;EԈD;GuP}S]]D$L>D$G$;|UWVS,U Mu}t1!,[^_]Ð++1ۉEF 1҉uމӋGuVW(;W,sNG0G WW(tmP҃FuD$$<ΰFtt&<$0uuQ$h<萰F8@GMQD$$ktf1ۅt&9u*1uv$ =MU<,[^_]Í&E@}t&U1ۈ2뛍vE8.U1|t&EU1ۋBB $jMA?&u>sN GEBS1u FV tMSSQU,[^_]Ít&u~BEBM1DDDbDD F {t&u>BF}߉eMtv1t&UCMSQutEDF t&E10@&=@4hFF$t&U:DM16MA$hE@ t&MQ1$<-F$)<F$?<F$<֬F|$;跬F]$<蘬F>$<{*D$<>D$c$;W&UWVSeE1xDžddDžhDžlDžpDžt$!t$D$ É$'$8 \$$@$9 lt΋Ee3u Ĭ[^_]誯UWV1S}u&StJ|$$薲ut6S8t*D$D$$誫$}mD$(D$D$k>$||$$EU[^_]D$D$Y>$A$ǐU4$Ɖ|$Tt#ƿTW4$|$D‰]f4$|$]UWVSÃ,5$_~(vT t t t u DD$:$蓧t\$$y=71#D$:4$Et4$D$05F<D$:$ED$ D$$_F4UED$:$讦MpD$ D$ $C,BD$:4$dtD$ D$4$Ш D$ D$4$U觨UB$D$:$tD$ D$$e$D$ D$UD$|$É$货$f/$$Egpgk@eys_@t$$өMA t.D$$蠄 \$蓦$D$,$z -o @"%O"@ "%If@ "ED$D$D$ \$D$$AE$;EtaM $D$D$,\$C\$$蟣EĬ[^_]Ð4$Х$-ED$ D$ZD$@ $腠ED$ D$TD$@ $_ED$ D$TD$@ $9UBD$TD$D$ Eԋ@ $MAD$ D$TED$@ $Et6t&D$ ED$UD$@ $諟EEuϋUBEt3fD$ ED$UD$@ $kEEuσ}}v;}Eԋ@ D$D$$kVD$ bEE]1M4$<$EU4$DD$$أf |$4$趦CEԍ{|$ D$D$@ $臞9]u<$芣$D$D$Y$謡$ E.EĬ[^_]É$7$D$$ -o @"%o"@ "%if@ "Egpgk@eys_@curl@ .ED$D$D$ D$\$$z=Eo$蒢_uri@} D$D$V$誠$JUBt"D$ ED$TD$@ $MA t"D$ ED$TD$@ $UBt"D$ ED$UD$@ $辜MAD$ D$ UEԋ@ D$D$$UD$ ɢEt5]&CD$ ED$D$@ $CuՋEԋ@ $ D$WEX C pD$D$tZ$Z\$t$$EEԉ$CEE}EuܐEԍM؉|$ t$L$@E$1]؉$葠‰~!D< t < t< t< u  ;D$D$V$mu7D$ D$$$ EG&D$D$V$XmuTD$D$$9mD$D$[$\$$艜t&D$D$V$lEEEEf EuY}tS }vá\$D$ED$ E D$Eԋ@$$$E؉$U$Eԉ$CEvD$D$OW$$VE7EĬ[^_]à t?uMYD$D$[$譜\$$ E7^D$D$:W끋UBPD$D$[$ZD$\$$讛E7Egz}pt}Tt},05ED$D$[$t$\$$IE7EwuEԋ@ $ D$耟UZ 3 rD$D$Z$胛M\$ t$L$$$Eԋ@ D$D$$UD$ 1EE&+ M $ENjED$mHE@@8 |$$_S$WE<$D$ EЉD$ED$(<$W(EЉ$lEЋ@@PHT$@DD$UD$D$ Eԋ@ $]1}t&?Stv (t&u׋rD$4${V4$UM蘓VHND~USMT:TD$E|$EыMT$ D$ED$UL$$MD$L$ ML$@ $7F(X~$2Eԋ@ $ D$;}EЋ@@PHT$@DD$VD$D$ Eԋ@ $ɕEЋ@@PHT$@DD$+VD$D$ Eԋ@ $蔕Eԋ@ D$D$ G,D$G0$EЋ@@PHT$@DD$AVD$D$ Eԋ@ $;<$UZ yEЋz@@D$vD$D$Z$P\$ |$t$$ԖEЉ$E$^EEEfzwEԋ@ D$D$$D$ ĚGL$$EnD$D$E$߹E$$EA}11]}+<t7UR $T$-t&9މ<%t<:t<D$ ED$mD$@ $趓뼍t&BPуHL$H T$L$PT$@D$UD$D$ Eԋ@ $]i}]U$oM $dE$YG8D$G@D$B=D$D$ Eԋ@ $O0W4Eԋ@ $eD$ Eԋ@ $rD$<$EЋM@1@D$D$D$UV$Օt$\$$]Eԋ@ D$ D$$!UD$ 芘E!]1}At& zf $9 uEԋ@ D$D$$TD$ 1҉}މӍt&D D$D$D$ Eԋ@ $~uыEԉ}@ $ D$茘MQ IU$MՈD$D$LZ$E~UMT$ UL$$T$ Eԋ@ D$D$$TD$ &1҉}މӍvD D$D$D$ Eԋ@ $螐uCD$C D$/UD$D$ Eԋ@ $hCD$=UD$D$ Eԋ@ $>Eԋ@ D$D$$FUD$ cEԋ@ $ D$(E D$D$X[$0$萒M$UKD$D$pU$EUMT$L$$v$D$ D$qD$D$Z$裒\$D$$8Eԋ@ $rD$DED$D$|V$NU\$T$$ӐUD$D$U$\$$衐E}-Eԃ}EE@EEt)}1UD$$уL$EkE$1$EEEEEMȉL$ MEčUED$T$ $$E,}u#ED$$VD$9`uED$$VD$`u0UD$$VэD D$_QED$}m$D$迍Ej}%1$U;UkE$ Eމ=,US<9v(UE}EM̉$USED$C8$!C8$C8}@0|$D$VD$ $C,~D$D$V$njC4 cD$YD$$ZUݏEExC8K<M$ $ }ED$$VD$/^uut~D$:4$tED$D$%4$(gEt7D$:$ԋtỦT$D$%$:   D$W1$kD3 D$$D$Kuۃ{$ {(C0bt4D$D$/$D$m$D$$ ;f$M5D$D$.$諊C $蓀D$W$D$胊8D$W1$hD3 D$$D$Hu ̉TSD$W$GT$ D$D$D$W$ՌD$m$D$͉C0D$D$$虌D$m$D$葉C0bD$O $uC($D$D$%$<$4D$\$Ɖ$誉4$f=|$4$Et$$ 4$]u}]Ít&E\$$]u}]Ít&UVWSE Ehht&E$_tG;tD$h$zUWD$D$W$UuI 먋Et(D$ D$$@EЉDh [^]Ðt&D$D$W$PUu,% @$D$WTDYD$ D$`hD$ $`D$D$$D$D$$&US]$<C$1C$&C $C$C$C$C$_][]fUVSuuBFStT$$StgFt&[$taCD$F$gSuF tS tT$$IStFtStT$$+Su[^]Í[^]Ðt&Ku UWVSL]z$($FD$ $Et+F]ԍ}ÃE!<$\u]7<:/<[ut<[;<:u<[$GẺ$1҉uЉ}ԉ׉Fމ EЋX>$Q;;}|uЋF81]D$WF$QED$WD$ QD$WD$E$WF$$WFD$W$wu@;/t2$FL[^_]Ëuԍ4$1L[^_]À{/u@/t1tyщډuԀ]f$WMF$躁$谁D$ VT$$#><$艁://\$$_1|1D$ YD$D$ZU$W~&'U8ED$E]uD$@,$צ1u]u]Ðt&Ut$>\$ƋE4$D$血E4$D$ D$D$4$EE]u]Ív'UWV1SL]eE1E}1vD$D$X$|~t$$}t/s|$4$ZEwUt$$ uыU1t91D$D$$D$ ƋE$1Ue3uL[^_]nUW1VS,u$E1Ed;]6tVUۍUЉ$EpE$낍vtoD$$D$EС@|$ t$D$EUD$@$蹳UЉ@EԋE$ t&D$D$Y$Tr$pO U8$]uu }2UD$E$D$ D$D$$t@D$D$$<$E'$oEu]u}]Ív$PE$>E]u}]Í֐US$EED$E$E1ɋU$D$ ED$E D$%ËE$8؃$[]UWVSlEU D$@DžEDžeU1҉$Fo$(F$C$iC D$^XD$ D$T$D$4$uD$4$A11Džt& ‹ !%tDJD+||$C $ C T$$tf|0ta|$C $C D0D$sXD$ D$D$ED$$tU݉T$C $sS $pf 9$n$\pDD$C $C Ɖ$X4$qwc$dD$D$`$g\$t$$:g4$蒾6t&$@Sc랍$ 4$XvJFfI FEԋUĉD$ED$|$T$ $D$U$.ED$G$軚=E4$载<$赽YvD$$i:E4$肽U$wE$"U$aEUe3Eu\[^_]jUED$ T$D$B D$B$6D$D$ a$2f$_D$ W U$!<$Ƽ4$込bUWVSÃ$^}cdGE‰T$GUȉMĉ$|MċUȉG )1L: ]ӉMu܍vM܋u u1ш }k,9Eu؃\[^_]ÃtD$$DeCH}1ҋEO҉E}tċU}Eu΃<}ԍx EU؋UMԉt$T$ $IEU؋M\$D$$Q8t11v 0 9uEԉt$<$D$IUEM9MB/E눅t>UM)E)D ]f}1ӈ}Q,҉Q,u؉EU9ЉE:M U}ME)Mڃ<}؉Uԍx U؋M|$|$$Q4Et"1v2  ;Euu]EUEԍ9UE멃=E1ҋMq҉EEE1Ux1&89Yt(0u uEE,[^_]1ҋEk8|$$D$ ED$dEu΋t1t&$)fD$:$B9|ދE,[^_]Ív\$1$f;}}$fD$$9|ދE}$!fD$vUWVS,E ]}Dء@t*9Dt7x189Yt(0uuİf,[^_]1ҍk8ME |$$L$ D$hu΋tċM E$RfT$E,[^_]Ð\$1$1f:}}$JfD$$9|ދ}1&$!fD$$9|'UWVS,]} @t&9Dt9x1 f89Yt(0uuEE,[^_]1ҋEk8|$$D$ ED$lEuΡt1$pfD$$R9|ދE,[^_]Ív\$1$Zf>9}}$JfD$j$9|ދE}$!fD$HvUWVSE ]u}E@t)9Dt4x189Yt 8uquŃ[^_]1ҐEk8}u]E p[^_]UH$4]Éu}行Xƍ@$D$ F D$FD$FD$FD$FD$ F D$F(D$$ׅFt5]u}]É4$1"U1tÍt&P  B  +P   @   D$gD$d$f5D$gD$f$f5D$gD$j$f5D$gD$l$f5D$gD$o$fm5D$gD$q$fQ5D$gD$s$f55t&US]u vt9Xu@[]Ít&;uу[]ÐUS]u vt9Xu1[]Ðt&uу[] UVS uu )t"t$C$u[ [^]Ívu\$plj4$,$D$(4$]'t@D$)$D'txtJuvt:Ct$$.ut$$ hw(}[^_]阀뮡=[^_]Ív$X+$u\$plj4$+:&\$D$$^P,1뚐t&1UMtu t&tu1]Ít&B]ÐUWVSUXH P P P H@  ‰1ف11щ1%11ډЉiЃi i4i 4i 4i  4ii  Љ ؃%@i@i @i4@i 4@i 4@i  4@i @i  1ہt&j)MM % ։M$u }܉ uց     }u <     }   u    lj ދu܉M  u   4   4  u    u    u 4  uL[^_]fUщSÃTeE1Ұ2tUe3uMT[]Ít&ډEU9u1fJxJ| u0(UWVS] ËErz B B B zR  Љ1111Ɓ11։1333311‰1%111⪪11֋U1‰׃?34j?34k??34l34m3S׃?34n?34o??34p34qS1׃?3j?3k??3l3m3S ׃?3n?3o??3p3qS1‰׃?34j?34k??34l34m3S׃?34n?34o?34p?{34q1?3j‰?3k?3l3C?3mǃ?3n?3o?3p?{ 3q1׉?34j?3k?3l3s$?3m?3n?3o?3p?3qs(1Ɖ?3j?3k??3l3m3s,?3n?3o??3p3qs01։?3j?3k??3l3m3s4?3n?3o??3p3qs81Ɖ?3j?3k??3l3m3s82twUM䍴&9uUe3x|[^_]<o8t0D$ lqD$D$$轓82u1t&u0     =u‰]]111҈EA1҈EA1҈EAUEE11ҍAu]EECHމǐ؍MUEE9uڋ}މE}Ǎ&؍MUKEEF9u}ލt&؍MU#EE9uڋ}ސt&؍MUEE9uډ}t&؍MUE E 9u1҃tэt&90tL9t=9t. 9 t~u1mf+aq'UWVSpeE1]EBLOWEFISHEEEEֺEטEvETE2EEAEyEnEϠEREaEnEEEEEE,EEECD$$D$xoEdD$p$\$ 8t"Ue3Ĭ[^_]Í&pމ$\$\$d8uẺމD$pD$}ĉ$UԉdT$p$\$s(¸<҅Jpމ$`\$\$d`ZD 艖UE EEHE0 E E 1}]DÐUWVSlueU1ҋE^V8H@ V V lj`3`́M+``>N ~v  p1HA1Ɖ<`1߉ ` `p+ `1HB)Ɖ``́3`+`p HC1Ɖ`3`́+``pHD11Ɖ<`<`+<`3<`pHE1)Ɖ``́3`+`pHF1Ɖ`3`́+``pHG11Ɖ<`<`+<`3<`HH1ߋX )Éމ4`4`ρ34`+4`HI1֋P$‰Ӊ`3`΁+``P(HJ11<`<`+<`3<`HK1p,)Ɖ``́3`+`HL1ڋX0Éމ4`34`ρ+4`4`HM1x41lj݋``+`3`x8HN1)lj``́M3`+`HO1p<Ɖ%`3`+``1؋]  KCCCCESUKf9uEe3ul[^_]E'UWVSlUeE1}BJw< J J OOƉ`3`́M+``2J rR w8 1ON)Ɖ``́3`+`w4OM11Ɖŋ``+`3`w0OL1Ɖ`3`́+``w,OK1)Ɖ``́3`+`w(OJ11Ɖŋ``+`3`w$OI1Ɖ`3`́+``w OH1)Ɖ``́3`+`wOG11Ɖŋ``+`3`wOF1Ɖ`3`́+``wOE1)Ɖ``́3`+`wOD11Ɖŋ``+`3`w OC1Ɖ`3`́+``wOB1)Ɖ``́M3`+`wOA11Ɖŋ``+`3`O@1؋Éى `3 `+ ` `] 1щSSSSSUCEKf9uEe3ul[^_]E'UWVSp `]`1]81}x `1]`1]<`1}]p]34`}34`}34`]34`]34`rX x `1]<`1}]`1]<`1}]`1]]Zp4`3p]34`34`]34`34`r }4`}34`}34`34`]34`1rz`]`1]Z`1]`1]<`1}]Yr `23`3`r 3`r 3`Yr :`]`:1]`1]`1]<`1}]Y rz`1]`1]`1]`1]<`1}]2]34`}߉]34`}34`34`]}34`pZz`1]`1]`1]`1]<`1}]X24`3r ]34`34`]34`}34``}p 3`}3`3`3`Yp `]`81]`1]`<`1]1}]Ypx`]`81]`1]<`p1}`1]uqXp`]`1]`1]<`1}X<`1}]Yp `]`1]81}x `1]`1]<`1}]p34`}34`}}]34`߉]34`]34`rX x `1]`1]`1]`1]<`1}]Zp4`3p34`34`34`34`]r ]<`]3<`]3<`3<`3<`y r `]`:1]`1]`1]<`1}]Y$Zr`]`1]:`1]<`r1}`1]uq(Zr`]`1]`1]Z`1]<`1}]Y,rz`1]`1]`1]`1]<`1}]2]34`}34`}}34`34`34`pZz`1]<`1}]`1]ߋ<`1}]`1]]X24`3r 34`34`34`34`}`p u3`3`3`]3`Q0pPX`3`x3`3`3`Q40P X `3`3`p 3`3`Q8P `3`3`3`3`A<[^_]ÍUWVS<Ee M1ɋ D]̋U ɉtK@2LU9uuUe3<[^_]Í1t&2umuʍEUt&9uEe3ul[^_]n'UWVSlEeU1ҋU] uEEt=)E}ىڋE<>1t&2  umuȍEUf9uEe3ul[^_]En'U U$Mt$]|$u} E tPp4 M3 p. 1 d$D‹t$|$]Ít&Up4 3 p. d$t$|$]Ðt&p4 M3 p.  d$t$|$]ÐUeU1ҋEU T$ PT$UT$$y Utv9uuEe3ulUeU1ҋEU T$ PT$UT$$ Utv9uuEe3u^lUWVSL]E e M1ɋUtu85TtB P2RUe3L[^_]à ,uۋ5TuET}EE#EEEgE؉E٫EEEEE޺EߘEvETE2EEE#EEEgEȉEɫEEEEEκEϘEvETE2EEgEgE1E8ETEEiEsEEWEEVEHEE¾ECƅlƅm#ƅnEƅogƅpƅqƅrƅsƅtƅuƅvƅwƅxvƅyTƅz2ƅ{ƅ|ƅ}ƅ~"ƅ3EDEUEfEwEEE4EEEEEENEEEEEE Eƅƅ#ƅEƅgƅƅƅƅƅƅƅƅƅvƅTƅ2ƅƅƅƅ"ƅ3ƅDƅUƅfƅwƅƅƅƅƅƅ ƅ ƅ EEE#E}EEEElE EE|EEE:EuD$E D$$MԉL$ML$ $Dž8t-$ PL$VdVED$D$$"Dž8ul $D$t$EԍMD$L$$)EMD$D$ $`DžED$D$$nMԍED$L$$\`Dž $D$ |$EԍMD$L$$pEMD$D$ $_Dž(fED$D$$MԍED$L$$_tfDžLflT$$D$&&9uu1`fcfP UEUM E E = E< E @< t u |]Ívp]Ív1 u]ÐUXtD$\$Ëlq$T$eÍU8uu]ӋU }ωEU$[$TUL$ \$$ET$Q'ET$D$$E|$T$ UD$$&E]u}E]iV'UWVSL$VE<$E+L$CE<$D$D$ƋEȉEẺEm'D$ $NjE |$9D$-<$REčMUčMȉxt$$|EčMȉWUčMt$$Nuu$10FUĉ$%F4$FEȋUẺBEЉBEԉB E؉BE܉BE$谦U\[^_]$\eP$YP'U8M]U u}wRr :R4$UJ$CUt$T$É$|$$`$FEЃ]u}] U(UMvÐt&EQ$UI$ECU MUE1ÐU8MUvÐt&EJMJMJ MJMR$UI$MBU MUk1Í&U8MUttÍvEJMJMJ MJMR$U%I$mBU MU1É'U(E]Uutt]u]ÍvEB$EH$BMËEE $D$$փoC]u]ÍvUEU v1ËEM'UM EUMMMt6t!t 1]fI]ÍvS]ÍvM]ÐUdtD$h$Ëlq$T$FQÍUWVSL$UԉEiG$@NjE$TG$@ËE$?G$@EE$)G$q@$ERFE؋E$D$EċED$EЉ$EЉ$CẺ$qE܉D$ẺD$$KEEEEăEȍ&EԃED$<$WEE|$$D$ ẺD$D$$EЉ$D$6~}vX}}=vE\$$D$ E؉D$D$$~69uv|$$u}EЉ$D$Ot&+E}ED$D$$ !D$ <$ƋEt$D$'4$Eȉ<$D$teEȉ<$D$EЉ<$D$yD$<$D$ !D$D$$HI&Eȉ<$D$Eȉ<$D$늋}1<$?$?E$?EЉ$u?Ẻ$j?E؉$_?L[^_]1붐UWVS|EUMv =`uT11fkt@D$D$|$ID$$MI$P``$ܞEЋE$C$C$EB}Ep$\<EċUĉ$.AMĉ $E Auĉ4$EAUMEEȋEUMEUuE$t$D$MuD$ L$4$ÉD$A%$蹟E4$D$}tU4$T$eMD$ $Rkt51ۋuĉD$$t$UЉku5kEEEt[&MЋEԋM9r'))uusEԋUЉ<EM kuEċUȋủD$$t$suMȃE4$L$D$EȋUMt$D$ T$ $X uD$4$EuEȍU&u6E} tE} NtH5k.EԋuEȉt$$u2 $H:y$|:EU$ <M $;u4$;E$;Uĉ$;MЉ $蒝Eȃ|[^_]Í&UEdE ]hÍt&'USE7ø ؃[]ÍvU1SE ø ؃[]ÍUWVS}$u?u )^9߉E uЉ޻1҉K9v}]ԉuE}B } 1uԋU EE)‰U E $?$811҉ƋE8}E UԍU$6MELIM̉ǃ}OẺE$MEEEMEȋEԃEMЅE9E}{Eԅtt}]]UEM8D<MEB9EWEЍTUM;]ԅT11ۉu t&9]~%EЀ<tUȋ9u֋u;]U4$T$<D$t$4$g}Eԅt0}1ۍ&Ut$4$D$9ߋUD$t$4$24$9E E}{9E E}t<mU$c8E11MEɉEEfuЋu1ۉ}}f$%89ŰuЋ}$֘Uԅ҉Eu1ۉƐE11Mȉ9]ߋu&9E E&;E EkEJ1k-D$4$tEIE11MȉMЋ]ЍLM>EZE$6E11EEt&Mt$4$L$ 1]̋M9<tP19UO‹UfEM9MUEEЉ$!4$84$E8D$t$É$MEt$ \$L$$$5UD$$M $5.EуM0EЋUЃEB EBE~O]Љ];MEu}}Љ]&|X؃9}u}UЋ]+]ӉU1E$ 5UREtOM $訕}ËEE1ۅt*učvE40$^69]ԉߋuċE4$9$24$E~9$24$Ek9$2}EUԋM UԉE$u8UMĉt$ $D$ED$$7uu}}UD$T$$S;$;)@MlqD$L$$-1 ;]GUMċL$4$D$EUt$<$D$ T$D$<$u 2;]HMu}$3E$3U$ 3Mĉ $2I<$1覔}̉uԋuȐt&$29Eȋuԉ$xUЉ$mM $2E$2Ĝ[^_]ø^MЀ|tT]Ӏ:EЋUЋME\ EMЍLMMЍ\u}]MЀ|tTU OEЋ]+]]ЍTUW.(EE ?m)1uԉEE)Ɖu t$$>U$T$+}g}t%uċu1ۋ$D$9uċE$;4$1\$$D$}=}!}tBuċu1ۋ$\$ D$2D$D$lq$Z89ɋuĸ MԋEċU|$L$M D$T$ $L$<11҉ UԍUE$(kE EU$1}D4M1U$1U9]ԉ}؉fM$L$U$D$*D$D$ lq$N7D$D$ $:}D$D$$g:U |$T$$9D$D$$:Ut8$4u8$ڏÐ$輏t$UWVSÁ ߍUeE1X$N-DDXHFLFPF TFllCBCBC B CBCBCBCBC B C$B$C(B(E$t$JXSFCFCF C FCt&GFGFG F GFT9t&9FX@uE$t$?JFGFGF G FG;gt&;u€uUe3 [^_]ÃBBBBB B BBBBBBBBB B B$B$B(B(:t&UWVS ] }uvt]0 Wvԃ~ ą1ۣȅu [^_]Í&;vUS$tL$ T$D$$n ӅxW$[]Ët. ut 뽍t&tλ 뮐t&EUMMUE$,5vUWVS,=utr4$Ҋt>1f:EE }E  fEm]mE9uƋE t$<$D$K<$#,1[^_]ÐD$D$T$45$3D$D$$5$f1<0É$0 v'UWVSÃ\1Uċԅt\[^_]Í}r11fEȐ|$D$ $90 >UuET$D$ D$D$$6딍t&D$D$Q$4UĉT$$2EuED$D$ D$D$$6 '댐t&\1[^_]Í 4$/D$D$<$q3Uĉ\$T$$1\[^_]É'UWVSeE1̅D$$/1̅1$$D$\$$74%=<TP X unD$Xt$$1.t׉$o.̅D$D$$;2t$\$$1vD$D$d$ 2$0t&$41Ue3[^_]Ívs-$-̅D$D$$1t$\$$$011뎍t&5̅D$D$$^1t$$/$*41Mv,$A-5̅D$D$n$ 1|$t$$/$31Ѕ0&D$D$@$0$D/$31Ѕv=X$W3D$D$X4$GJ,D$D$$$:3D$D$$1D$D$$11ɺsЅR3]+vLt&'UHD$ XD$D$D$4D$0D$,D$(D$$D$ D$D$D$D$lq$+É'U]ÐU11S1҃]؅t؅ Eƒ[]Ðt&U t u 1=؅Ív[ى'Uԅ]ÐU̅uE$薅̅D$D$$.vUWVS̅REą8Ѕ1ҡ [ZZZ u̅D$D$A$'*@̅D$D$$0t&D$X$D$*W(t҉$*)5̅D$D$$,|$t$$~+$/[^_]c($(5̅D$D$$,|$t$$+$]/[^_]D$D$$Y,$*|t&'$I(̅D$D$$,t$\$$*0'$(̅D$D$=Xg'&UVSp]D$$*uD$D$$,E$D$D$t$$*D$D$H4$9u$]-$D$D$EG,$D$D$Ep[^]Ðt&D$$n Ѓp[^]>D$D$ $*'UWVSCypÉ1!1ιƍ:!Iڋ}431!18b%1!1M @@1!1˹ ËMQZ^&1!1ιƋM43 Ƕ\1!1\‹M]/։\1!1\M SD1!1˹ Ëp؉1!1ιƋM43 \1!1\‹M!\1!1\t 7É1!1˹ ËM 1!1ιƋM43 ZE\1!1\‹x㩉}\1!1\1!1э;}˹ Í1!1>ogιƋ|431ߍ L*\!1\‹M1׍B9<8EǍ<:q11 M"amt11˹Í2 811ڍ‹MD꾤}11ιƍ8K}Ѝ4211 ;`K}11˹Í:px11ڍ>~(}‰ٍ11ιƍ8'}Ѝ4211 ;0ԋ}11˹Í:}11ڍ>9ً|‰ٍ11ιƍ8拽pЍ4211 ;|}11˹Í:eVĉ‹}11ڍ‰ 1ٍ>D")ΉƋM42*C E 1Et # 1˹ËM 9U 1U‹|Y[e 1ΉƋM42 E 1EM } 1˹ËM ]U 1U‹MO~o 1ΉƋp42, E 1EM C 1˹Ëx NU 1U‹M~S 1Ή}ƍ4285:} 1Ѝ ;*}э 1˹Í:ӆ} 1hl`d7W_G Ę[^_]Í'UWVS]eE1u M}CTST@CTt?uTCT?~D$D$$z?vMTPǍv؃@@C?CTwዽPTGǃ?t@dU䐍t&9ut$CTt&TCTt?~Ee3uTļ[^_]11@T؉LoLdv9uCTCUWVS]eE1D$D$$NSKTȃ4 ƒ7A{8D CTTt D;7u)ȃ7CTCTCLCMCNSPCO؈SQCRCSTodU䍶9u}e3=CCCCCC C usļ[^_]Íy?D {TȍD?u)ύG?CTP{D$D$$1T󫋕PCt&'U1}t]ÍvE XEpEEE E 0 E$ E( @ ]ÐUE#Eg@@ܺ@ vT2@@@X]Ð&UE]Ðt&UWVSXЋ:ZrR \HMPUHMPUH MP$UH(MP,UH0|P4xH8t@pm E 1E ËM9>pm 1ϹDZ ‹d1>pm 1ιƱ \>pm 1˹ ñ NjM>pmU 1U± Ƌt>pmE 1E ËM9>pm 1ϹDZ ‹M1>pm 1ιƱ M>pm 1˹ ñ NjM>pm U 1U± Ƌ|>pmE 1E Ë`9>pm 1ϹDZ ‹M1>pm 1ι Ʊ h>pm 1˹ ñ NjM>pmU 1U± UƋx>pmй E1U ËM:vmz!! ʹ׋UDZ ‹M1vmzuщ!! uιޱ uuMvmzu!! d˹ñ Ǎvmzu!! u ± Ƌ\vmzщE!! ȹE EEËM8vmzE!! ȹNjpDZ ‹M0vmz!! ȹƋEƱ hvmz]щ!! ً]˹ӱ ]]ǍvmzU]!! ڋ|± ƍvmz]!! ؋] Ë`9vmz}щ!! }Ϲ  }x‹M7vmz}!! }ι ޱ vmz}!! }˹ ñ NjMvmzىU!! ʹU± ƋMUvmzEM!! ȹt ËM:vmz!! ʹ׋UDZ |11ιƱ p11˹ñ U11ʹ ± E11ȹ  dE11ر Ǹ lj‹Mu11ιމuuƋM]11˹ÉNjM] U11UU]u3U1֋UƉ‹M`11Ϲ ߉}}Njx ]11ÉƋMt]1ً]1ʹ‰ËMh11Ϲ}}NjM\11ι Ɖ‹M]u1 1ˉ]]ËM }3}1ߍ<9uljXPDƉXEXTLU<@1Q UlHUAQĸ[^_]Ðt&UWVS]eE1u M}CXSD@CXt?uTCX?~D$D$$z?vMD@Ǎv؃@@C?CXwዽ@DGǃ?t@NU䐍t&9ut$CXt&TCXt?~Ee3uT[^_]11@D؉<nh41M3M3M uM}ƉNjd}}3}1ϋM1ωNjMl}9nMl13M }MNjM}ωNjM}}3M1|1ωNjM}}n}ϋM13M M}NjM}ωNjM}}3M1h1ωlj}}>nu41M3M3M uM}ƉNjM}}3}1ϋl1ωNjMx}9nMx13M }MNjM}ωNjM}}3M1}1ωlj`}Mn`ϋM13M }MNjM}ωNjp}}3M1}1ωlj}}>nu41M3M3M uM}ƉNjMtd3|1ϋx1ωNjM}t9nM}13M t}Njt}ωNjM}h3p1`1ωNjMp}npϋM13M }MNjM}ωNjM}l3d1}1ωljd}>nd41M3M3t tM}ƉNjMt}3}1ϋM1ωlj}Mt9nM}13M }MNjM}ωNjMt}3M1p1ωNjt}}n}ϋM13M }MNjM}ωNjMtx3M1d1ωlj}t>nu41M3M3M tutƉNj`}|3}1ϋM1ωNjM}}9nM}13M }MNjM}ωNjh}}3M1}1ωNjM}}n}M13t<9}tNjMtωNjl}}3|1}1ωlj|}>n|}3h41t3M3M MMΉƉщDuƋp1ϋM1ωljh}7ܼh}#D41M D#t }MuljƋduu3l1΋M1ΉƋtlu1ܼluMu #D! uMMƋMuΉƋxuu3M1|1ΉƋMuDܼuM#uMM M! uMtƋtuΉƋ`uu3M1h1ΉƉuu7ܼ}u#u<9M M#M M}uljщD}ƋM3x1ϋl1ωljx}7ܼxt#D41t D#M tMuljƋMuu3`1΋M1ΉƋM`u1ܼM`uu #D! uMMƉuMΉƋpuu3M1u1ΉƋMuDܼuM#uMM M! uMMƋMuΉƋdt|3M1x1ΉƉut7ܼu} }#}41M#M ω<>t}tljщD}Ƌh3p1ϋ`1ωljp}7ܼp}#D41M D#M }uMƉщuuƋl3d1ϋM1ωljd}7ܼdt#}41t M#D tMuljƉuMu3u1΋M1ΉƋDuu1ܼMuuu #M! MMMΉƋMtΉƋMuu3M1p1ΉƋMuuܼuM#tMM t! uMMƉuMΉƋMux3M1d1ΉƉuu7ܼu}#}41M M#t }MuljƋ`u|3u1΋M1ΉƋtuu1ܼMuuu #M! MMMΉƉtMΉƋhuu3M1u1ΉƋMuuܼuM#tMM t! uMMƋMuΉƋluu3|1u1ΉƉ|u7ܼ|}#}41M M#t M}uljƋpuu3h1΋M1ΉƋthu1ܼMhuu #M! MMMΉƋMDΉƋMud3l1u1ΉƋMluܼul#DMM D! MtuƋtuΉƋxuu3M1|1ΉƉuu7ܼu}#}41M M#D }MuljƋMu`3u1΋h1ΉƋDuu1ܼtuut #M! MMtΉƋMDΉƋMuu3x1l1ΉƋMxubʋx΋D13MutƋtuΉƋMuu3`1u1ΉƉ`u7bʋ`u<9M3D3M M}ƉщupNjM3u1΋M1ΉƉuD>bʋu41M3M3t tM}ƉNj|td3}1ϋx1ωNjM}t9bʋM}13M }tNjt}ωNjM}h3p1`1ωNjMp}bʋpϋM13M M}NjM}ωNjM}l3d1}1ωljd}>bʋd41M3M3t tM}ƉNjMt}3}1ϋM1ωNjM}t9bʋM}13M }tNjt}ωNjM}}3M1p1ωlj}}Mbʋ}ϋM13M }MNjM}ωNjM}x3M1d1ωlj}}>bʋu41M3M3t tM}ƉNj`t|3}1ϋM1ωNjM}t9bʋM}13M M}NjM}ωNjht}3M1}1ωNjt}}bʋ}ϋM13M }MNjM}ωNjlt}3|1}1ωlj|t>bʋ|41M3M3M uttƉщuuNjp3h1΋M1ΉƉDuM3M3M>bʋuD hhƉlj}}ىuu3l3d3}NjM1bʋM3M3ttlƋltΉƋxuu3M1|1ΉƋMuubʋu΋t3M3hMhƋMhΉƋ`uu3M1D1ΉƋMuubʋu΋h3t3l lMƉщluƋM3xxM1x1xxljxt7bʋlx3h3}<9}uƉuu3`3u3uƋh9bʍ 7u3l3u41uuƉupы}3u3u3uƋl9bʋM3M3M47} MuljыUƉuuً]11֋dpu3U3|3x‰ƋTbʋ\EpMEXPLHsK{ Cİ[^_]ÍUWVS]eE1u M}CXST@CXt?uTCX?~D$D$$z?vMTPǍv؃@@C?CXwዽPTGǃ?t@dU䐍t&9ut$CXt&TCXt?~Ee3uTļ[^_]11@T؉LLdv9uCXCUE]Ðt&UWVS]eE1D$D$$>SKXȃ4 ƒ79A{8D CXTt D;7u)ȃ7CXCTCRCTCUCVCWCPCQSSTdUt&9uSSˆCCSSSˆCCSS S!ˆC#C S"S$S%ˆC'CS&S(S)S*C+}e3=umļ[^_]Íy?D {XD?u)ύG?CXP{D$D$$1T󫋕PvU1}t]ÍvE \EpEEE E E$ E( ; ]ÐUEg j@g@rn<@ :O@RQ@h@ك@[@ @d]ÍvUE؞@|6@p0@ 9Y@1 @Xh@d@O@ @d]ÍvUWVS@Iv @Iv1v LLLuɍU썅,f0H̋XX 11΍11P;u1D؉1<1ًω#!1ً ׉3#!1ˉ1 1 @,VFVFV ^F@[^_]Ít&UWVS]eE1u }CdK$@Cdt@uT$Cd?~D$D$$?vMTPǍv؃@@C ?CdwዽPTGǃ?t@U䍅d9uutCdT$Cdt?~Ee3ulļ[^_]11@ʉ؉L LUDžTHdf9uTTuCdC UE]$Ðt&UWVS]eE1D$D$$.s Kdȃ ƃ7A{$8D $CdTt D;%7u)ȃ7CdC$TC^C_C`CaCbC\C]ScTU䍅d&9uuS$S%ˆC'CS&S(S)ˆC+CS*S,S-ˆC/C S.S0S1ˆC3CS2S4S5ˆC7CS6S8S9ˆC;CS:S<S=S>C?CS@SASBCC}e3=unļ[^_]Íy?D ${dȐD%?u)ύG?CdP{$D$D$$1T󫋕P63t&'U1}t]ÍvE hEqEE E E @ E$ E( K ]ÐU1} t]ÍvE hEpEEE@ E @ E$ E( D ]ÐUxD$]uƉ$Jt'ED$\$$u/؋u]]'$t$$D$$jt$$D$&'UWVSEeU1҃}DIq_M}ۍCIT )CDžPӥPLDžH$HjDžHE  1\󫋕TPDžDž \T$L\D$ D$D$$l}F}uG膿D$ |$t$$9}υxˉD$$tU D$@4$T$D@)EEE䐍t&9u1Ue3[^_]Ð$H$D$D$D$<$ UT$$uDžHf胾$$&D$A<qãq ãqUEɼ@g j@;ʄ@ g@+@rn<@6_@:O@ т@$RQ@(l>+@,h@0kA@4ك@8y!~@<[@@@Dǀ]ÐUE؞@]@|6@ *)b@p0@ZY@9Y@/@ 1 @$g&3g@(Xh@,J@0d@4 . @8O@<HG@@@Dǀ]ÐUWVS<Xpx HXpxH X$p(x,H0X4p8xL~ՍC tɍTu_,[^_]Ít&E\$<$CE눍UWVS,u }_WtJtF9rLЃx2?v  u11t&9uG,[^_]Ðt&UD$<$QCU렍UW}VSw;u _v<+u tCE 1&  9r3E )G[^_]Ít&G[^_]1U]]uu $Su1u]u]Í&K uًS0;2t U(]]}} u$<$S COt6 tv9tu@W 1u?]u}]à t͉]u}]Íw tč4ōt&D$GD$C$*t[ }ۋ]1€u]ÉƋ])΋}u]ÐU(uu }}]]|$FD$F$*t V )DžEDžtS1҅‰S]u}]Ít&UWVS]ES {Hp UU GED$M$@ME)ȅEdEtEUMD$$@ME[U 3u@]urEqE1ۉUtEU@9ЉEQEEăUE*UM$FM $D$>MUL$T$EĉDԋED$ Eĉ$GUE|$4$T$ D$GMs}Uċ}EL$T$M|$ t$D$$4)M‹Et)ȅt }U}Bz ɉ~Et DuM ۉy}y "t&Dԉ$>uČ[^_]f9utU9U_ETEM$DM $D$<MDԃɉE~4U1]]ĉ}}U&9u}]}};u}U1]v9u]E;] t(CU BC B ~J1[9uEtMAA Č[^_]ËUMYM|$D$ $L$F+}1ҋM|)׉y}y } GEG Č[^_]fEEt&MEԉt&'U8E]] uu}}P 9ÉUtK19tEUD$ |$\$4$EM9O UtCu9t%U]u}]<$=믍t&]u}]ÍvD$t$4$E܉\$$D$ U뛍t&U8]]uu }}$@$9|$ t$$D$EE]u}E]j;v'U8M E]]u}q9~$);3^{Iu+s]u}]ÍvC]u}]Ít&D$ t$D$<$B1|)밍vE܉UMt$$C:E܋MU{It뭍'UEU T$PT$@$.#ɅÐUWVSE }$<ƋE$ <F @ *f\$t$<$\$4$=|$$=D$$uĉt$<$p=4$9$9<$D$p[^_]UWVSLEuEE $c;4$Y;At&D$4$u6$66uL[^_]'6&$d:$E74$E7$E;$K4\$EȋE؉D$Eȉ$rt&$ :E@ t&$9$EQ7fED$E؉$8EEЉ|$$8@&Et$D$$}t$D$$hUNE܉\$D$$6EȉD$EĉD$E܉$E܉D$Eĉ$U8eE܉U\$D$Eȉ$WUpUHE M]]u}P ɋpUtStO~;;hSL$ t$@U$D$9uEԉsC ]u}]ÐUߍCC ]u}]Ðt&EM܉|$$v3M܋E{t&'UWVS4EEċMY}Eu }ĉEM}U1EBB EEEt<$^-]t U$L-Mt M $:-Ut E$(-Et U$-Ĭ[^_]ÍvMEML$$`+UNUEU1~u9uM qA 9u|E E@Eu%MAA uMMEċU;E/9;]~;]uUMT$ $,E}DžxEXt&F8Z&EUL$<$D$ T$4UF$T$&*E~M 1]]Q 9u]EUt$ |$D$T$D$$wuwEU ut&TMMf;]9;]E9}DžxZ~M19uMUD T$$5)EEEEEEEƅwtU B wMUMȃ)ʋMu]EMMEMut&mMf E~eE?9UME|$pL$ MD$ $ p9U|>xoEUEUۅtUE|$$D$?9U}‹EMU|$ D$EL$T$D$ȉ$qۋ}y}EUM|$D$ET$ L$$|"}9}cEMU|$ D$EL$T$D$ȉ$}-fEp$(pD$$1'pUEMUԉT$EU|$L$MD$ T$ $#Tu]:-Ep1f9u9}M~$Gt&\u Uԉ$ wMM|$ t$4$L$/9}tMU)UċU<>)9ÉO9t}ă~1t&9|}E~/Ut#t&DuE t&|MyxA Et$ $D$'} ?MD$ $r%UE&EĐt&\{9tE!MEL$$%}DžxEvE|$t$4$D$ !/5t&EUM|$ T$L$t$D$$T}t&MU|$\$L$ B$k.MqfUMET$L$ D$$.EU4$T$4$EEM19uMMMEL$$#x‰EEv}1v 9uUDžxKUrED$E$#EEEuċM1u9uUuĉUUuULD$ *D$D$$/D$ *D$D$$/}UWVSLU EM]2E܉UM؅1Ѝt& uEEu}ԉދ]Ӊ$6S9Lu]uUȉ}9gUԅ8 w$謅EċE؉$)$##UD$$E(EԅEeE]t&U1E؋MЉT$D$ T$ $]ԋ}+]U\$$Ey݅ 9uMč<҉tnU؉D$MЋE܉T$ L$$aUԃE9UiMЉ $#u1ۋ}̍$#9|EĉEL[^_]tt&th1s#tEE؋MD$ T$$D$;]|΅҉N$!;M$ %‰$'UĉD$ mD$ID$3$T-EЉEẻ$"}!D$ mD$8D$3$K,D$ mD$?D$3$zl,D$ mD$>D$3$H~,D$ mD$@D$3$MZ,U1UVSZt ru1 f u 9r[^]Ív[^]ÐUWVSÃ,ɉUt@ sE0DEu$'4$5EKx@E4ߍW2XXPuҋU:u;Ut2UMt :t9UtD$ET$$0E,[^_]Ít&4$ EV&UWVSUD$UE؋Mt$\$D$ T$A$BUM\$ BL$ $D$U MUQMM؉99t~1t&9L[^_]Ív$4$mT$$UZBMAM$D$t&auvVufE؋UMt$D$ \$T$A$eM $m1҅>E$lt$cMaUS]$dCE[]d&'UE]uu ҍu-u]u]]xb]u]]b&D$$x뾍t&'U uu]uW$b1tD$4$SC؉3CCC C]u]ÍD$$뒉'U]uuuW$a1tD$4$C؉3CC CC]u]ÍD$$ 뒉'US]tBu][]bt&$b$D$= ][]b[]Ív'US]C$E CE[]Ív'U]]uu 93sCt#T$$aC3]u]Ð$aCߍUE@@@]ÍvUS]tRu9Cu#C$Cu5][]afC$uaۍv$ f[]$~ &'U]]uCusCCuuP]u]Ít&D$$S~1ҍ& 9SC]uu]D$ 5D$D$$fUS]tJCu4C$E CCCEC؃[]ÐC$M`ʍv$릐&UEU @ttH @$4 t&UVS]CtfC$ huGC$^ƋCS4$D$T$| Ct$$D$[^]ÍC$E^뷐uLC$K SH K҉PHKH~p1ҋ[t& 9P[^]ÍvC$51 UVS]CtfC$guGC$,]ƋCS4$D$T$ Ct$$D$ [^]ÍC$U]뷐u4C$!S@@ @P[^]Í&C$]ʍv1뗍t&UWVS,} U_G ;EDEۋwH~1t&9uUGZBGBEB ,[^_]Ív\$$fU]]uu ~0C01CC CC]u]fD$$8뾍US]$P1҅‰P@ []Í&'UU]E u}J :rZMJMJM HJHJH J HJHJUM8pXP HUP]u}]Ð&UE]@Ðt&UE]@ Ðt&UE]fUE]fUE]@ÐWVSU|$t$L$l$ <41f؉Au][^_ÐWVSU|$t$L$l$ <41f؃Au][^_ÐWVSU|$t$L$l$ <41f؃)Au][^_ÐWV|$ t$T$L$؃tA)))Et&FBGFBGF B G FBGFBGFBGFBG v R Iu^_WV|$ t$T$L$؃tA)))աt&FBGFBGF B G FBGFBGFBGFBG v R Iu^_WVS|$t$T$L$1Jt.Pu؍&؉JÉJuX[^_[^_ÐWVS|$t$T$L$|4ڋ1Bt(Pu ؐ؉BÉBuX[^_[^_ÐUt]flq]Ít&US]$Yt$Y[]f[]áU]DÍU(Eu fD$D$ DD$D$$Í&'UUt ]Ðt&U]Ít&U U] Í'U(Mt^t,L$D$T$ D$ID$$DfL$D$ D$RD$$flq떍t&U$nE D$ ED$D$$É'U uPD$D$b$$ E D$ ED$D$$AÍ&D$D$Z$$맍vU$E D$ ED$D$$fU$l^E D$ ED$D$$`$v'Ulq$ D$$tE D$ ED$D$lq$.lq$_7 UD$D$$vUT$ U $T$UT$QUSE] t;lqt;rt$2t5t D$$t#[]Ðlqt&r١lqm$\$$D$WD$D$1$t&'U$E D$ ED$D$$É'UWVSuE} $Ft811ۍD$D$D$ $9މwҡE E [^_]US]D$/$^tE[]TfU(]]D$/u}$&t:)ߍG${R|$\$Ɖ$>]u}]ÍE]u}]XT&UWVS,u}4$XE t&$\Gu>~t]$1Qt$É$=U ut"vf/T$$u<$QS,[^_]Í&FEFD$/$@D$~D$$@tf\$ D$@D$1$$[]Ít&????-??-f??$[]ÐD$2D$$@y UWVS,u}] E EE3v<v3;Ut+;Ut&Mt<\t|$$t[<uɉ|$$\y< tj< t~< < <t&u|$$0>u,[^_]D$ D$%D$<$tt&|$$n[v|$$rCv|$$f+v|$$vv|$$bt&'U(ED$D$ ED$E D$E$rUVSU]M ut9x31 &<x"9wu]UM [^]t&t$T$ $p\$Ɖ$u[^]Ft&UED$ D$E D$E$YÍ&UWVSLu ]MھE ]M,t&v0;}t(]ԅt \t! y wˀ u߉4$]D} UƉE"f<v'9t t<\ttSH w\N< tx< < < <0ut&}L[^_]À U v *fفt0fFn\t&rMt&f=t&v-t&bt&UD$D$ %D$D$ $U$/Clj)U1WVSM} 1tT<|tF1 |tKu1t#D$|$ $t*ـ|tu1[^_]f1|뾃[^_]ÍU8D$]]uu }D$$7D$D$'$D$D$5$ED$D$8$E\$<$Et]u}]Ít&E\$$t3E|$$t{tE܉|$$D$($tD$;$kD$.$ۺtgQ|$$5!t {+|$$8{Df{_1]}u] UWVS,]D$D$$pD$D$$RD$D$$4D$D$>$ED$D$A$ED$D$D$E\$4$E1t,[^_]É\$<$t ,[^_]ËE\$$¸utWEt$$t1{tE܉t$$mt{zE؉t$$KD$$˸cD$$賸ƒ.1!t$$>t{t$$D1{{dv'UWVS,]u D$D$$MD$D$>$/D$D$$ED$D$A$E\$<$E;tUD$$t{tuE\$$urtE|$$t{tPD$$(t,t*D$$>rt{D,[^_]Ð1,[^_]ÍUED$$ÐU8]ˉu}EU|tUt(Hq^]u}]Ít&Mtu1uD$D$$5UT$U$T$]f$ D$D$G$t$$~wt&USEu؋$t=u[]Ív'U(}} ]uu<$+ $;@@|$$؉]u}]Ít&'UWVSu }4$ $.;@Í@t$$>u‹u؃[^_]É؃[^_]Ð&UEM 9t#ut&ҍtЋ9u]Ít&1]ÍUEu t&Ћu]ÍU8}}u1]t6S$U$M:UT$Ɖ$d$;]u}]ÐUWVSt}EuEE܃,[^_]f}UWVSu}] t2t8t$t1҃ Dt 9u[^_]É4$8fUWVSE8tgU v:tP DK u ]Ɉ t@M1ۉEDك2t2E:0D~ u1܍&]E[^_]Í&tE[^_]Í&'UWVS} tM]11&D9u v#D$E$&u19u w݅t +}} E [^_]Ð&UE D$ D$E$pÍ&'UWVSE tJ]11&D9u v#D$E$u19u w݅t+}} E [^_]Ít&'UE D$ D$E$pÍ&'U1MS] tt&9ƒu[]Í&'UHq]ÍUWVSL]GHq$1D$M1҉پtfrHփurUԉ4$U5$]Uԉu<$U؉E܍E؉D$ED$ E܉D$ED$E<$L[^_]Í&9߸t0u$4Ɖuut&tay?ȀBٍt&$6L[Ɖ^_]Ít&t,\$4$a+t&L[^_]$ HqD$D$$MЉEUԋMD$1T$ L$$NzHq1$t&UU]E u]u/$$ƉD$!4$5؋u]]Ív]u]v'UM]E u]u/$O$ƉD$a4$4؋u]]Ív]u]:v'UWV1S|EeU1EEEt&} ]EM 1EEMERt&UP@=vJyFt*$D$D$ %D$D$EmtfEuMu|}t.<<;UzMt <\kvtE1muv}E$1E&P?UtOU܉߉]1Ӑ3<$D$ %D$D$D$9u͋Uċ]M$D$D$ %D$D$lE1MEDEt&U1?D܃UU уMtMU1֐t&9E1EEHt&Mt \Uă< 1ۉM$D$D$ %D$D$vЉсyссссt'$T$D$ %D$D$ED$1ۉM*r1ۉMf1ۉMv1ۉMn1ۉMb1ۉM0t&tWtMU1֐9U1UEXt&1UEE8t& 1uv=A9u[Nf1UEEt&1UEE1UEE5]Me3 |[^_]Ã1UEERE"Eۉ5U'1ۍUtE}}t&2$UD$ %D$D$D$w9Uȋ}E1MEEHqD$1$uM+]CEЉ9ډM؉E$,4$EԉÍẺD$EԉD$ EЉD$E؉D$HthEU$.4$@U1}7$D$ %D$D$D$u9u= tQE $-$-UM ET$L$$O<$HqD$D$$UkU|$ D$1T$$YHq1?U$,ME UL$D$$K`D$PD$$iX{vUS$]؄҉~ vt-@%D$$UUt ]$[],1tكu$r*҉ut&y?ʀQՉ%=y%=g%=U%=C,1$[]vU(E D$ED$E$1xE$$D$ 'U(E D$ED$E$1IEÐt&U(E D$ED$E$豠1IEÐt&UE]AÍUE]aÍU1WVS,}] u9t:u 4f:t$E$9Euu1,[^_]Í1:t҉$輡$诡,[)Ɖ^_]ÍvUVS]-$ބu3Hq^1[^]fD$b4$ptD$4$\tD$4$HtD$4$4yD$4$Hq11\t&D$D$$XCs<_t<-f$,D$14$}aD$1$}tP$P\$$1`tK$31Hq1ɺ1Ro11ɉ:WUVS];tڍt&2 :u[^]U4u Í&04$)D$@D$$tH$$_D$Ít&U|twɅDÍ&$$t($w|DÐt&މ'US$uL (tMlq0tVxqhq`qdq$}$[]Ðt&#D$$4$\$$D$$Ct&'UTt&U u$tEdqpqÍt&'U u$tdqÍt&dq鍴&U(Ut(]Ð&U1ҡ }]‰ Í&U u?$t8E D$ ED$D$0$,0$'UWVSÃ|eE1(U =$ou, $2N#ǡ0$D$@$@4EDEHELEPeETEXE\Eġ`EȡdE̡hEСlEԡpEءtEܡxE0$lUT$D$$\$1$}mSE2t&0$#UD$T$$U Mu,ڃt( tS~.EӃ9}N7돍&U$UUUX]븍vE 9|E2U<$T$^"f} tUu;7Ue3|[^_]Ðt&$2 t&0$D$@D$$u4됍v[$i$_D$$$ $+$_D$$g$$$D$|USE] t'UT$ \$D$$ []Í u$t>ED$ 0\$D$$,0$[]Ðt&#v븍&'UWVS ]u u$tnC0$\D$< ttuH0$0D${t%Bu0$T$Vuۃ[^_]ÐD$ 0D$%D$$f0$nD$ 뎐+;UVS5 MU ]u5t9x41<x*9w9vEӉU M[^][^]ÐD$T$ $ۉt$n9st$$}mu[^]`UE D$D$E$@Í&'U(](uE }$D,$st}$$t$É$,$$w'4$؋u]]Ív]1ҋu]4$ύEEa$@몐UE<US $(up,tq0$ D$,~'1ېt&0$ D$9,0$ D$0$,[]Í(h֍UE]u$ $J$ ]u]ÐUSÃ@ĀuẀCCC C$C C(C,C0vC[]Í&C tCti>UtXT$$D${ {C C[]fT$$0D$뾋T$$D$릋Ct'f>C(+$D‰D$MVT$$ND$2;t&T$$aD$t&C(+$D‰D$$pjfT$$zD$t&T$$D$t&C(+$D‰D${C(+$D‰D$S\C(+$D‰D$1:C(+$D‰D$$v&'USr$ g\$$$ OtD$D$m$K$ "D$T$D$"f$t$u$t$$ t$$tr$T$"$tr$T$$ptr$T$(uڡr$[] UWVSÃ|uKS=t|tvt |u딍t&$농u]ԃ E܀8@t$.UMRKډMvD$B U$D$UЅt 8@(=UлD$D$7$ýUЋB :, D$ NщT$D$<$膽t ?|^rD$D$$D$ .9~ fr$ D$9t'9tt&< ?r$ D$UEE t $$t&r$ D$Pr$D$r$ҿ$Fr$T$ =Ir$ D$~1ېt&r$ D$9frUD$D$D$ $UЋBz@< u5t&?r$ D$B< tЋr$T$אEr1$ D$~!t&r$ D$9t&<=t:r$ D$t<|uv<htr$T$i<|u<2t?|t Gr$ D$0GOU<|tJtFOMUt&r$T$MكD<|u֋U܉<Pϻ퍴&UVSӉʃu҃ tt7t3[^]Ít&4$T$D$d1[^]Ð4$T$D$41[^]ÐU1ɉ1WVSL]){‹7E؉}܉M}KMtMq{$C({v8-K ShC$K$ɉC(t̓LU؋ECM} 0C{L[^_]Í&CEtmEVt&PH-aS C C E E} E uЉ։]̉˃@t\$$u׉ًuЋ]fC HxSEmC$U؋ECE&St&CCCmEU؋E U ҉U.E9EU uԉƃ9ƍWׅuuEE}?tG}htAGK%C C9t}U؋EC CS@uE MMąCCU؉E돋uEECGtNyQucV~;:-zC;|C}؉EI{CC U؉}+}̅uKM܉E܍{$D$= $M Et}й?E 1ɉEԉNjE ]̋]Љu؉f@t\$$Uu׋}1u؋]E ű}Љ]ȋ]уM1ɉf؃@tU؉|$$T$贽uЋ} ȋu]ȍT8:tFNjE | t&t,BtU؉$MĉT$UЉT$]MąuιE܅t}=E HSE܅E܋}܃CCmECqKM܉E܍s$.mEuЉً]EU} UԋkE}ЃC|]̋uE$RMĉD$~MąuKS@C1F}%{$SiU$:MĉT$Mąu;C@u$|{CU؉}!}$DMĉ|$込MąPE$MMĉD$蝼Mą'] ;CtD$D$Z$跲Ӌ|SCE؉Uũ]E1R} E28-tV{$S#u/&軳Dx tldD:։Љ\1Džl@tML$$b>uԉl\h`tB@h%Al\QlDl1òDx fUDžl`X9lsl` lX2X`L$$l`lhqvUe3ļ[^_]ËldD 0tDÉƍ}Ft |$$P跷P ރuΉddA%hpaTh@"hhK4$Nhrh1Aydd֋hArtfhBAlDžT\h@ hAqBlblDl:```4$`xhBdhAM` $Whp11эT:"Y`"ux`0`hA$$lL$``ED$$wl` lDžXdDžl)lE$D`[`hU(E]uttv]u]Ðt&$4$ &$ t$\$D$6D$D$ lq$藨lq]uE]A$)$蝰$衲lq$(\$$#$w U1U w]ÐUt6D$D$$X讪$ҩ$D$D$$XxԍU]Ít&'U]Ít&'U]]uD؉$7t]u]Ðt&1?]u]ÍvUED‰Et&U]]uD؉$t]u]Ðt&غ]u]Uuu]4$)t$D$É$+؋u]]Í&Uuu]4$Yt$D$É$؋u]]Í&U]]uu $t"$t$t0؋u]]Ít&$t$u1҉ӍvfUS]t*$u][]][]v[]fU]Ít&'U$@N1Ív'Uuu]4$a$t$É$ت؋u]]Ít&Uuu]4$!$t t$$蔪؋u]]Ut$u M$مt1҉9t 1҉]t$$] Ut$u M$مt1҉9t ^]t$$]Ut Í&D$D$$t$D$D$$P$Í&'UE҉ tu ufH&1҃=Uƒ=]Ѓ U8E]u}=?@F‹t'$1]=u}]f j$葢~١D$D$D$D!ȣD$ "D$D$$%54$ã=$|$Vt E؅ t(t#&t t$A$D$艤1]u}]Ðt&i9_$u$I9u$/$Ft&1=c&蛫4$若u$Ҧ{9u$kΟ$4$D$輣t&諟$$PD$D$耢 $ϣt$$o UWVS,5t]15+E؉EU܅t; v9v"‹BuE9EumfXZ ;  v ;w,[^_]Í!:,1[^_]ËF늋EًUoD$D$$u$D$D$$Q$$t&UVuStmN^tEʉ؍uʉؐuʉؐUuʉؐu-) NC[^]ÍvU8]]}} usC vt9r؋u]}]f<$tLt$)\$$EU|$D$424$u$Uu}Ӊ؋]]Ð1듉D$$P 1UMt9r 19]Ðt&US t?ʉuʉؐuʉؐUuʉؐuu<[]Ít&L$$붍v'U8t Í&D$xD$D$ D$D$D$D$D$ lq$MÐU(UB;vOT$D$ wD$2D$$ߤfD$D$$PÍ$ot&θxǸfV빸B벸.뫸 뤸띸떸돸눸끸wmcYOyEg;U1D'2" ~m]U}?s&i_UKA7-#yjQ8(x(I2UWVSÃ<Ȉuy&UT$UT$ D$D$S@$ЋEs,K(S4Dljt$L$T$D$ CTD$CP$$D$[Lt+C~3E9UF|$D$$9~L1҃EЋFt$$(ډT$D$ zۺu}M9,[^_]f))FEEhEPzH(;H,n}G0G WO(VEx(;x,bE@ P@0 8G} щG(NEx(;x,YE@ P@08G} ʉG(VEH(;H,P}G0G WO( ЍvFF }M}F҉9t&Myu.Q(;Q,s&E@ P@0Q(&}<$U$((y=FE$VF NE< 1ҁEU w9ߍPs MD$ $Ft@=D$FD$E$uFDUU9F߅E)]vPU~]~9FMU܉|$$L$yU܉~=Ȉ^ ]>MFF1FFF,[^_]Ã>NȈL4$UtU܃,[^_]ËFUȉ\$$T$y1^Ѓ,[^_]ËU$M‹AVMU܉ $}U܉G щNUM܉$}M܉‹G ʉVU$+V ME\$L$$,,[^_]FF}1#(t$$#wXU܉t$$$wU~ ^f U@D$$$xq$r$(D$MuFU܉$UFFU$#uU$NF$P(t\}D$<$}YD$<$d@%D$<$F"ljD$<$/ ÉD$<$…ut\$FD$E$…E\$$$x(tD$)D$B$!tM|$ $rD$)D${$!tD$ )D$)D$!$#@sD$ )D$%D$!$#sU$U܉FD$ )D$9D$!$#rD$ )D$8D$!$#rD$ )D$D$!$XrD$ )D$D$!$#rrD$)D$$!s&'U1VS] uu)&t҉T$4$t[^]Í&US] CLt&S,$F,Xa뮸L[^_]ÉE^U9wEt^$UD$hUԅtD>u?D$D$*$[bUԉT$$`C$d,t&} pt9tH umuL$ wT$D$$*`E܉uED$D$ D$D$$d Nv,뗐$0,,`L[^_]Í&SE$,T$bEԃL[^_]Í&C t&$P]$*D$`n$*_1C Tt&U8u1]]}tECu>C tMUt{\9u[EtTC$buoC ]u}]Í&C$\,D$a]u}]Í|$$@+_$+_똋C$h+D$_{U]]E D$@u$eU1҉}^9؉u(1Ue3@]u}]Í&t1xPtˉ$)މAa$bt$\$$`._pkfFa.F4$T$aD$\$ D$ $D$cƋ$͵ & ff43t39s/t$$^\b19t$$^V9sX PxX ڃGP ʃ8x ӍC$ 9sDt@C)ىˋ tLtH9sDD$;$Zu1$:D$v,$duЍ~D$;<$_ZtD$D$},<$bu1ɉ|JG<vG< v G<cDKpPv vp89F<9~ pt#ut&9؍v <u틍AuAx9f `\$t$ $dFtiFxb9s^)؉T$st&~$(D$`D$$dPf(Aƅ!C$ * ۭEpEf]tEL]F t2ddNȾ̉ȃ)ҍA0шu.BtC#CC%B؍"|$D$ D$^D$$*E$bA"-FPƅ!+B1Ҁ!¨uAx )9o !t0`!D$D$ $d`|$)\$$du\BB+9)L$$` d!ƍxsƅ! A$ Y$1D$ 1D$KD$,$-&=F$$@1~X$9@ D8PI‰C DAD8<@F؉FNDžX`D$\$4$d@$H@$ <@$ 0@$$@$@$ @$ @$@$@$@$@$@$@$@$@$@$݅1B$D$`11Eڃ- u0)ƒv@xP@0`T$)Ӊ\$ $d*1Bƅ!+1! ډA }A) t{ 1ۋQ ~ )9B٨u!Bx+9s )9O!wBtRBt+d0T$`$0`t$|$ $d@@+)9xۃƅ!-C.f C딉1kB,,EЍ}؃ u動BD/tDž1ziƅ! ]$1EGEg{EErEeiEF`EaWEANٍ"\$D$ D$^D$$=!D$`D$$dTƅ! Aƅ!-#A$}:;Dž|J$t$D$ D$ 00$t$D$ D$ /щ t>Atu|tGDžxC`T$D$4$dƅx tT,E‰D$`D$$d;}ڃ0 ؈u拍AB090A+D$4$3XL S1+)9B1эY)ع T$`$domI) T$`$d=d)؋`$dL$ D$ 1D$+D$,$,b4D$ 1D$1D$,$,->4D$ 1D$;D$,$\-48D$ 1D$ED$,$-3'UE D$ E$pUD$lqD$wÐt&UED$ E $pUD$ED$IÍ&UE$pUD$ E D$ED$Í&U18]] uu}}EEƉEE]E|$D$ E$TD$tCt uU܃]Ћu}]ÅtE؅tU9wDՍ&D$D$<$룍&'UED$ ED$E D$E$Ð&UVS ]EEE$蔈Et]Eut$$TD$ E D$thtutD.0ED$D$E$1E$萉 [^]ÍEt.U [^]fD$D$4${D$ 1D$D$,$!-g1 UED$E D$E$ÐUMSB< w'҃0IA< v.A<wLɍD []fB<w!I҃7A< wɍD []ÍvZw҃W뢍YwɍD fUE]Hƒ߃FÍv'UE]Hƒ FÍv'U1W} 9}VStA1 t&8u9U Xƒ FrӃ Fӄu1)[^_]fvUEWVSt[U 9UtS1&tL8u/] rӃ u Gzփ Fփu)[^_]Ð1[^_]Ð1鍶UVSE$81ƋE . Usage: gpg [options] [files] (-h for help)Syntax: gpg [options] [files] sign, check, encrypt or decrypt default operation depends on the input data NOTE: old default options file `%s' ignored gpg: WARNING: standard input reopened gpg: WARNING: standard output reopened gpg: WARNING: standard error reopened gpg: fatal: unable to reopen standard input, output, or error NOTE: no default option file `%s' NOTE: %s is not for normal use! cipher extension `%s' not loaded due to unsafe permissions the given preferred keyserver URL is invalid `%s' is not a valid signature expiration `%s' is not a valid character set could not parse keyserver URL %s:%d: invalid keyserver options %s:%d: invalid import options %s:%d: invalid export options %s:%d: invalid verify options unable to set exec-path to %s no = sign found in group definition `%s' %s:%d: invalid auto-key-locate list WARNING: program may create a core file! will not run with insecure memory due to %s you can only make detached or clear signatures while in --pgp2 mode you can't sign and encrypt at the same time while in --pgp2 mode you must use files (and not a pipe) when working with --pgp2 enabled. encrypting a message in --pgp2 mode requires the IDEA cipher selected cipher algorithm is invalid selected digest algorithm is invalid selected compression algorithm is invalid selected certification digest algorithm is invalid completes-needed must be greater than 0 marginals-needed must be greater than 1 max-cert-depth must be in the range from 1 to 255 invalid default-cert-level; must be 0, 1, 2, or 3 invalid min-cert-level; must be 1, 2, or 3 NOTE: simple S2K mode (0) is strongly discouraged invalid S2K mode; must be 0, 1 or 3 invalid personal cipher preferences invalid personal digest preferences invalid personal compress preferences you may not use cipher algorithm `%s' while in %s mode you may not use digest algorithm `%s' while in %s mode you may not use compression algorithm `%s' while in %s mode failed to initialize the TrustDB: %s WARNING: recipients (-r) given without using public key encryption symmetric encryption of `%s' failed: %s --symmetric --encrypt [filename]you cannot use --symmetric --encrypt with --s2k-mode 0 you cannot use --symmetric --encrypt while in %s mode --symmetric --sign --encrypt [filename]you cannot use --symmetric --sign --encrypt with --s2k-mode 0 you cannot use --symmetric --sign --encrypt while in %s mode %s: symmetric+sign+encrypt failed: %s %s: sign+symmetric failed: %s -k[v][v][v][c] [user-id] [keyring]--gen-prime mode bits [qbits] unknown configuration item `%s' Go ahead and type your message ... processing message failed: %s |[file]|make a clear text signatureencryption only with symmetric cipherremove keys from the public keyringremove keys from the secret keyringgenerate a revocation certificatesearch for keys on a key serverupdate all keys from a keyserver|algo [files]|print message digestsuse this user-id to sign or decrypt|N|set compress level N (0 disables)generate PGP 2.x compatible messages@ (See the man page for a complete listing of all commands and options) @ Examples: -se -r Bob [file] sign and encrypt for user Bob --clearsign [file] make a clear text signature --detach-sign [file] make a detached signature --list-keys [names] show keys --fingerprint [names] show fingerprints no-require-cross-certificationdisplay photo IDs during signature verificationshow policy URLs during signature verificationshow all notations during signature verificationshow IETF standard notations during signature verificationshow user-supplied notations during signature verificationshow preferred keyserver URLs during signature verificationshow user ID validity during signature verificationshow revoked and expired user IDs in signature verificationshow only the primary user ID in signature verificationvalidate signatures with PKA dataelevate the trust of signatures with valid PKA datadisplay photo IDs during key listingsshow policy URLs during signature listingsshow all notations during signature listingsshow IETF standard notations during signature listingsshow user-supplied notations during signature listingsshow preferred keyserver URLs during signature listingsshow user ID validity during key listingsshow revoked and expired user IDs in key listingsshow revoked and expired subkeys in key listingsshow the keyring name in key listingsshow expiration dates during signature listingscan't create `%s': %s can't open `%s': %s ../../g10/gpg.citem==0 || item==1 || item==2/usr/lib/gnupg%%%02X%s: RMD160 = %6s = %*s[stdin]rb (%c%d)gpg (GnuPG)GNU/Linux Home: Supported algorithms: Pubkey: Cipher: Hash: Compression: gpg.conf-1.4.11gpg.confon exitconflicting commands usage: gpg [options] --auto-key-retrieve--no-auto-key-retrieve/dev/null--for-your-eyes-only--set-filenameh2--sign--store--symmetric --encrypt--symmetric--detach-sign--clearsign/usr/share/localeCOLUMNSLINESlibpcsclite.so.1option file `%s': %s reading options from `%s' --export-ownertrust--list-ownertrust--pipemode--list-options --show-keyringsocket://classicalwaysdirectautounknown trust model `%s' --force-ownertrustinvalid ownertrust `%s' --show-policy-url--verify-options no-show-policy-urls--no-show-policy-url--no-comments--default-comment--show-photos--no-show-photosinvalid keyserver options invalid import options invalid export options %s:%d: invalid list options invalid verify options --show-notationno-show-notations--no-show-notation--keyserver-options --honor-http-proxy--import-options --merge-only0xshort0xlongunknown keyid-format `%s' invalid auto-key-locate list gpgconf-gpg.conf:%lu:"%s verbose:%lu: quiet:%lu: keyserver:%lu: reader-port:%lu: %s %s; %s using character set `%s' WARNING: %s overrides %s _CONSOLE--no-literal%s not allowed with %s! --textmode%s makes no sense with %s! --set-filesize--require-secmemideas1invalid default preferences %s does not yet work with %s --multifilerandom_seedsecring.gpgpubring.gpg--store [filename]storing `%s' failed: %s %s: encryption failed: %s --sign [filename]signing failed: %s --sign --encrypt [filename]%s: sign+encrypt failed: %s --sign --symmetric [filename]--clearsign [filename]%s: clearsign failed: %s verify files failed: %s verify signatures failed: %s --decrypt [filename]decrypt_message failed: %s --sign-key user-id--lsign-key user-idlsignsave--edit-key user-id [commands]--gen-key [parameterfile]--gen-keykeyserver send failed: %s keyserver receive failed: %s key export failed: %s keyserver search failed: %s keyserver refresh failed: %s key fetch failed: %s --gen-revoke user-id--desig-revoke user-id--dearmor [file]dearmoring failed: %s --enarmor [file]enarmoring failed: %s --gen-random 0|1|2 [count]--print-md algo [files]invalid hash algorithm `%s' --update-trustdb--list-trust-path --import-ownertrust [file]--card-status--change-pin [no]cfg:group:cfg:version:pubkeycfg:pubkey:ciphercfg:cipher:ciphernamecfg:ciphername:digestcfg:digest:digestnamehashnamecfg:digestname:compresscfg:compress:ccid-reader-idcfg:ccid-reader-id:%s can't open `%s' md5@Commands: |[file]|make a signaturemake a detached signatureencrypt dataencrypt-files@decryptdecrypt data (default)decrypt-filesverify a signatureverify-fileslist-keyslist keyslist-public-keyslist-sigslist keys and signaturescheck-sigslist and check key signatureslist keys and fingerprintslist-secret-keyslist secret keysgenerate a new key pairdelete-keysdelete-secret-keyssign a keylsign-keysign a key locallyedit-keysign or edit a keygen-revokedesig-revokeexportexport keyssend-keysexport keys to a key serverrecv-keysimport keys from a key serversearch-keysrefresh-keysfetch-keysexport-secret-keysexport-secret-subkeysimport/merge keysfast-importprint the card statuscard-editchange data on a cardchange-pinchange a card's PINlist-configgpgconf-listgpgconf-testlist-packetsimport-ownertrustupdate the trust databasefix-trustdbdearmordearmourenarmorenarmourprint-mdgen-primegen-random@ Options: create ascii armored output|NAME|encrypt for NAMEremote-userdefault-recipient-selfno-default-recipienttemp-directoryexec-pathno-encrypt-tolocal-userbzip2-compress-levelbzip2-decompress-lowmemuse canonical text modeno-textmodeno-expertdefault-sig-expireno-ask-sig-expiredefault-cert-expireno-ask-cert-expiredefault-cert-levelmin-cert-levelno-ask-cert-leveluse as output filemax-outputquietno-ttyno-force-v3-sigsno-force-v4-certsno-force-mdcno-disable-mdcdo not make any changesinteractiveprompt before overwritingno-use-agentgpg-agent-infoyesnoprimary-keyringsecret-keyringdefault-keykeyserver-optionsimport-optionsexport-optionslist-optionsverify-optionsdisplay-charsetdebugdebug-alldebug-levelstatus-fdstatus-fileattribute-fdattribute-fileno-sk-commentscompletes-neededmarginals-neededmax-cert-depthtrusted-keyload-extensionno-pgp2no-pgp6no-pgp7no-pgp8rfc4880use strict OpenPGP behaviorno-rfc2440-texts2k-modes2k-digest-algos2k-cipher-algos2k-countsimple-sk-checksumcert-digest-algocompress-algocompression-algono-throw-keyidno-throw-keyidsphoto-viewerset-notationnotation-datasig-notationcert-notationprint-mdslist-trustdbpassphrase-fdpassphrase-filepassphrase-repeatcommand-fdcommand-filequick-randomno-verbosetrustdb-nameno-secmem-warningno-require-secmemno-permission-warningno-mdc-warningno-armorno-armourno-default-keyringno-greetingno-optionshomedirno-batchwith-colonswith-key-datalist-keylist-sigcheck-sigskip-verifycompress-keyscompress-sigsdefault-cert-check-levelalways-trusttrust-modelrun-as-shm-coprocessno-for-your-eyes-onlyset-policy-urlsig-policy-urlcert-policy-urlsig-keyserver-urlno-emit-versionno-versionnot-dash-escapedno-escape-from-lineslock-oncelock-multiplelock-neverlogger-fdlogger-fileno-use-embedded-filenameno-utf8-stringswith-fingerprintdisable-cipher-algodisable-pubkey-algono-allow-non-selfsigned-uidno-allow-freeform-uidfast-list-modefixed-list-modelist-onlyignore-time-conflictignore-valid-fromignore-crc-errorignore-mdc-errorshow-session-keyoverride-session-keyno-random-seed-fileno-sig-cacheno-sig-create-checkno-auto-check-trustdballow-secret-key-importtry-all-secretsenable-special-filenamesno-expensive-trust-checksdelete-secret-and-public-keyspreserve-permissionsdefault-preference-listdefault-keyserver-urlpersonal-cipher-preferencespersonal-digest-preferencespersonal-compress-preferencespersonal-cipher-prefspersonal-digest-prefspersonal-compress-prefsdisplayttynamettytypelc-ctypelc-messagesungroupno-groupsno-strictno-mangle-dos-filenamesenable-progress-filterkeyid-formatexit-on-status-write-errorlimit-card-insert-triesreader-portctapi-driverpcsc-driverdisable-cciddebug-ccid-driverallow-multisig-verificationenable-dsa2disable-dsa2no-allow-multiple-messagessign-withrequire-cross-certificationno-require-backsigsno-auto-key-locateshow-std-notationsshow-standard-notationsshow-user-notationsshow-keyserver-urlsshow-uid-validityshow-unusable-uidsshow-primary-uid-onlypka-lookupspka-trust-increaseshow-unusable-subkeysshow-sig-expireshow-sig-subpackets @HPXx8 RRRRRRRRRRRRRRRRRRRiH2tRRRRRRRj[3RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR;iRRRRoYHHHH'RRHHSHHHHHHHHyc 2M7!yWA+zk1"vguH)AqSD5$LL=.K:){jG7"!<zj[L=yb"| {l]N-q w=.n* ^^O@/ yiYI8'[@1"vsg0main7Բ/ @8Skt @ \check_permissionscheck_permissions7/ @@pSk @DxԶparse_subpacket_listcan't cope with hdrlen yet build_packet() type=%d ../../g10/build-packet.cGNUenc->version == 4do_symkey_enc: s2k=%d ed->mdc_methodunused <= area->lennot human readabledo_plaintext(): wrote %lu bytes but expected %lu bytes ((sk->skey[npkey]) && (mpi_get_flags (sk->skey[npkey])&4))((sk->skey[i]) && (mpi_get_flags (sk->skey[i])&4))invalid packet type in build_packet() invalid packet type in calc_packet_length()delete_subpkt: buffer shorter than subpacket WARNING: invalid notation data found a notation name must have only printable characters or spaces, and end with an '=' a user notation name must contain the '@' character a notation name must not contain more than one '@' character a notation value must not use any control characters 33J33J33J3J3J3J33g3:98(855544g34445g344X4g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g3g34DxBDDxDBBBBBBBBBBBBhDBBBXDBHDbuild_sig_subpktdelete_sig_subpktcalc_packet_lengthbuild_packetdo_secret_keydo_symkey_encdo_encrypted_mdcenter deflate: avail_in=%u, avail_out=%u, flush=%d leave deflate: avail_in=%u, avail_out=%u, n=%u, zrc=%d begin inflate: avail_in=%u, avail_out=%u, inbuf=%u enter inflate: avail_in=%u, avail_out=%u leave inflate: avail_in=%u, avail_out=%u, zrc=%d do_uncompress: returning %u bytes build_packet(PKT_COMPRESSED) failed invalid compression level; using default level zlib deflate problem: %s zlib deflate problem: rc=%d deflate: iobuf_write failed unknown errorout of coreinvalid lib version1.2.3.4zlib problem: %s zlib inflate problem: %s zlib inflate problem: rc=%d ../../g10/compress.ccompress_filterpush_compress_filter2compress_filterenter bzCompress: avail_in=%u, avail_out=%u, flush=%d bz2lib deflate problem: rc=%d leave bzCompress: avail_in=%u, avail_out=%u, n=%u, zrc=%d bzCompress: iobuf_write failed begin bzDecompress: avail_in=%u, avail_out=%u, inbuf=%u enter bzDecompress: avail_in=%u, avail_out=%u leave bzDecompress: avail_in=%u, avail_out=%u, zrc=%d bz2lib inflate problem: rc=%d bz2lib problem: %d unexpected EOF in bz2lib ../../g10/compress-bz2.ccompress_filter_bz2../../g10/free-packet.cuid->ref > 0free_packet() type=%d eeeeeexeeheXeeHeeexeeeeXeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefree_user_idcopy_public_key[User ID not found]../../g10/getkey.c01234567890abcdefABCDEF0123456789abcdefABCDEF checking subkey %08lX subkey not valid subkey has been revoked subkey has expired subkey not yet valid subkey looks fine primary key not valid primary key has expired primary key may be used using key %08lX pub == pubblockkeydb_search failed: %s !ret_kdbhdDNS CERTPKALDAPfpr_len<=20%s %.*s%s [?]%08lX%08lX %.*s%08lX%08lX [?]nodefaultlocalldappkaa->pkt->pkttype == PKT_SECRET_KEY || a->pkt->pkttype == PKT_SECRET_SUBKEYa->pkt->pkttype == PKT_PUBLIC_KEY || a->pkt->pkttype == PKT_PUBLIC_SUBKEYcache_public_key: already in cache too many entries in pk cache - disabled keydb_get_keyblock failed: %s keyblock->pkt->pkttype == PKT_PUBLIC_KEY || keyblock->pkt->pkttype == PKT_PUBLIC_SUBKEYexpected public key but found secret key - must stop Invalid key %s made valid by --allow-non-selfsigned-uid key %s: secret key without public key - skipped pubblock->pkt->pkttype == PKT_PUBLIC_KEYsecblock->pkt->pkttype == PKT_SECRET_KEYno secret subkey for public subkey %s - ignoring keyblock->pkt->pkttype == PKT_PUBLIC_KEYk->pkt->pkttype == PKT_PUBLIC_KEY || k->pkt->pkttype == PKT_PUBLIC_SUBKEYk->pkt->pkttype == PKT_USER_IDfinish_lookup: checking key %08lX (%s)(req_usage=%x) usage does not match: want=%x have=%x no suitable subkeys found - trying primary primary key has been revoked primary key usage does not match: want=%x have=%x no suitable key found - giving up using subkey %s instead of primary key %s cache_user_id: already in cache error checking usability status of %s automatically retrieved `%s' via %s auto-key-locate found fingerprint %s gg!8h0Țmerge_selfsigsmerge_selfsigs_mainmerge_selfsigs_subkeylookuppremerge_public_with_secretfinish_lookupcache_user_idmerge_public_with_secretmerge_public_with_secretsk_from_blockkey_bynamepk_from_blockget_pubkey_byfprint_fastget_pubkey_bynameget_pubkey_fastgnupg-ring:can't allocate lock for `%s' can't lock `%s' keyring `%s' created keyblock resource `%s': %s ../../g10/keydb.cused_resources <= 40active_handles > 0invalid key resource URL `%s' unknown type of key resource `%s' error creating keyring `%s': %s failed to rebuild keyring cache: %s keydb_search2keydb_locate_writablekeydb_releasekeydb_newbuild_packet(%d) failed: %s %s is the unchanged one %s is the new one %s: keyring created %s: close failed: %s ../../g10/keyring.c%s: copy to `%s' failed: %s n_packetscan't unlock `%s' can't seek `%s' !hd->current.iobuferror closing `%s': %s caching keyring `%s' - deletedkeyring_search failed: %s gpg --rebuild-keydb-cacheswriting sigcache packet failed renaming `%s' to `%s' failed: %s WARNING: unable to restore permissions to `%s': %sWARNING: 2 files with confidential information exists. Please fix this possible security flaw %s: skipping %u packets failed: %s resource && !resource->secret == !secretkeyring_get_keyblock: read error: %s skipped compressed packet in keyring re-reading keyblock failed: %s word search mode does not yet work keyring_get_keyblock failed: %s unexpected keyblock found (pkttype=%d)%s %lu keys cached so far (%lu signatures) %lu keys cached (%lu signatures) Hint: backup your keys and try running `%s' VVkeyring_searchkeyring_searchprepare_search0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZABCDEFGHIJKLMNOPQRSTUVWXYZcompare_namekeyring_search_resetkeyring_delete_keyblockdo_copykeyring_update_keyblockkeyring_releasekeyring_newkeyring_register_filenameweak key created - retrying ../../g10/seskey.ci > 0n == nframei > 1pk || skcannot avoid weak key for symmetric cipher; tried %d times! can't encode a %d bit key in a %d bits frame can't encode a %d bit MD into a %d bits frame DSA requires the hash length to be a multiple of 8 bits DSA key %s uses an unsafe (%u bit) hash DSA key %s requires a %u bit or larger hash encode_md_valuepkcs1_encode_mdencode_session_keynode %p %02x/%02x type=%s "" %c%c%c%c ctrl=%d len=%u emptypublic-enconepass-sigsecret-keypublic-keysecret-subkeyplaintextpublic-subkeygpg-control class=%02x keyid=%08lX ts=%lu keyid=%08lX a=%d u=%d %c%c%c%c 050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505u05public key is %s %s encrypted session key "%s" encrypted with %s key, ID %s pkdecrypt_failed %dencrypted with 1 passphrase assuming %s encrypted data decryption okay session key: `%s' original file name='%.*s' verify2handle plaintext failed: %s uncompressing failed: %s ../../g10/mainproc.cDo we really need this here?pubuatsecssb[keybind][selfsig]:%u:%d:%08lX%08lX:%s:%s::rtv:1:%u: %s %4u%c/%s %s%s[revoked]%s:::::::::uid%*srtv:2:%u: [revoked: %sexpires: %s%s::%u:%d:%08lX%08lX:%s:%s:::%s %4u%c/%s %s rev::%d:%08lX%08lX:%s:%s:%c %s %s [%s] :%02x%c:!sig->pka_infopka-address@gnupg.orgSignature made %s Key available at: %08lX%08lX [uncertain] BAD signature from "%s"Expired signature from "%s"Good signature from "%s" [%s] [uncertain] aka "%s" %s %lu %lu %d 0 %d %d %02X Signature expired %s Signature expires %s binary%08lX%08lX %d %d %02x %lu %dCan't check signature: %s can't hash datafile: %s not a detached signature !c->list!c->pipemode.opc->pipemode.op == 'B'subkey w/o mainkey orphaned user ID ring trust w/o key no signature found public key encrypted data: good DEK invalid symkey encrypted packet encrypted with unknown algorithm %d passphrase generated with unknown digest algorithm %d weird size for an encrypted session key (%d) encrypted with %u-bit %s key, ID %s, created %s public key decryption failed: %s encrypted with %lu passphrases IDEA cipher unavailable, optimistically attempting to use %s instead WARNING: message was not integrity protected WARNING: encrypted message has been manipulated! NOTE: sender requested "for-your-eyes-only" invalid control packet CTRLPKT_CLEARSIGN_START WARNING: multiple plaintexts seen proc_pkt.plaintext 89_BAD_DATAnode->pkt->pkttype == PKT_SIGNATUREstandalone revocation - use "gpg --import" to apply invalid root packet for sigclass %02x ERROR: unexpected packet type %dinvalid node with packet of type %d signature verification suppressed number of one-pass packets does not match number of signature packets can't handle this ambiguous signature data using %s key %s Signature made %s using %s key ID %s %s signature, digest algorithm %s cleartext signature without data WARNING: multiple signatures detected. Only the first will be checked. standalone signature of class 0x%02x old style (PGP 2.x) signature invalid root packet detected in proc_tree() invalid pipemode control packet length invalid pipemode control packet code 7887 877777877777777879h99P999779789797777977777777777777777777777777777777777777777777(9788h9 8P999778789797777877777777777777777777777777777777777777777777(9788h9 8P9::978789999777877777777777777777777777777777777777777777777(9add_signatureadd_gpg_controlprint_useriddo_check_sigcheck_sig_and_printpka_uri_from_sigarmor: %s invalid armor header: Hash:RIPEMD160SHA1MD5SHA224SHA256SHA384SHA512NotDashEscaped:invalid clearsig header VersionMessageIDHashCharsetunknown armor header: unexpected armor: invalid dash escaped line: = premature eof (no CRC) malformed CRC CRC error; %06lX - %06lX armor-filter: control: %d ../../g10/armor.cnested clear text signatures afx->what=%dComment: \n\r\vno valid OpenPGP data found. armor_filter-----BEGIN PGP SIGNATURE-----BEGIN PGP MESSAGEBEGIN PGP PUBLIC KEY BLOCKBEGIN PGP SIGNATUREBEGIN PGP SIGNED MESSAGEBEGIN PGP ARMORED FILEBEGIN PGP PRIVATE KEY BLOCKBEGIN PGP SECRET KEY BLOCKEND PGP MESSAGEEND PGP PUBLIC KEY BLOCKEND PGP SIGNATUREEND dummyEND PGP ARMORED FILEEND PGP PRIVATE KEY BLOCKEND PGP SECRET KEY BLOCKinvalid radix64 character %02X skipped Version: GnuPG v1.4.11 (GNU/Linux)invalid armor: line longer than %d characters quoted printable character in armor - probably a buggy MTA has been used P(P(P(P(P(P(PP(P(P(P(PPPPP(PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP(PXb}aHcgbbbbb(c`aa`c3Lcarmor_filtermd_filter../../g10/textfilter.csize > 10text_filterFrom can't handle text lines longer than %d characters input line longer than %d characters standard%.20s ? %lu %luprogress_filterstdincan't disable core dumps: %s GnuPG 1.xSIG-COUNTERplease use "%s%s" instead ZIPZLIBBZIP2Uncompresseduncompressed|noneuncompressedzipzlibbzip2z0z1z2z3???%s%*s%s no-ambiguous option `%s' unknown option `%s' ..~/.gnupgGNUPGHOMEPATH--gnupg--openpgp--rfc2440--rfc1991--pgp2--pgp6--pgp7--pgp8GnuPGOpenPGPOpenPGP (older)old PGPPGP 2.xPGP 6.xPGP 7.xPGP 8.xWARNING: using experimental public key algorithm %s WARNING: Elgamal sign+encrypt keys are deprecated WARNING: using experimental cipher algorithm %s the IDEA cipher plugin is not present please see %s for more information http://www.gnupg.org/faq/why-not-idea.htmlWARNING: digest algorithm %s is deprecated http://www.gnupg.org/faq/weak-digest-algos.htmlWARNING: using experimental digest algorithm %s NOTE: This feature is not available in %s http://www.gnupg.org/faq/features-not-in-gnupg-1.html%s:%d: deprecated option "%s" WARNING: "%s" is a deprecated option WARNING: "%s" is a deprecated command - do not use it this message may not be usable by %s 01234567890_-.abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ[qxqhqq[q[q[q[q[q[q[q[q[q[q[q[qhqq[q[qq xhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhu(uhuhuhuhuhuhuhuxpwhupwhuhuhuhuhuhuhuhuhuhuhuhuwhuhu(v(vhuhuhuvhuhuhuhu(vhuhuupwhuuRZdnxFile `%s' exists. Overwrite? (y/N) openfile.overwrite.okay.pgp.sig.asc.sign%s: unknown suffix Enter new filename%s [%s]: openfile.askoutname[stdout]writing to stdout writing to `%s' assuming signed data in `%s' directory `%s' created can't create directory `%s': %s new configuration file `%s' created WARNING: options in `%s' are not yet active during this run %04d-%02d-%02d../../g10/keyid.c0x%08lX0x%08lX%08lX?v3 fpr?never len <= 20Oops: keyid_from_fingerprint: no pubkey fingerprint_from_skfingerprint_from_pkkeystr_from_desckeystrkeystrlenRrs????????????gD??Gcan't handle public key algorithm %d packet(%d) with unknown version %d :%s key packet: version %d, algo %d, created %lu, expires %lu protect algo: %d (hash algo: %d) experimental / private subpacketpreferred-email-encoding@pgp.comsubpacket of type %d has critical bit set subpkt %d len %u (additional recipient request) WARNING: PGP versions > 5.0 and < 6.5.8 will automagically encrypt to this key and thereby reveal the plaintext to the owner of this ARR key. Detailed info follows: too short: buffer is only %u) trust signature of depth %d, value %dv%d, class 0x%02X, algo %d, digest algo %dsubpacket of type %d too short buffer shorter than subpacket signature packet: hashed data too long premature eof while reading hashed signature data signature packet: unhashed data too long premature eof while reading unhashed signature data signature packet without timestamp signature packet without keyid :signature packet: algo %d, keyid %08lX%08lX version %d, created %lu, md5len %d, sigclass 0x%02x digest algo %d, begin of digest %02x %02x signature packet: too much data buffer shorter than attribute subpacket [bad attribute packet of size %lu][unknown attribute of size %lu]%s: invalid packet (ctb=%02x) %s: partial length for invalid packet type %d %s: indeterminate length for invalid packet type %d parse_packet(iob=%d): type=%d length=%lu%s (%s.%s.%d) WARNING: potentially insecure symmetrically encrypted session key :symkey enc packet: version %d, cipher %d, s2k %d, hash %d:pubkey enc packet: version %d, algo %d, keyid %08lX%08lX onepass_sig with unknown version %d :onepass_sig packet: keyid %08lX%08lX version %d, sigclass 0x%02x, digest %d, pubkey %d, last=%d :trust packet: flag=%02x sigcache=%02x :literal data packet: mode %c (%X), created %lu, name="encrypted_mdc packet with unknown version %d :encrypted data packet: length: %lu :encrypted data packet: length: unknown mdc_packet with invalid encoding :unknown packet: type %2d, length %lu %4d: EOF %02xpublicsecretpublic subsecret subGNU SHA1 protection, simple checksum,:rfc1991 comment packet: "\x%02xpacket(%d) too short unknown algorithm %d skey[%d]: unknown S2K %d simple S2K salted S2K iter+salt S2K gnu-dummy S2K gnu-divert-to-card S2K unknown %sS2K %d , algo: %d,%s hash: %d, salt: protect count: %lu serial-number: protect IV: dummydata encrypted stuff follows mpi too small mpi too large (%u bits) skey[%d]: [encrypted] checksum: %04hx pkey[%d]: packet shorter tham mpi hashed critical not primary user ID[too short]signer's user ID[not human readable][error][invalid regexp subpacket][invalid trust subpacket] %s%ssubpkt %d len %u (sig created %ssig expires after %ssig does not expire%sexportableregular expression: "%s"%srevocablekey expires after %skey does not expirepref-sym-algos:revocation key: c=%02x a=%d f=issuer key ID %08lX%08lXpref-hash-algos:pref-zip-algos:key server preferences:preferred key server: key flags:revocation reason 0x%02x (Big Brother's key (ignored): features:signature: data: ../../g10/parse-packet.cmax_namelen > 70[%d attributes of size %lu][%.20s image of size %lu] (new_ctb)OpenPGP draft GnuPG !pkt->pkt.generic[don't know]%s: 1st length byte missing %s: 2nd length byte missing %s: 4 byte length invalid %s: garbled packet detected copy_packet: compressed! packet(%d) too large packet with S2K %d too short !pktlen, seskey %d bits salt , count %lu (%lu) unsupported algorithm %d :user ID packet: ":attribute packet: %s :%scomment packet: ":trust packet: empty packet(%d) too short (%lu) ", raw data: unknown length %lu bytes :compressed packet: algo=%d mdc_method: %d :mdc packet: length=%lu :packet 63: length %lu - gpg control packet- private (rest length %lu) :marker packet: PGP invalid marker packet dump:skipsomecopysearchparse  0@0 P`p00.1v3[Pcok"]SuXArAMXpr;make_attribute_uidnameparseparse_symkeyencprimegenpk_dsapk_elg[GNUPG:] ../../g10/status.c%.20s X 100 100%.20s %c 0 0[GNUPG:] %s ENTERLEAVEABORTGOODSIGBADSIGERRSIGBADARMORRSA_OR_IDEAKEYEXPIREDKEYREVOKEDTRUST_UNDEFINEDTRUST_NEVERTRUST_MARGINALTRUST_FULLYTRUST_ULTIMATESHM_INFOSHM_GETSHM_GET_BOOLSHM_GET_HIDDENNEED_PASSPHRASEVALIDSIGSIG_IDENC_TONODATABAD_PASSPHRASENO_PUBKEYNO_SECKEYNEED_PASSPHRASE_SYMDECRYPTION_FAILEDDECRYPTION_OKAYMISSING_PASSPHRASEGOOD_PASSPHRASEGOODMDCBADMDCERRMDCIMPORTEDIMPORT_RESFILE_STARTFILE_DONEFILE_ERRORBEGIN_DECRYPTIONEND_DECRYPTIONBEGIN_ENCRYPTIONEND_ENCRYPTIONDELETE_PROBLEMGET_LINEGOT_ITPROGRESSSIG_CREATEDSESSION_KEYNOTATION_NAMENOTATION_DATAPOLICY_URLBEGIN_STREAMEND_STREAMUSERID_HINTUNEXPECTEDINV_RECPNO_RECPALREADY_SIGNEDEXPSIGEXPKEYSIGATTRIBUTEIMPORT_OKIMPORT_CHECKREVKEYSIGCARDCTRLNEWSIGPLAINTEXTPLAINTEXT_LENGTHKEY_NOT_CREATEDNEED_PASSPHRASE_PINSIG_SUBPACKETSC_OP_FAILURESC_OP_SUCCESSBACKUP_KEY_CREATEDPKA_TRUST_BADPKA_TRUST_GOODBEGIN_SIGNINGcan't open fd %d for status output: %s client modified shm control block - abort client returns too large data (%u bytes) too much shared memory requested; only 8k are allowed can't get %uk of shared memory: %s locking shared memory %d failed: %s shmctl IPC_STAT of %d failed: %s shmctl IPC_SET of %d failed: %s can't attach %uk shared memory: %s mapped %uk shared memory at %p, id=%d shmctl IPC_RMDID of %d failed: %s pv=1 pid=%d shmid=%d sz=%u lz=%uSIGEXPIRED deprecated-use-keyexpired-insteadA A ^ ^ ^ ^ ^ ^ ^ ^ A A A A ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ A A do_shm_get..........//"/1/=/L/U/]/j/y///////////00#0+02090B0M0X0b0m0~0000a/0n/000000 11!12,181C1L1T184c1j1t1~11111111111 22+292H2g0%X %lu error creating `%s': %s wbexceeded --max-output limit Error writing to `%s': %s Error closing `%s': %s Error flushing plaintext: %s Detached signature. detached_signature.filenamereading stdin ... ../../g10/plaintext.cfpno signed data can't open signed data `%s' data not saved; use option "--output" to save it clearsig encountered while not expected Problem reading source (%u bytes remaining) Please enter name of data file: No such file, try again or hit enter to quit. ask_for_detached_datafilepublic key %s is %lu second newer than the signature public key %s is %lu seconds newer than the signature key %s was created %lu second in the future (time warp or clock problem) key %s was created %lu seconds in the future (time warp or clock problem) NOTE: signature key %s expired %s assuming bad signature from key %s due to an unknown critical bit WARNING: signature digest conflict in message WARNING: signing subkey %s is not cross-certified http://www.gnupg.org/faq/subkey-cross-certify.htmlWARNING: signing subkey %s has an invalid cross-certification (sig->keyid[0]!=pk->keyid[0]) || (sig->keyid[0]!=pk->keyid[1])root->pkt->pkttype == PKT_PUBLIC_KEYkey %s: no subkey for subkey revocation signature key %s: no subkey for subkey binding signature unode->pkt->pkttype == PKT_USER_IDkey %s: no user ID for key signature packet of class %02x %s %s %lu../../g10/sig-check.c((sig)->sig_class == 0x20)check_key_signature2hash_uid_nodecheck_revocation_keyscheck_revocation_keys1 bad signature %d bad signatures pkd:%d:%u:spk:%d:%u:%u: Card serial no. =../../g10/keylist.cprimary0 sec %4u%c/%s %s %s pub %4u%c/%s %s %s %s%c %4u%c/%s created: %s card-no: Critical signature policy: Signature policy: Preferred keyserver: %d %u %u Critical signature notation: Signature notation: opt.show_subpackets %lu %u %u %u %lu %lu %urvk:::%d:::::::%02x%s: Primary key fingerprint: Subkey fingerprint: Key fingerprint =fpr::::::::: %02X%02XOops; key lost! pub:%s:r::::%s:e::::%s:%c::::sub::%u:%d:%08lX%08lX:%s:%s:::::[revoked]:[key binding]:[subkey revoked]:sig::::::::::%02x%c: sec%c %4u%c/%s %sexpired: %spub %4u%c/%s %suid%*s%s sub %4u%c/%s %sssb%c %4u%c/%s %skeydb_search_next failed: %s Keyringerror reading key: %s tru::%d:%lu:%lu:%d:%d:%d1 signature not checked due to a missing key %d signatures not checked due to missing keys 1 signature not checked due to an error %d signatures not checked due to errors Critical preferred keyserver: primary key is not really primary! sec::%u:%d:%08lX%08lX:%s:%s:::ssb::%u:%d:%08lX%08lX:%s:%s:::::sig [unexpected signature class 0x%02x] keydb_search_first failed: %s can't open fd %d for attribute output: %s v$do_reorder_keyblockprint_revokersdump_attribsprint_subpackets_colon caught ... exiting ../../g10/signal.cwhich == 1pause_on_sigusrsending command `%s' to agent failed: %s error parsing received key data unknown parameter name in received key data error: LF detected in status line - not sending Please insert the card and hit return or enter 'c' to cancel: invalid serial number in keyring detected Please remove the current card and insert the one with serial number: %.*s Hit return when ready or enter 'c' to cancel: SCD WRITEKEY --force OPENPGP.%dpin_cb called without proper PIN info hack PIN not correctly repeated; try againAPPTYPEDISP-NAMEDISP-LANGDISP-SEXPUBKEY-URLLOGIN-DATACHV-STATUSEXTCAPkiaacKEY-FPRKEY-TIMECA-FPRPRIVATE-DO-1234../../g10/cardglue.cno >= 0 && no <= 3KEY-ATTR%d %d %dKEY-DATAKEY-CREATED-AT%s%s%sSCD SERIALNO openpgpselecting openpgp failed: %s card reader not available cardctrl.insert_card.okay1 %.32scardctrl.change_card.okaySCD GETATTRSCD LEARN --forceSCD LEARNSCD SETATTRSCD WRITEKEYOPENPGP.%d--force SCD GENKEY %s%dSCD GENKEY --resetSCD PASSWD%s %dSCD PASSWDSCD CHECKPINOPENPGP 3 OPENPGP 1 OPENPGP 3OPENPGP 1passphrase.pin.new.askpassphrase.adminpin.new.askpassphrase.pin.askpassphrase.adminpin.askEnter New Admin PIN: Enter New PIN: Enter Admin PIN: Enter PIN: Repeat this PIN: passphrase.pin.repeatSCD SETDATASCD PKDECRYPT %sSCD PKDECRYPT--hash=sha224 --hash=sha1 --hash=sha256 --hash=sha384 --hash=sha512 --hash=rmd160 --hash=md5 SCD PKSIGN %s%sSCD PKSIGNlearn_status_cbgcry_md_hash_bufferPPC Card SystemsPrismOpenFortressWewid ABZeitControlMagratheaFSIJtest cardunmanaged S/N rangeerror reading `%s': %s ../../g10/card-util.ckeyno >= 0 && keyno <= 3Replace existing key? (y/N) cardedit.genkeys.replace_keycardedit.genkeys.sizerounded up to %u bits RSA--force %d 1 %uD27600012401not an OpenPGP card [none]Signature key ....:Encryption key....:Authentication key:[not set]CHV-STATUS-1error checking the PIN: %s Name of cardholder: <<OpenPGP card no. %s detected can't do this in batch mode Error changing the PIN: %s PIN changed. Your selection? cardutil.change_pin.menuError unblocking the PIN: %s Reset Code set. AID::: AID:%s:Application ID ...: %s NKSnetkey-card: this is a NetKey card DINSIGdinsig-card: P15pkcs15-card: GELDKARTEgeldkarte-card: unknown: not an OpenPGP card openpgp-card: version:%.4s: vendor:%04x:%s: serial:%.8s: lang:sex:%c: url:login:forcepin:%d::: keyattr:%d:%d:%u: maxpinlen:%d:%d:%d: pinretry:%d:%d:%d: sigcount:%lu::: private_do:%d:cafpr:fprtime:%lu:%lu:%lu: Manufacturer .....: %s Serial number ....: %.8s Language prefs ...: femaleunspecifiedSex ..............: %s URL of public key : Login data .......: Private DO 1 .....: Private DO 2 .....: Private DO 3 .....: Private DO 4 .....: CA fingerprint %d .:not forcedSignature PIN ....: %s Key attributes ...: %u%cMax. PIN lengths .: %d %d %d PIN retry counter : %d %d %d Signature counter : %lu created ....: %s General key info..: [none] (1) Signature key (2) Encryption key (3) Authentication key cardedit.genkeys.subkeytypeInvalid selection. cardedit.genkeys.storekeytype9CA-FPR-1CA-FPR-3CA-FPR-2gpg/card> cardedit.promptAdmin-only command %-10s %s off[CHV3]Admin commands are allowed Cardholder's surname: keygen.smartcard.surnameCardholder's given name: keygen.smartcard.givennameerror setting Name: %s URL to retrieve public key: cardedit.change_urlerror setting URL: %s Login data (account name): cardedit.change_loginerror setting login data: %s Language preferences: cardedit.change_langerror setting lang: %s cardedit.change_sexError: invalid response. error setting sex: %s CA fingerprint: cardedit.change_cafprerror setting cafpr: %s Private DO data: cardedit.change_private_doerror setting private DO: %s usage: writecert 3 < FILE OPENPGP.3usage: readcert 3 > FILE error writing `%s': %s cardedit.genkeys.backup_encReplace existing keys? (y/N) cardedit.genkeys.replace_keys12345678123456quit this menuadminshow admin commandsshow this helplist all available datachange card holder's namechange URL to retrieve keyfetchchange the login namechange card holder's sexchange a CA fingerprintforcesiggenerategenerate new keysunblockprivatedoreadcertwritecertError: Only plain ASCII is currently allowed. Error: The "<" character may not be used. Error: Double spaces are not allowed. error allocating enough memory: %s WARNING: such a key has already been stored on the card! What keysize do you want for the Signature key? (%u) What keysize do you want for the Encryption key? (%u) What keysize do you want for the Authentication key? (%u) %s keysizes must be in the range %u-%u The card will now be re-configured to generate a key of %u bits NOTE: There is no guarantee that the card supports the requested size. If the key generation does not succeed, please check the documentation of your card to see what sizes are allowed. error changing size of key %d to %u bits: %s key operation not possible: %s error getting current key info: %s error setting forced signature PIN flag: %s error clearing forced signature PIN flag: %s OpenPGP card not available: %s This command is only available for version 2 cards Reset Code not or not anymore available 1 - change PIN 2 - unblock PIN 3 - change Admin PIN 4 - set the Reset Code Q - quit PIN unblocked and new PIN set. Error setting the Reset Code: %s this is a DINSIG compliant card this is a PKCS#15 compliant card this is a Geldkarte compliant card serial number longer than expected Version ..........: %.1s%c.%.1s%c Please select the type of key to generate: node->pkt->pkttype == PKT_SECRET_KEY || node->pkt->pkttype == PKT_SECRET_SUBKEYThe card does not support the import of keys You may only store a 1024 bit RSA key on the card Please select where to store the key: Key does not match the card's capability. unknown key protection algorithm secret parts of key are not available secret key already stored on a card error writing key to card: %s Admin commands are not allowed Error: Combined name too long (limit is %d characters). Error: URL too long (limit is %d characters). error retrieving URL from card: %s error retrieving key fingerprint from card: %s Error: Login data too long (limit is %d characters). Error: invalid length of preference string. Error: invalid characters in preference string. Sex ((M)ale, (F)emale or space): usage: cafpr N 1 <= N <= 3 Error: invalid formatted fingerprint. usage: privatedo N 1 <= N <= 4 Error: Private DO too long (limit is %d characters). usage error: redirection to file required error writing certificate to card: %s error reading certificate from card: %s error getting current status: %s error toggling signature PIN flag: %s Make off-card backup of encryption key? (Y/n) NOTE: keys are already stored on the card! Please note that the factory settings of the PINs are PIN = `%s' Admin PIN = `%s' You should change them using the command --change-pin Invalid command (try "help") fetch the key specified in the card URLchange the language preferencestoggle the signature force PIN flagmenu to change or unblock the PINverify the PIN and list all dataunblock the PIN using a Reset Code4:]D"ivVRP%RRRRRru)SR\RS ^P SP $_CS .SdQ GS_SD_hSqS< h__S_SSScard_store_subkeyreplace_existing_key_pinvalid structure of OpenPGP card (DO 0x93) memory allocation error in send_key_data failed to store the fingerprint: %s failed to store the creation date: %s warning: constructed DO too short error retrieving CHV status from card %d Admin PIN attempts remaining before card is permanently locked |A|Please enter the Admin PIN%%0A[remaining attempts: %d]gc=%d ki=%d fc=%d pd=%d mcl3=%u aac=%d sm=%derror reading application data fingerprint on card does not match requested one PIN callback returned error: %s PIN for CHV%d is too short; minimum length is %d error changing size of key %d to %u bits size of key %d changed to %u bits failed to use default PIN as %s: %s - disabling further default use ||Please enter the PIN%%0A[sigs done: %lu]verification of Admin PIN is currently prohibited through this command ||Please enter the Reset Code for the cardReset Code is too short; minimum length is %d card does not support digest algorithm %s signatures created so far: %lu existing key will be replaced please wait while key is being generated ... key generation completed (%d seconds) response does not contain the public key data response does not contain the RSA modulus response does not contain the RSA public exponent protected-private-key passed to writekey shadowed-private-key passed to writekey RSA modulus size is %u bits (%u bytes) RSA modulus missing or not of size %d bits RSA public exponent missing or larger than %d bits RSA prime %s missing or not of size %d bits tp - template <= template_sizewarning: historical bytes are too short warning: bad category indicator in historical bytes warning: bad Compact-TLV in historical bytes can't access %s - invalid OpenPGP card? Algorithm Attributes SignatureAlgorithm Attributes DecryptionAlgorithm Attributes Authentication../../g10/app-openpgp.cc->tag != tagtag <= 0xffffstd+nstdcrtcrt+nkeyno >=0 && keyno <= 2error reading DO 0x%02X Key-Attr-%s ..: RSA, n=%u, e=%u, fmt=%s card is permanently locked! |A|Please enter the Admin PIN%d 1 %u %u %dPRIVATE-DO-1PRIVATE-DO-2PRIVATE-DO-3PRIVATE-DO-4keyno >= 1 && keyno <= 3error reading fingerprint DO verify CHV%d failed: %s chvno == 1 || chvno == 2using default PIN as %s CHV2!*pinvalue||Please enter the PIN|RN|New Reset Code|AN|New Admin PIN|N|New PINerror getting new PIN: %s chvno == 1 || chvno == 3OPENPGP.2 --force %d %d %ufailed to set `%s': %s OPENPGP.1datalen <= sizeof datakeyidx >=0 && keyidx <= 2key already exists generating new key writing new key generating key failed protected-private-keyshadowed-private-keyrsacreated-atcreation timestamp missing rsa_e_len <= rsa_e_reqlenrsa_e_len <= 4tp - template == template_lenfailed to store the key: %s AES-1283DESOPENPGPAID: Historical Bytes: CHV Status BytesExtended Capability FlagsVersion-2 ......: %s Get-Challenge ..: %s (%u bytes max)Key-Import .....: %s Change-Force-PW1: %s Private-DOs ....: %s Algo-Attr-Change: %s SM-Support .....: %s (%s)Max-Cert3-Len ..: %u Max-Cmd-Data ...: %u Max-Rsp-Data ...: %u Cmd-Chaining ...: %s Ext-Lc-Le ......: %s Status Indicator: %02X GnuPG-No-Sync ..: %s GnuPG-Def-PW2 ..: %s DO `%s' not available: %s DO `%s': DO `%s': `%.*s' [%u] Login DataHistorical BytesCardholder Related DataNameLanguage preferencesSexApplication Related DataAIDDiscretionary Data ObjectsExtended Card CapabilitiesCA FingerprintsGeneration timeSecurity Support TemplateDigital Signature CounterPrivate DO 1Private DO 2Private DO 3Private DO 4Cardholder certificateCERT-3SM-KEY-ENCSM-KEY-MAC$AUTHKEYID$DISPSERIALNOv$^nP_ER_ne o[e%o-_e*o5_e?onCoOn\os`oGnon{onhn in,in *mnononozozooopp!pget_cached_dataparse_algorithm_attributeflush_cache_itemverify_a_chvdo_change_pincompare_fingerprintdo_signdoes_key_existdo_writekeychange_keyattrbuild_privkey_templateadd_tlvD[ E^D-_D5_DP_4J*O= 0 && slot < 4slot %d: ATR=ICC not presentProcessor ICC presentMemory ICC presentreader slot %d: %s received data: CT_data: raw apdu: T0 T1 raw PCSC_data:eof reachedeeprom failurewrong lengthCHV wrongCHV blockeduse conditions not satisfiedbad parameterfile not foundrecord not foundreference not foundbad Lcbad P0 or P1instruction not supportedsuccessmore data availableunknown status errorunknown host status erroralready connectedno keypadabortedno readergeneral errorcard I/O errorcard inactiveno cardlocking failedno driverinvalid valueapdulen <= apdu_buffer_sizeresultlen < bufsize dump: CT_initCT_dataCT_closeSCardEstablishContextSCardReleaseContextSCardListReadersSCardGetStatusChangeSCardConnectSCardReconnectSCardDisconnectSCardStatusSCardBeginTransactionSCardEndTransactionSCardTransmitSCardSetTimeoutdetected reader `%s' internal errorinvalid handleinvalid parameterinvalid targetno memorywaited too longinsufficient bufferunknown readersharing violationno smartcardunknown cardcan't disposeproto mismatchnot readysystem cancelledcomm errorinvalid ATRnot transactedreader unavailablePCI too smallreader unsupportedduplicate readercard unsupportedno serviceservice stoppedunsupported featureunsupported cardunresponsive cardunpowered cardreset cardremoved cardinserted cardnew_reader_slot: out of slots pcsc_disconnect failed: %s (0x%lx) reader slot %d: using ccid driver ct_activate_card: can't get status of reader %d: %s ct_activate_card(%d): activation failed: %s ct_activate_card(%d): ATR too long ccid_transceive failed: (0x%lx) reader slot %d: active protocol:reader slot %d: not connected pcsc_connect failed: %s (0x%lx) pcsc_status failed: %s (0x%lx) %lu ATR returned by pcsc_status is too large pcsc_get_status_change failed: %s (0x%lx) pcsc_transmit failed: %s (0x%lx) send apdu: c=%02X i=%02X p1=%02X p2=%02X lc=%d le=%d em=%d apdu_send_simple(%d) failed: %s response: sw=%04X datalen=%d apdu_send_simple(%d): %d more bytes available apdu_send_simple(%d) for get response failed: %s more: sw=%04X datalen=%d apdu_send_simple(%d) got unexpected status %04X from get response apdu_open_reader: failed to open driver: %s apdu_open_reader: invalid CT-API driver open_ct_reader: invalid port %d requested apdu_open_ct_reader failed on port %d: %s apdu_open_reader: failed to open driver `%s': %s apdu_open_reader: invalid PC/SC driver (%d%d%d%d%d%d%d%d%d%d%d%d) pcsc_establish_context failed: %s (0x%lx) error allocating memory for reader list pcsc_list_readers failed: %s (0x%lx) invalid response from pcsc_list_readers error allocating memory for reader name apdu_send_direct(%d) failed: %s apdu_send_direct(%d): %d more bytes available apdu_send_direct(%d) for get response failed: %s apdu_send_direct(%d) got unexpected status %04X from get response apdu_send_directsend_ledisconnect_pcsc_cardconnect_pcsc_card,zw;zJz\zkzuzzzkzzzzzzxz {{#{2{]vE{S{f{w{{{{]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v]v{{{{{|ccid-driver: %s: ccid-driver: [%04lu] 3.0V5.0V1.8V T=0 T=1 (Invalid values detected) 2-wire 3-wire I2C accept eject capture lockecho %02X none %u cols %u lines verification modification5.0 V3.0 V1.8 V (continued) (continues+ends) (continues+continued) (DataBlock-expected)PC_to_RDR_IccPowerOnPC_to_RDR_IccPowerOffPC_to_RDR_GetSlotStatusPC_to_RDR_XfrBlockPC_to_RDR_GetParametersPC_to_RDR_ResetParametersPC_to_RDR_SetParametersPC_to_RDR_EscapePC_to_RDR_IccClockPC_to_RDR_T0APDUPC_to_RDR_SecurePC_to_RDR_MechanicalPC_to_RDR_AbortPC_to_RDR_SetDataRateUnknown PC_to_RDR commandCommand not supportedBad TS in ATRBad checksum in ATRICC protocol not supportedICC class not supportedProcedure byte conflictDeactivated ProtocolAutomatic sequence ongoingPIN timeoutPIN cancelledSlot busyParameter error at offset %dError code %02X (XferBlock-expected) (running) (stopped-L) (stopped-H) (stopped)RDR_to_PC_DataBlockRDR_to_PC_SlotStatusRDR_to_PC_ParametersRDR_to_PC_EscapeRDR_to_PC_DataRateUnknown RDR_to_PC command/dev/cmx0../../g10/ccid-driver.cr_rid%04X:%04X:0000:%04X:%s:0ccid-driver: out of memory !"transport not defined"!"no transport" %d:%c%c [more]requestapdulencard_busy/dev/cmx1ccid-driver: dwLength ..........: %u ccid-driver: bSlot .............: %u ccid-driver: bSeq ..............: %u ccid-driver: bStatus ...........: %u ccid-driver: bError ............: %u ccid-driver: idVendor: %04X idProduct: %04X bcdDevice: %04X ccid-driver: CCID device descriptor is too short ccid-driver: ChipCard Interface Descriptor: ccid-driver: bLength %5u ccid-driver: bDescriptorType %5u ccid-driver: bcdCCID %2x.%02x (Warning: Only accurate for version 1.0)ccid-driver: nMaxSlotIndex %5u ccid-driver: bVoltageSupport %5u %s ccid-driver: dwProtocols %5u ccid-driver: dwDefaultClock %5u ccid-driver: dwMaxiumumClock %5u ccid-driver: bNumClockSupported %5u ccid-driver: dwDataRate %7u bps ccid-driver: dwMaxDataRate %7u bps ccid-driver: bNumDataRatesSupp. %5u ccid-driver: dwMaxIFSD %5u ccid-driver: dwSyncProtocols %08X ccid-driver: dwMechanical %08X ccid-driver: dwFeatures %08X ccid-driver: Auto configuration based on ATR ccid-driver: Auto activation on insert ccid-driver: Auto voltage selection ccid-driver: Auto clock change ccid-driver: Auto baud rate change ccid-driver: Auto parameter negotiation made by CCID ccid-driver: Auto PPS made by CCID ccid-driver: WARNING: conflicting negotiation features ccid-driver: CCID can set ICC in clock stop mode ccid-driver: NAD value other than 0x00 accepted ccid-driver: Auto IFSD exchange ccid-driver: TPDU level exchange ccid-driver: Short APDU level exchange ccid-driver: Short and extended APDU level exchange ccid-driver: WARNING: conflicting exchange levels ccid-driver: dwMaxCCIDMsgLen %5u ccid-driver: bClassGetResponse ccid-driver: bClassEnvelope ccid-driver: wlcdLayout ccid-driver: bPINSupport %5u ccid-driver: bMaxCCIDBusySlots %5u ccid-driver: junk ccid-driver: this drivers requires that the reader supports T=1, TPDU or APDU level exchange and auto configuration - this is not available ccid-driver: enabling workaround for buggy SCM readers ccid-driver: bPowerSelect ......: 0x%02x (%s) ccid-driver: bBWI ..............: 0x%02x ccid-driver: wLevelParameter ...: 0x%04x%s ccid-driver: bProtocolNum ......: 0x%02x ccid-driver: bClockCommand .....: 0x%02x ccid-driver: bmChanges .........: 0x%02x ccid-driver: bClassGetResponse .: 0x%02x ccid-driver: bClassEnvelope ....: 0x%02x ccid-driver: bBMI ..............: 0x%02x ccid-driver: bFunction .........: 0x%02x ccid-driver: usb_bulk_write error: %s ccid-driver: usb_bulk_write failed: %d ccid-driver: writen to %d failed: %s Host aborted the current activityCCID timed out while talking to the ICCParity error while talking to the ICCOverrun error while talking to the ICCAn all inclusive hardware error occurredccid-driver: CCID command failed: %s ccid-driver: sending abort sequence for seqno %d ccid-driver: usb_control_msg error: %s ccid-driver: usb_bulk_write error in abort_cmd: %s ccid-driver: usb_bulk_write failed in abort_cmd: %d ccid-driver: usb_bulk_read error in abort_cmd: %s ccid-driver: bulk-in msg in abort_cmd too short (%u) ccid-driver: unexpected bulk-in slot (%d) in abort_cmd ccid-driver: status: %02X error: %02X octet[9]: %02X ccid-driver: sending abort sequence succeeded ccid-driver: usb_bulk_read error: %s ccid-driver: read from %d failed: %s ccid-driver: bulk-in msg too short (%u) ccid-driver: unexpected bulk-in slot (%d) ccid-driver: bulk-in seqno does not match (%d/%d) ccid-driver: time extension requested (%02X,%02X) ccid-driver: unexpected bulk-in msg type (%02x) ccid-driver: bChainParameter ...: 0x%02x%s ccid-driver: bClockStatus ......: 0x%02x%s ccid-driver: protocol ..........: T=%d ccid-driver: bmFindexDindex ....: %02X ccid-driver: bmTCCKST1 .........: %02X ccid-driver: bGuardTimeT1 ......: %02X ccid-driver: bmWaitingIntegersT1: %02X ccid-driver: bClockStop ........: %02X ccid-driver: bIFSC .............: %d ccid-driver: bNadValue .........: %d ccid-driver: buffer[9] .........: %02X ccid-driver: dwClockFrequency ..: %u ccid-driver: dwDataRate ..... ..: %u ccid-driver: bMessageType ......: %02X ccid-driver: usb_open failed: %s ccid-driver: found CCID reader %d (ID=%s) ccid-driver: failed to open `%s': %s ccid-driver: no CCID readers found ccid-driver: no CCID reader with ID %s ccid-driver: no CCID reader with number %d ccid-driver: setting up transport for CardMan 4040 ccid-driver: using CCID reader %d (ID=%s) ccid-driver: device not supported ccid-driver: usb_claim_interface failed: %d ccid-driver: usb_intr_read error: %s ccid-driver: intr-in msg too short ccid-driver: notify slot change:ccid-driver: hardware error occured ccid-driver: unknown intr-in msg of type %02X ccid-driver: USB: CALLING USB_CLEAR_HALT ccid-driver: USB: RETRYING bulk_in AGAIN ccid-driver: GetParameters failed ccid-driver: SetParameters failed (ignored) ccid-driver: T=1: put %c-block seq=%d%s ccid-driver: T=1: got %c-block seq=%d err=%d%s ccid-driver: invalid response for S-block (Change-IFSD) ccid-driver: IFSD has been set to %d ccid-driver: provided buffer too short for received data (%u/%u) ccid-driver: T=1: requesting resync ccid-driver: T=1: 3 failed retries ccid-driver: R-block with wrong seqno received on more bit ccid-driver: unexpected ACK R-block received ccid-driver: T=1: S-block %s received cmd=%d ccid-driver: T=1: requesting an ifsc=%d ccid-driver: T=1: waittime extension of bwi=%d ccid-driver: T=1: resync ack from reader ccid-driver: sending escape sequence to switch to a case 1 APDU ccid-driver: I-block with wrong seqno received ccid-driver: chaining requested but not supported for Secure operation ccid-driver: No retries supported for Secure operation ccid-driver: chaining not supported on Secure operation ccid-driver: T=1: S-block %s received cmd=%d for Secure operation F teVb*{ccid_transceiveccid_transceive_apdu_levelz/scan_or_find_devicesccid_open_readerprepare_special_transport ../../g10/pkclist.cThis key belongs to us Use this key anyway? (y/N) untrusted_key.overridefailed to get the keyblock Oops, PK not in keyblock No reason specifiedKey is supersededKey has been compromisedKey is no longer usedUser ID is no longer validreason for revocation: code=%02xrevocation comment: iImMqQsSNo trust value assigned to: %4u%c/%s %s aka "%s" %d = I do NOT trust %d = I trust marginally %d = I trust fully %d = I trust ultimately m = back to the main menu s = skip this key q = quit Your decision? edit_ownertrust.valueNote: This key has expired! --hidden-recipient%s: skipped: %s --hidden-encrypt-toCurrent recipients: %4u%c/%s %s "pklist.user_id.enterNo such user ID. Public key is disabled. no valid addressees No trust check due to `--trust-model always' option invalid trustlevel %u returned from validation layer %s: There is no assurance this key belongs to the named user %s: There is limited assurance this key belongs to the named user This key probably belongs to the named user It is NOT certain that the key belongs to the person named in the user ID. If you *really* know what you are doing, you may answer the next question with yes. How much do you trust that this key actually belongs to the named user? Please decide how far you trust this user to correctly verify other users' keys (by looking at passports, checking fingerprints from different sources, etc.) %d = I don't know or won't say The minimum trust level for this key is: %s Do you really want to set this key to ultimate trust? (y/N) edit_ownertrust.set_ultimate.okayOoops; the key vanished - can't check the trust WARNING: Using untrusted key! WARNING: this key might be revoked (revocation key not present) WARNING: This key has been revoked by its designated revoker! WARNING: This key has been revoked by its owner! This could mean that the signature is forged. WARNING: This subkey has been revoked by its owner! Note: This key has been disabled. Note: Verified signer's address is `%s' Note: Signer's address `%s' does not match DNS entry trustlevel adjusted to FULL due to valid PKA info trustlevel adjusted to NEVER due to bad PKA info WARNING: This key is not certified with a trusted signature! There is no indication that the signature belongs to the owner. WARNING: We do NOT trust this key! The signature is probably a FORGERY. WARNING: This key is not certified with sufficiently trusted signatures! It is not certain that the signature belongs to the owner. you may not use %s while in %s mode %s: skipped: public key already present You did not specify a user ID. (you may use "-r") Enter the user ID. End with an empty line: skipped: public key already set as default recipient skipped: public key already set unknown default recipient "%s" %s: skipped: public key is disabled      P  B ; 4  I  !   H (  do_we_trustdo_edit_ownertrust(insecure!)not securedo not use(INSECURE!)no default secret key: %s skipped "%s": duplicated skipped "%s": %s no valid signators key is not flagged as insecure - can't use it with the faked RNG! invalid default secret key: %s skipped: secret key already present this is a PGP generated Elgamal key which is not secure for signatures! (IDEA)../../g10/pubkey-enc.cDEK frame:DEK is:NOTE: key has been revokedold encoding of the DEK is not supported cipher algorithm %d%s is unknown or disabled oops: public key not found for preference check NOTE: secret key %s expired at %s WARNING: cipher algorithm %s not found in recipient preferences anonymous recipient; trying secret key %s ... okay, we are the anonymous recipient. get_it GPG_AGENT_INFOcan't connect to `%s': %s DISPLAYGPG_TTYTERMutf-8 (main key ID %s)Repeat passphrase Enter passphrase ../../g10/passphrase.cokay_cb_parm.pwcancelled by user passphrase.ask %s %s. Enter passphrase: %08lX%08lX %08lX%08lX %d 0passphrase.enterRepeat passphrase: passphrase.repeats2k->hash_algoReading passphrase from file descriptor %d ...gpg-agent is not available in this session malformed GPG_AGENT_INFO environment variable gpg-agent protocol version %d is not supported problem with the agent - disabling agent use You need a passphrase to unlock the secret key for user: "%.*s" %u-bit %s key, ID %s, created %s%s can't query passphrase in batch mode You need a passphrase to unlock the secret key for user: "%s" %u-bit %s key, ID %s, created %s (subkey on main key ID %s)agent_get_passphrasehash_passphrasehash_passphrase%s ... ../../g10/seckey-cert.cndata >= 2p == data+ndatanbytes == (nbits + 7)/8Invalid passphrase; please try againsecret key parts are not available protection algorithm %d%s is not supported protection digest %d is not supported not enough bytes for SHA-1 checksum not enough bytes for checksum ndata == ((p[0] << 8 | p[1]) + 7)/8 + 2WARNING: Weak key detected - please change passphrase again. sk->protect.ivlen <= (sizeof(sk->protect.iv)/sizeof((sk->protect.iv)[0]))!((sk->skey[i]) && (mpi_get_flags (sk->skey[i])&4))generating the deprecated 16-bit checksum for secret key protection protect_secret_keyprotect_secret_keydo_checkdo_check../../g10/encr-data.cdfx->refcountsize > 44dfx->eof_seenmdc_decode_filterunsupported blocksize %u checkmdckey setup failed: %s dfx->cipher_hddfx->mdc_hashWARNING: message was encrypted with a weak key in the symmetric cipher. problem handling encrypted packet decrypt_datadecrypt_datarelease_dfx_contextdecode_filtermdc_decode_filter../../g10/cipher.ccreatmdchashlen == 20writing MDC packet failed cipher_filterbuild_packet(ENCR_DATA) failed cipher_filterbuild_packet(pubkey_enc) failed: %s build symkey_enc packet failed: %s error creating passphrase: %s build symkey packet failed: %s WARNING: `%s' is an empty file copying input to output failed: %s you can only encrypt to RSA keys of 2048 bits or less in --pgp2 mode unable to use the IDEA cipher for all of the keys you are encrypting to. WARNING: forcing symmetric cipher %s (%d) violates recipient preferences WARNING: forcing compression algorithm %s (%d) violates recipient preferences forcing symmetric cipher %s (%d) violates recipient preferences --output doesn't work for this command input line %u too long or missing LF encryption of `%s' failed: %s --throw-keyidpubkey_encrypt failed: %s %s/%s encrypted for: "%s" ../../g10/encode.cdek->keylen <= 32using cipher %s `%s' already compressed build_packet failed: %s reading from `%s' DEK is: encrypt_filterencrypt_filterencode_seskeyv$make_keysig_packetmk_notation_policy_etcclearsign_filebuild onepass_sig packet failed: %s build_packet(PLAINTEXT) failed: %s key has been created %lu second in future (time warp or clock problem) key has been created %lu seconds in future (time warp or clock problem) checking created signature failed: %s WARNING: unable to %%-expand notation (too large). Using unexpanded. WARNING: unable to %%-expand policy URL (too large). Using unexpanded. WARNING: unable to %%-expand preferred keyserver URL (too large). Using unexpanded. build signature packet failed: %s multiple files can only be detached signedyou can only detach-sign with PGP 2.x style keys while in --pgp2 mode WARNING: forcing digest algorithm %s (%d) violates recipient preferences you can only clearsign with PGP 2.x style keys while in --pgp2 mode -----BEGIN PGP SIGNED MESSAGE----- NotDashEscaped: You need GnuPG to verify this message (sigclass >= 0x10 && sigclass <= 0x13) || sigclass == 0x1F || sigclass == 0x20 || sigclass == 0x18 || sigclass == 0x19 || sigclass == 0x30 || sigclass == 0x28%s/%s signature from: "%s" ../../g10/sign.csig->version>=4%c %d %d %02x %lu signing:any%s encryption will be used symc-sign%d %sthe signature could not be verified. Please remember that the signature file (.sig or .asc) should be the first file given on the command line. key incomplete key %s has no user IDs 0 = %s 1 = %s 2 = %s 3 = %s 4 = %s Cancel Q = %s ask_revocation_reason.codeask_revocation_reason.textReason for revocation: %s (No description given) Is this okay? (y/N) ask_revocation_reason.okayerror reading keyblock: %s ../../g10/revoke.cgen_revoke.okayunknown protection algorithm ASCII armored output forced. key "%s" not found: %s To be revoked by: gen_desig_revoke.okayPlease select the reason for the revocation: (Probably you want to select %d here) Enter an optional description; end it with an empty line: secret key "%s" not found: %s no corresponding public key: %s public key does not match secret key! Create a revocation certificate for this key? (y/N) Secret parts of primary key are not available. NOTE: This key is not protected! Comment: A revocation certificate should follow make_keysig_packet failed: %s Revocation certificate created. Please move it to a medium which you can hide away; if Mallory gets access to this certificate he can use it to make your key unusable. It is smart to print this certificate and store it away, just in case your media become unreadable. But have some caution: The print system of your machine might store the data and make it available to others! (This is a sensitive revocation key) Create a designated revocation certificate for this key? (y/N) Comment: A designated revocation certificate should follow Revocation certificate created. no revocation keys found for "%s" gen_revokegen_desig_revoke%s: decryption failed: %s moving a key signature to the correct place WARNING: no user ID has been marked as primary. This command may cause a different user ID to become the assumed primary. pub_keyblock->pkt->pkttype==PKT_PUBLIC_KEYsec_keyblock->pkt->pkttype==PKT_SECRET_KEYsigning subkey %s is already cross-certified subkey %s does not sign and so does not need to be cross-certified update_keysig_packet failed: %s passphrase not correctly repeated; try againOops; secret key not found anymore! Secret parts of primary key are stored on-card. Enter the new passphrase for this secret key. You don't want a passphrase - this is probably a *bad* idea! Do you really want to do this? (y/N) protect_secret_key failed: %s Key has only stub or on-card key items - no passphrase to change. There are no preferences on a PGP 2.x-style user ID. Enter your preferred keyserver URL: skipping v3 self-signature on user ID "%s" Current preferred keyserver for user ID "%s": Are you sure you want to replace it? (y/N) Are you sure you want to delete it? (y/N) Current notations for user ID "%s": Displaying %s photo ID of size %ld for key %s (uid %d) User ID "%s": %d signature removed User ID "%s": %d signatures removed User ID "%s": already minimized user ID "%s" is already revoked WARNING: a user ID signature is dated %d seconds in the future Subkey %s is already revoked. This key was revoked on %s by %s key %s This key may be revoked by %s key %sPlease note that the shown key validity is not necessarily correct unless you restart the program. Are you sure you still want to sign it? (y/N) User ID "%s" is not self-signed.The self-signature on "%s" is a PGP 2.x-style signature. Do you want to promote it to an OpenPGP self-signature? (y/N) Your current signature on "%s" has expired. Do you want to issue a new signature to replace the expired one? (y/N) Your current signature on "%s" is a local signature. Do you want to promote it to a full exportable signature? (y/N) "%s" was already locally signed by key %s "%s" was already signed by key %s Do you want to sign it again anyway? (y/N) This key is due to expire on %s. Do you want your signature to expire at the same time? (Y/n) You may not make an OpenPGP signature on a PGP 2.x key while in --pgp2 mode. This would make the key unusable in PGP 2.x. How carefully have you verified the key you are about to sign actually belongs to the person named above? If you don't know what to answer, enter "0". (1) I have not checked at all.%s (2) I have done casual checking.%s (3) I have done very careful checking.%s Your selection? (enter `?' for more information): Please enter the depth of this trust signature. A depth greater than 1 allows the key you are signing to make trust signatures on your behalf. Please enter a domain to restrict this signature, or enter for none. Are you sure that you want to sign this key with your key "%s" (%s) This will be a self-signature. WARNING: the signature will not be marked as non-exportable. WARNING: the signature will not be marked as non-revocable. The signature will be marked as non-exportable. The signature will be marked as non-revocable. I have not checked this key at all. I have checked this key casually. I have checked this key very carefully. sig:%c::%d:%08lX%08lX:%lu:%lu:You have signed these user IDs on key %s: signed by your key %s on %s%s%s Oops: no user ID for signature This signature expired on %s. Are you sure you still want to revoke it? (y/N) Create a revocation certificate for this signature? (y/N) You are about to revoke these signatures: Really create the revocation certificates? (y/N) Delete this good signature? (y/N/q)Delete this invalid signature? (y/N/q)Delete this unknown signature? (y/N/q)Really delete this self-signature? (y/N)error reading secret keyblock "%s": %s Need the secret key to do this. Please use the command "toggle" first. * The `sign' command may be prefixed with an `l' for local signatures (lsign), a `t' for trust signatures (tsign), an `nr' for non-revocable signatures (nrsign), or any combination thereof (ltsign, tnrsign, etc.). 1 user ID without valid self-signature detected %d user IDs without valid self-signatures detected Really sign all user IDs? (y/N) Hint: Select the user IDs to sign This command is not allowed while in %s mode. WARNING: This is a PGP2-style key. Adding a photo ID may cause some versions of PGP to reject this key. Are you sure you still want to add it? (y/N) You may not add a photo ID to a PGP2-style key. You must select at least one user ID. You can't delete the last user ID! Really remove all selected user IDs? (y/N) Really remove this user ID? (y/N) Really move the primary key? (y/N) You must select exactly one key. Command expects a filename argument Error reading backup key from `%s': %s You must select at least one key. Do you really want to delete the selected keys? (y/N) Do you really want to delete this key? (y/N) WARNING: This is a PGP 2.x-style key. Adding a designated revoker may cause some versions of PGP to reject this key. You may not add a designated revoker to a PGP 2.x-style key. Enter the user ID of the designated revoker: cannot appoint a PGP 2.x style key as a designated revoker you cannot appoint a key as its own designated revoker this key has already been designated as a revoker WARNING: appointing a key as a designated revoker cannot be undone! Are you sure you want to appoint this key as a designated revoker? (y/N) Really revoke all selected user IDs? (y/N) Really revoke this user ID? (y/N) Do you really want to revoke the entire key? (y/N) Do you really want to revoke the selected subkeys? (y/N) Do you really want to revoke this subkey? (y/N) Please remove selections from the secret keys. Please select at most one subkey. Changing expiration time for a subkey. Changing expiration time for the primary key. You can't change the expiration date of a v3 key Please select exactly one user ID. Owner trust may not be set while using a user provided trust database Really update the preferences for the selected user IDs? (y/N) Really update the preferences? (y/N) Key not changed so no update needed. No corresponding signature in secret ring sign selected user IDs [* see below for related commands]sign selected user IDs locallysign selected user IDs with a trust signaturesign selected user IDs with a non-revocable signaturemove a backup key to a smartcarddelete signatures from the selected user IDschange the expiration date for the key or selected subkeysflag the selected user ID as primarytoggle between the secret and public key listingsset preference list for the selected user IDsset the preferred keyserver URL for the selected user IDsset a notation for the selected user IDsrevoke signatures on the selected user IDsrevoke key or selected subkeyscompact unusable user IDs and remove unusable signatures from keycompact unusable user IDs and remove all signatures from key%s%c%c %c%c%c%c%c%c %s %s[revocation][self-signature]../../g10/keyedit.cmake_backsig failed: %s This key is not protected. Key is protected. Can't edit this key: %s change_passwd.empty.okay[%d] Digest: Features: Keyserver no-modifyNotations: %c%d [mdc] [no-ks-modify](%d)* (%d). (%d) keyedit.add_keyserverkeyedit.confirm_keyserverEnter the notation: keyedit.add_notationNo notations on user ID "%s" Skipping notation: %s=%s Removing notation: %s=%s Adding notation: %s=%s Removing all notations Proceed? (y/N) keyedit.confirm_notationUser ID "%s" compacted: %s User ID "%s": already clean strlen(namehash)==20*2No user ID with hash %s Key %s is already revoked. err:%u:%d:%08lX%08lX:%lu:%lu::uat:uid:r::::::::e::::::::%c::::::::,mdc,no-ks-modify%d,(sensitive)%s%c %4u%c/%s usage: %strust: %svalidity: %s*** This key has been disabledUser ID "%s" is revoked.sign_uid.revoke_okay Unable to sign. User ID "%s" is expired.sign_uid.expire_okaysign_uid.nosig_okayUser ID "%s" is signable. Sign it? (y/N) sign_uid.sign_okaysign_uid.v4_promote_okaysign_uid.replace_expired_okaysign_uid.local_promote_okaysign_uid.dupe_okayNothing to sign with key %s This key has expired!sign_uid.expired_okaysign_uid.expiresign_uid.v4_on_v3_okay (0) I will not answer.%s sign_uid.classtrustsig_prompt.trust_valuetrustsig_prompt.trust_depthtrustsig_prompt.trust_regexpReally sign? (y/N) sign_uid.okayprimary_pk::%02x%c (non-revocable) (non-exportable)revoked by your key %s on %s uat:::::::::%u %luuid:::::::::user ID: "%s" ask_revoke_sig.expiredask_revoke_sig.oneask_revoke_sig.okayunodeno secret key Not signed by you. uid keyedit.delsig.validkeyedit.delsig.invalidkeyedit.delsig.unknownkeyedit.delsig.selfsigDeleted %d signature. Deleted %d signatures. Nothing deleted. Secret key is available. gpg> keyedit.prompt%-11s %s pub %4u%c/%s %s No user ID with index %d No subkey with index %d Key is revoked.keyedit.sign_revoked.okaykeyedit.sign_all.okaynrUnknown signature type `%s' pk && skkeyedit.v3_photo.okaykeyedit.remove.uid.okaykeyedit.keytocard.use_primaryCan't open `%s': %s keyedit.remove.subkey.okaysensitivekeyedit.v3_revoker.okaykeyedit.add_revokerkeyedit.add_revoker.okaykeyedit.revoke.uid.okaykeyedit.revoke.subkey.okaySet preference list to: keyedit.setpref.okaySave changes? (y/N) keyedit.save.okayQuit without saving? (y/N) keyedit.cancel.okayupdate failed: %s update secret failed: %s %s %4u%c/%s %s %4u%c/%ssave and quitshow key fingerprintlist key and user IDsselect user ID Nselect subkey Ncheck signaturescross-certifybacksigntsignnrsignadduidadd a user IDaddphotoadd a photo IDdeluiddelete selected user IDsdelphotoaddkeyadd a subkeyaddcardkeyadd a key to a smartcardkeytocardmove a key to a smartcardbkuptocarddelkeydelete selected subkeysaddrevokeradd a revocation keydelsigtogglelist preferences (expert)showpreflist preferences (verbose)setprefupdprefchange the passphrasepasswordchange the ownertrustrevsigrevuidrevoke selected user IDsrevphotorevkeyenableenable keydisabledisable keyshowphotoshow selected photo IDsminimizev$jg Xm l l e  j j  j %i i h h h "h | u 0r r y s x q | | { 8z p p p | n q Pq jg @q jg jg q En !n  n m f RP%RRfQrT}&56:GU ~m+^+(d+Xu kr&'((/GRg 'T  nHzlu|% 3!<   ( @/6AIU#_#)`w*keyedit_menumenu_select_uid_namehashsign_uidsmenu_adduidmenu_addrevokermenu_addrevokermenu_backsignshow_key_with_all_namesmenu_revsigComment: Use "gpg --dearmor" for unpacking NOTE: a key's S/N does not match the card's one NOTE: primary key is online and stored on card NOTE: secondary key is online and stored on card WARNING: key %s contains preferences for unavailable algorithms on these user IDs: "%s": preference for cipher algorithm %s "%s": preference for digest algorithm %s "%s": preference for compression algorithm %s it is strongly suggested that you update your preferences and re-distribute this key to avoid potential algorithm mismatch problems you can update your preferences with: gpg --edit-key %s updpref save node->pkt->pkttype == PKT_PUBLIC_SUBKEY || node->pkt->pkttype == PKT_SECRET_SUBKEYWARNING: key %s may be revoked: fetching revocation key %s WARNING: key %s may be revoked: revocation key %s not present. %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lukey %s: duplicated user ID detected - merged Do you want to import this key? (y/N) key %s: PKS subkey corruption repaired key %s: no user ID for signature key %s: unsupported public key algorithm on user ID "%s" key %s: invalid self-signature on user ID "%s" key %s: unsupported public key algorithm key %s: invalid direct key signature key %s: no subkey for key binding key %s: invalid subkey binding key %s: removed multiple subkey binding key %s: no subkey for key revocation key %s: invalid subkey revocation key %s: removed multiple subkey revocation key %s: accepted non self-signed user ID "%s" key %s: non exportable signature (class 0x%02X) - skipped key %s: revocation certificate at wrong place - skipped key %s: invalid revocation certificate: %s - skipped key %s: subkey signature in wrong place - skipped key %s: unexpected signature class (0x%02X) - skipped this may be caused by a missing self-signature key %s: public key not found: %s no writable keyring found: %s error writing keyring `%s': %s key %s: public key "%s" imported key %s: doesn't match our copy key %s: can't locate original keyblock: %s key %s: can't read original keyblock: %s key %s: invalid direct key signature removed key %s: "%s" revocation certificate added key %s: direct key signature added dst->pkt->pkttype == PKT_USER_IDsrc->pkt->pkttype == PKT_USER_IDnode->pkt->pkttype == PKT_USER_IDdst->pkt->pkttype == PKT_PUBLIC_SUBKEY || dst->pkt->pkttype == PKT_SECRET_SUBKEYkey %s: "%s" %d new signatures key %s: "%s" %d signature cleaned key %s: "%s" %d signatures cleaned key %s: "%s" %d user ID cleaned key %s: "%s" %d user IDs cleaned key %s: secret key with invalid cipher %d - skipped no default secret keyring: %s key %s: already in secret keyring key %s: secret key not found: %s key %s: no public key - can't apply revocation certificate key %s: invalid revocation certificate: %s - rejected key %s: "%s" revocation certificate imported import signatures that are marked as local-onlyrepair damage from the pks keyserver during importdo not update the trustdb after importcreate a public key when importing a secret keyonly accept updates to existing keysremove unusable parts from key after importremove as much as possible from key after import../../g10/import.cTotal number processed: %lu skipped new keys: %lu w/o user IDs: %lu imported: %lu (RSA: %lu) unchanged: %lu new user IDs: %lu new subkeys: %lu new signatures: %lu new key revocations: %lu secret keys read: %lu secret keys imported: %lu secret keys unchanged: %lu not imported: %lu signatures cleaned: %lu user IDs cleaned: %lu pub %4u%c/%s %s key %s: no user ID %08X%08X import.okaykey %s: skipped user ID "%s" key %s: skipped subkey key %s: no valid user IDs key %s: new key - skipped key %s: "%s" 1 new user ID key %s: "%s" %d new user IDs key %s: "%s" 1 new signature key %s: "%s" 1 new subkey key %s: "%s" %d new subkeys key %s: "%s" not changed sec %4u%c/%s %s key %s: secret key imported !node->nextskipping block of type %d %lu keys processed so far read_block: read error: %s [stream]import from `%s' failed: %s import-local-sigsrepair-pks-subkey-bugconvert-sk-to-pkimport-cleanimport-minimalallow-local-sigsrepair-hkp-subkey-bugimport-unusable-sigsimport-clean-sigsimport-clean-uidsimport_onemerge_sigsappend_uidappend_keymerge_keysigsimport_secret_oneimport_revoke_cert, T@)`8I_t   ( (      4 ( d C  P 0 _ r     WARNING: nothing exported export-local-sigsexport-attributesexport-sensitive-revkeysexport-reset-subkey-passwdexport-cleanexport-minimalinclude-local-sigsinclude-attributesinclude-sensitive-revkeysexport-unusable-sigsexport-clean-sigsexport-clean-uidskey %s: not protected - skipped key %s: PGP 2.x style key - skipped key %s: key material on-card - skipped about to export an unprotected subkey failed to unprotect the subkey: %s WARNING: secret key %s does not have a simple SK checksum export signatures that are marked as local-onlyexport attribute user IDs (generally photo IDs)export revocation keys marked as "sensitive"remove the passphrase from exported subkeysremove unusable parts from key during exportremove as much as possible from key during exportkey %s: accepted as trusted key trust record %lu, req type %d: read failed: %s trust record %lu is not of requested type %d trust record %lu, type %d: write failed: %s `%s' is not a valid long keyID You may try to re-create the trustdb using the commands: gpg2 --export-ownertrust > otrust.tmp gpg2 --import-ownertrust < otrust.tmp If that does not work, please consult the manual update ownertrust from %u to %u unable to use unknown trust model (%d) - assuming %s trust model key %s occurs more than once in the trustdb key %s: no public key for trusted key - skipped key %s marked as ultimately trusted trustdb: searching trust record failed: %s trustdb: record %lu is not a trust record %d keys processed (%d validity counts cleared) no ultimately trusted keys found public key of ultimately trusted key %s not found %d marginal(s) needed, %d complete(s) needed, %s trust model key %08lX%08lX: update min_ownertrust from %u to %u key %08lX%08lX: overriding ownertrust `%s' with `%s' keydb_search_reset failed: %s ooops: invalid pkttype %d encountered regexp `%s' (`%s') on `%s': %s trust sig on %s, sig depth is %d, kr depth is %d replacing trust value %d with %d and depth %d with %d depth: %d valid: %3d signed: %3d trust: %d-, %dq, %dn, %dm, %df, %du unable to update trustdb version record: write failed: %s no need for a trustdb update with `%s' trust model no need for a trustdb check with `%s' trust model clearing ownertrust (old value %u) clearing min_ownertrust (old value %u) error getting main key %s of subkey %s: %s 10 translator see trustdb.c:uid_trust_string_fixeduidnode->pkt->pkttype==PKT_USER_IDcompacting user ID "%s" on key %s: %s removing signature from key %s on user ID "%s": %s trustdb: sync failed: %s trustdb.gpg cd %s rm %s undefinedmarginalfullultimateinsert ownertrust %u can't init trustdb: %s ../../g10/trustdb.cusing %s trust model YESpublic key %s not found: %s insert min_ownertrust %u force trust for key %s to %s <[^>]+[@.]validate_key_list failed %d:%08lX%08lX:K::%c:::: %d:%08lX%08lX:U:::%c:::next trustdb check due at %s no need for a trustdb check please do a --check-trustdb checking the trustdb [ revoked][ expired][ unknown][ undef ][marginal][ full ][ultimate]key unavailableinvalid signaturesignature supersededexternal   0 P   + @+ + * + + `+ clean_one_uidclean_sigs_from_uidinit_trustdbV-eqnmfu# List of assigned trustvalues, created %s # (Use "gpg --import-ownertrust" to restore them) changing ownertrust from %u to %u error finding trust record in `%s': %s TrustDB: %s line too longcolon missinginvalid fingerprintownertrust value missingsetting ownertrust to %u inserting ownertrust of %u read error in `%s': %s trustdb rec %lu: lseek failed: %s trustdb rec %lu: write failed (n=%d): %s can't acquire lock - giving up version, td=%lu, f=%lu, m/c/d=%d/%d/%d tm=%d nc=%lu (%s) %s: error reading version record: %s %s: error reading free record: %s %s: error writing dir record: %s %s: failed to zero a record: %s trustdb: lseek to end failed: %s %s: failed to append a record: %s upd_hashtable: read failed: %s upd_hashtable: write htbl failed: %s upd_hashtable: read item failed: %s hashtable has invalid indirections. upd_hashtable: read hlst failed: %s upd_hashtable: write hlst failed: %s upd_hashtable: write ext hlst failed: %s upd_hashtable: write new hlst failed: %s upd_hashtable: update htbl failed: %s hashtbl %lu: %lu/%d points to an invalid record %lu %s: failed to create hashtable: %s %s: error updating version record: %s migrate_from_v2: lseek failed: %s migrate_vfrom_v2: read error or short read migrate_from_v2: read error or short read failed to recreate version record of `%s' failed to write trust record of `%s' migrated %d version 2 ownertrusts trustdb: read failed (n=%d): %s %lu: read expected rec type %d, got %d %s: version record with recnum %lu %s: invalid record type %d at recnum %lu %s: error writing version record: %s %s: directory does not exist! %s: failed to create version record: %sdrop_from_hashtable: read failed: %s drop_from_hashtable: write htbl failed: %s drop_from_hashtable: read item failed: %s drop_from_hashtable: read hlst failed: %s hashtbl %lu: %lu/%d points to wrong record %lu hashtable has invalid indirections lookup_hashtable: read item failed: %s lookup_hashtable: read hlst failed: %s Error: The trustdb is corrupted. ../../g10/tdbio.cunusedrec %5lu, blank free, next=%lu htbl,hlst, next=%lu,trust , ot=%d, d=%d, vl=%lu valid , v=%d, next=%lu unknown type %d recnumdb_fd == -1can't create lock for `%s' NOTE: trustdb not writable gpgfound %d ownertrust records can't truncate `%s': %s failed to sync `%s' %s: invalid trustdb trustdb: lseek failed: %s %s: not a trustdb file %s: invalid file version %d can't access `%s': %s %s: invalid trustdb created %s: trustdb created lookup_hashtable failed: %s hashtable read failed: %s create_hashtabletdbio_new_recnumtdbio_write_recordopen_dbtdbio_set_dbnameput_record_into_cacheput_record_into_cachedelete_key.secret.okaydelete_key.okayOops; key not found anymore! %s: get secret key: %s deleting keyblock failed: %s %s: delete key failed: %s (unless you specify the key by fingerprint) can't do this in batch mode without "--yes" Delete this key from the keyring? (y/N) This is a secret key! - really delete? (y/N) ownertrust information cleared there is a secret key for public key "%s"! use option "--delete-secret-keys" to delete it first. SignCertifyEncryptAuthenticatepreference `%s' duplicated too many cipher preferences too many digest preferences ../../g10/keygen.cwriting direct signature 11223300SsEeAaQqCurrent allowed actions: (%c) Finished keygen.flags (%d) DSA and Elgamal (%d) DSA (sign only) (%d) RSA (sign only) (%d) RSA (encrypt only) keygen.algokeygen.sizeRequested keysize is %u bits pubkey_generate failed: %s dsa2_generate failed: %s auth%s:%d: invalid usage list seconds=Real name: keygen.nameInvalid character in name Email address: keygen.emailNot a valid email address keygen.commentInvalid character in comment NnCcEeOoQqkeygen.userid.cmdkey generation failed: %s communication error with SCD S9 S8 S7 S3 S2 S1 H8 H2 H9 H10 H11 Z2 Z3 Z1no-mdcKey is valid for? (0) keygen.validSignature is valid for? (%s) siggen.validinvalid value Key does not expire at all Key expires at %s Signature expires at %s Is this correct? (y/N) keygen.valid.okayReally create? (y/N) keygen.sub.okayKey generation failed: %s keygen.cardsub.okay!sk->is_protected)(1:e%u:)(1:p%u:)(1:q%u:%lu:%s: no Key-Type specified %s:%d: invalid algorithm %s:%d: invalid keyserver url dek%s:%d: invalid creation date %s:%d: invalid expire date outctrl->pub.streamoutctrl->sec.streamwriting public key to `%s' writing secret key to `%s' pri_skwriting self signature nskey <= 6 && npkey < nskeysk_%08lX%08lX.gpgbuild packet failed: %s can't write public key: %s can't write secret key: %s %s: no User-ID specified Key-Typemissing colonmissing argumentunknown keywordduplicate keywordencrypt sign %echo%dry-run%commit%pubring%secringskipping control `%s' (%s) %s:%d: %s %s:%d: read error Key generation canceled. [internal]Key-LengthKey-UsageSubkey-TypeSubkey-LengthSubkey-UsageName-RealName-EmailName-CommentExpire-DateCreation-DatePassphrasePreferencesRevokerHandleKeyservertoo many compression preferences You need a Passphrase to protect your secret key. You don't want a passphrase - this is probably a *bad* idea! I will do it anyway. You can change your passphrase at any time, using this program with the option "--edit-key". NOTE: Bad translation at %s:%d. Please report. Possible actions for a %s key: (%c) Toggle the sign capability (%c) Toggle the encrypt capability (%c) Toggle the authenticate capability Please select what kind of key you want: (%d) RSA and RSA (default) (%d) Elgamal (encrypt only) (%d) DSA (set your own capabilities) (%d) RSA (set your own capabilities) %s keys may be between %u and %u bits long. What keysize do you want for the subkey? (%u) What keysize do you want? (%u) We need to generate a lot of random bytes. It is a good idea to perform some other action (type on the keyboard, move the mouse, utilize the disks) during the prime generation; this gives the random number generator a better chance to gain enough entropy. keysize invalid; using %u bits keysize rounded up to %u bits WARNING: some OpenPGP programs can't handle a DSA key with this digest size invalid creation date in line %d You need a user ID to identify your key; the software constructs the user ID from the Real Name, Comment and Email Address in this form: "Heinrich Heine (Der Dichter) " Name may not start with a digit Name must be at least 5 characters long You are using the `%s' character set. You selected this USER-ID: "%s" Please don't put the email address into the real name or the comment Change (N)ame, (C)omment, (E)mail or (Q)uit? Change (N)ame, (C)omment, (E)mail or (O)kay/(Q)uit? Please correct the error first Note that the key does not use the suggested creation date invalid item `%s' in preference string make_keysig_packet failed for backsig: %s build_packet failed for backsig: %s writing key binding signature Please specify how long the key should be valid. 0 = key does not expire = key expires in n days w = key expires in n weeks m = key expires in n months y = key expires in n years Please specify how long the signature should be valid. 0 = signature does not expire = signature expires in n days w = signature expires in n weeks m = signature expires in n months y = signature expires in n years Signature does not expire at all Your system can't display dates beyond 2038. However, it will be correctly handled up to 2106. NOTE: creating subkeys for v3 keys is not OpenPGP compliant ((sk->pubkey_algo)==1 || (sk->pubkey_algo)==2 || (sk->pubkey_algo)==3 )%s:%d: specified Key-Usage not allowed for algo %d %s:%d: specified Subkey-Usage not allowed for algo %d %s:%d: invalid revocation key %s:%d: only one ring name is set dry-run mode - key generation skipped writing secret key stub to `%s' storing key onto card failed: %s can't create backup file `%s': %s NOTE: backup of card key saved to `%s' no writable public keyring found: %s no writable secret keyring found: %s error writing public keyring `%s': %s error writing secret keyring `%s': %s public and secret key created and signed. Note that this key cannot be used for encryption. You may want to use the command "--edit-key" to generate a subkey for this purpose. parameter block does not start with "Key-Type"save_unprotected_key_to_cardgenerate_card_subkeypairwrite_keybindinggenerate_subkeypairdo_create*++++++++ +, ,, %, -,4,get_parameter_u32ask_user_idproc_parameter_filedo_generate_keypairwrite_direct_sigwrite_selfsigsgen_card_key_with_backupgenerate_raw_keyask_expire_intervalmake_backsigset_one_pref../../g10/pipemode.cnested begin of stream invalid state for @> invalid state for @t invalid state for @. pipemode_filterEOF encountered at wrong state @@ not allowed in current state invalid state for operation code invalid operation for this state invalid escape sequence 0x%02x in stream o o o o o o o o o o o o o  o p o  o     o o o o o o o o o o o o o  o o  o o o o o o o o o o o o o o o o o o o o o o o o o o o o o @ pipemode_filtermake_controlNo help availableNo help available for `%s'keygen.algo.rsa_seEnter the size of the keykeygen.size.huge.okayAnswer "yes" or "no"keygen.size.large.okaykeyedit.updpref.okayIt's up to you to assign a value here; this value will never be exported to any 3rd party. We need it to implement the web-of-trust; it has nothing to do with the (implicitly created) web-of-certificates.To build the Web-of-Trust, GnuPG needs to know which keys are ultimately trusted - those are usually the keys for which you have access to the secret key. Answer "yes" to set this key to ultimately trusted If you want to use this untrusted key anyway, answer "yes".Enter the user ID of the addressee to whom you want to send the message.Select the algorithm to use. DSA (aka DSS) is the Digital Signature Algorithm and can only be used for signatures. Elgamal is an encrypt-only algorithm. RSA may be used for signatures or encryption. The first (primary) key must always be a key which is capable of signing.In general it is not a good idea to use the same key for signing and encryption. This algorithm should only be used in certain domains. Please consult your security expert first.Enter the required value as shown in the prompt. It is possible to enter a ISO date (YYYY-MM-DD) but you won't get a good error response - instead the system tries to interpret the given value as an interval.Enter the name of the key holderplease enter an optional but highly suggested email addressPlease enter an optional commentN to change the name. C to change the comment. E to change the email address. O to continue with key generation. Q to to quit the key generation.Answer "yes" (or just "y") if it is okay to generate the sub key.When you sign a user ID on a key, you should first verify that the key belongs to the person named in the user ID. It is useful for others to know how carefully you verified this. "0" means you make no particular claim as to how carefully you verified the key. "1" means you believe the key is owned by the person who claims to own it but you could not, or did not verify the key at all. This is useful for a "persona" verification, where you sign the key of a pseudonymous user. "2" means you did casual verification of the key. For example, this could mean that you verified the key fingerprint and checked the user ID on the key against a photo ID. "3" means you did extensive verification of the key. For example, this could mean that you verified the key fingerprint with the owner of the key in person, and that you checked, by means of a hard to forge document with a photo ID (such as a passport) that the name of the key owner matches the name in the user ID on the key, and finally that you verified (by exchange of email) that the email address on the key belongs to the key owner. Note that the examples given above for levels 2 and 3 are *only* examples. In the end, it is up to you to decide just what "casual" and "extensive" mean to you when you sign other keys. If you don't know what the right answer is, answer "0".Answer "yes" if you want to sign ALL the user IDsAnswer "yes" if you really want to delete this user ID. All certificates are then also lost!Answer "yes" if it is okay to delete the subkeyThis is a valid signature on the key; you normally don't want to delete this signature because it may be important to establish a trust connection to the key or another key certified by this key.This signature can't be checked because you don't have the corresponding key. You should postpone its deletion until you know which key was used because this signing key might establish a trust connection through another already certified key.The signature is not valid. It does make sense to remove it from your keyring.This is a signature which binds the user ID to the key. It is usually not a good idea to remove such a signature. Actually GnuPG might not be able to use this key anymore. So do this only if this self-signature is for some reason not valid and a second one is available.Change the preferences of all user IDs (or just of the selected ones) to the current list of preferences. The timestamp of all affected self-signatures will be advanced by one second. Please enter the passhrase; this is a secret sentence Please repeat the last passphrase, so you are sure what you typed in.Give the name of the file to which the signature appliesAnswer "yes" if it is okay to overwrite the filePlease enter a new filename. If you just hit RETURN the default file (which is shown in brackets) will be used.You should specify a reason for the certification. Depending on the context you have the ability to choose from this list: "Key has been compromised" Use this if you have a reason to believe that unauthorized persons got access to your secret key. "Key is superseded" Use this if you have replaced this key with a newer one. "Key is no longer used" Use this if you have retired this key. "User ID is no longer valid" Use this to state that the user ID should not longer be used; this is normally used to mark an email address invalid. If you like, you can enter a text describing why you issue this revocation certificate. Please keep this text concise. An empty line ends the text.  ? ?@n@%4A>LB%>>>>>'Cs(>&C&C&4D*'XD(D>4E>Q>>J&Jq4KdK(L MpM>N@OxO7OOC0P|PRldapshkps pusu0xsendVERSION %d PROGRAM %s SCHEME %s OPAQUE %s AUTH %s HOST %s PORT %s PATH %s OPTION %s COMMAND GET 0x%08lX%08lX 0x%08lX 0x0000000000000000 ../../g10/keyserver.crequesting key %s from %s COMMAND GETNAME searching for names from %s COMMAND SEND INFO %08lX%08lX BEGIN %sb:%08lX%08lX:%u:%u:%u:%u:sig:%08lX%08lX:%X:%u:%u INFO %08lX%08lX END KEY %08lX%08lX BEGIN KEY %08lX%08lX END sending key %s to %s COMMAND SEARCH searching for "%s" from %s no keyserver action! VERSION PROGRAM OPTION OUTOFBANDSEARCH BEGIN ENDinfo:(%d) %s %d bit unknown key %s%08lXkey %skey key not found on keyserver keyserver timed out keyserver internal error Keys %d-%d of %d for "%s". keysearch.promptno-http-proxyno-honor-http-proxyno-use-temp-filesstring!=((void *)0)x-broken-hkpbroken-http-proxyx-hkp"%s" not a key ID: skipping mailtorefreshing 1 key from %s refreshing %d keys from %s _pgpkey-ldap._tcp.%s:%umax-cert-sizeinclude-revokedinclude-subkeyskeep-temp-filesrefresh-add-fake-v3-keyidshonor-keyserver-urlhonor-pka-record                                               keyserver_spawnprint_keyrecparse_keyserver_urino keyserver known (use option --keyserver) # This is a GnuPG %s keyserver communications file requesting key %s from %s server %s searching for names from %s server %s sending key %s to %s server %s searching for "%s" from %s server %s invalid keyserver protocol (us %d!=handler %d) WARNING: keyserver handler from a different version of GnuPG (%s) keyserver did not send VERSION key "%s" not found on keyserver no handler for keyserver scheme `%s' action `%s' not supported with keyserver scheme `%s' gpgkeys_%s does not support handler version %d keyserver communications error: %s Enter number(s), N)ext, or Q)uit > WARNING: unable to refresh key %s via %s: %s WARNING: unable to fetch URI %s: %s WARNING: unable to parse URI %s include revoked keys in search resultsinclude subkeys when searching by key IDuse temporary files to pass data to keyserver helpersdo not delete temporary files after using themautomatically retrieve keys when verifying signatureshonor the preferred keyserver URL set on the keyhonor the PKA record set on a key when retrieving keysjpgimage/jpegimage/x-unknowneog %ixloadimageeogno photo viewer set %08lX%08lX.%sunable to display photo ID! photoid.jpeg.addphotoid.jpeg.size`%s' is not a JPEG file photoid.jpeg.okayxloadimage -fork -quiet -title 'KeyID 0x%k' stdindisplay -title 'KeyID 0x%k' %i Pick an image to use for your photo ID. The image must be a JPEG file. Remember that the image is stored within your public key. If you use a very large picture, your key will become very large as well! Keeping the image close to 240x288 is a good size to use. Enter JPEG filename for photo ID: unable to open JPEG file `%s': %s This JPEG is really large (%d bytes) ! Are you sure you want to use it? (y/N) Is this photo correct (y/N/q)? tempin.txttempout.bintempout.txttempin.bin/tmpTMPDIRTMP%s/gpg-XXXXXX%s/%sset_exec_path: %s %/bin/sh../../g10/exec.cexpanding string "%s" SHELLexeclp: %s execlp: %s -c %s -cusing temp file `%s' system() command is %s external program calls are disabled due to unsafe options file permissions args expanded to "%s", use %u, keep %u unable to execute program `%s': %s unable to execute shell `%s': %s system error while calling external program: %s unnatural exit of external program unable to execute external program unable to read external program response: %s WARNING: unable to remove tempfile (%s) `%s': %s WARNING: unable to remove temp directory `%s': %s exec_write../../cipher/cipher.cAESAES192AES256RIJNDAELRIJNDAEL192RIJNDAEL256cipher %d w/o key length cipher %d not found cipher %d w/o blocksize !(nbytes%c->blocksize)can't disable cipher algo %d: table full cipher_open: algorithm %d not available WARNING: cipher_setiv: ivlen=%u blklen=%u cipher_encrypt: invalid mode %d cipher_decrypt: invalid mode %d cipher_decryptcipher_encryptsetup_cipher_table../../cipher/pubkey.cno decrypt() for %d no encrypt() for %d no verify() for %d no sign() for %d ELGpubkey_encrypt: algo=%d pkey: data: encr:pubkey_decrypt: algo=%d skey: plain:pubkey_sign: algo=%d sig:can't disable pubkey algo %d: table full setup_pubkey_table../../cipher/md.cno asn for md algo %d dbgmd-%05d.%.10smd debug: can't open %s md_enable: algorithm %d not available more than algorithm in md_read(0) more than algorithm in md_digest(0) WARNING: more than algorithm in md_get_algo() WARNING: no length for md algo %d Oops: md debug already started load_digest_modulemd_digestmd_readmd_writeextension `%s' already registered DES maintenance test failed.Triple-DES test failed.DES weak key detection failedTriple-DES SSLeay test pattern no. %d failend on encryption.Triple-DES SSLeay test pattern no. %d failend on decryption.1dUZR8IgL&18IgL&18IgL&1QEKX-D qxn*CCCBD0YW7B@#Eg#Eg#Egsomedata=O#EgUUUUUUUU#Egsomedata#EgUUUUUUUUܺvT2somedataHcbrRg fY!dj4Wsquiggle}*f0[~r)tF4 b2[@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @ @@@ @ @@ @@ @@@ @@ @@@ @@@@ @ @ @@@@ @@@@@ @ @ @@@@ @@ @@ @ @@ @@@ @@@@ @ @@ @@@@@ @@ @@                                                             B@@@BB@@@@BBB@BBB@B@@B@BBBB@B@@@TWOFISHTWOFISH128Twofish-128 test encryption failed.Twofish-128 test decryption failed.Twofish-256 test encryption failed.Twofish-256 test decryption failed..Sj/4TE\k0K5UF $]l1+Ls6͂VbGO%^'fm֜y2h,Z)"M`{;t7oWcܬH PBx&e_(!Ygnz: Aî3Di-R J[*#Nar=|<}u>8?vp~X dw@9I QCqȡ @My>|7n 0`[!BEY)R (P 4hc{|7n 0`[!BEY)R (P 4hc{ 3`&_\v*IR!_ē ّŅ9I-O1;G#mFN>-idH*Oe/x\Xz՘WKgZd(c?)3&_v*I!9ͭ1#N-HOex\XWgdcid*/zKZ(?)B3||&_==סv*Ia!s?ٵmmŮxx9mřͤvv>>1gˋG[#``ݰjjMMN-|UUHZ~~O!!ze&^^xfZZ\KeeXNbbE@@W33g^d}OOjc/ttu \\t<3--00I..IIhrFFDUwwبMC((i))y.JY BBnG//49##5bj녅"ɡqq𐐛SዋNNo>oo TRۻ{/ii99 a#PDllF''%vІPPVU Q%zz99٩gqRRevEEKKࠀZZfxjjcc**68T Cb5$AAwl((C2u{{7& pDD~~ZHzжG$$<0祄kkAT``#E::[h=Y!ff1oo>WWc[M.mmكQS]]c|hh;?00֥zz%  5㧧#a鯌:\\ s11',v%VV {Nk44SjÙ[[GGk""ȽEnⳳtt/fXXV +^^,,µIIϕ~}} d wm9j||3qqb7q=yQ >>ܭ??-$vvUU@@xx%%͹MwwUD PP077ӡ@aa4NNTTlpss*;;Rҟ A{؈Og1''Fgg'88( HHx`.LLeeK\++DZoBB RJJ==_Y :Ia|-!!OBrr;//GH,mF<)iOO}d*..Iii/\^zчddե&&K`Z66"(uu?y)--3B|3|&=_=סv䔁*Ias!ė?mmxxm9vv>>g1G[`#`jjMMN|-ޝUUZ~H~!O!z&e^^fZxZKe\eNbXbE@@3W3g^}OdOjc/ttu \\t3-<-00I..IIrFhFUwDwبM(C()iy)ّ.ѬJYּ֨ BBn/G/9#4#b5j܅"qqSԋNNo>ooT R{i/i99 #aôDlPlF''v%PPVUQ %zz٩9ِgqqReevEKfxZfݰjc68*6T TC Cb5b$$wlAwC(2u27{ԛ&p pDZH~ZzzЌGG<0$o>Wc[[MM.mQSSc|]c;h;??֥0%z% 55#a#鯀:\s ',1'v%v V{{NkS4jęÙ[GkkȽ"Enn/t/f̙XVԋ ++^µ,‰I~~ } ddw m9mjj3|ѡqb7q7=y=Q Qܭ>-$?-vU؂@x͹%MUDwU  P00ӡ7@@4a4NlpTl*s*R;R A {؈OOg1gF'F'g( 8(x`Hx..LK\eKDZ+oo B RJ_=YY ::Iaa|-|O!BB;r۸G/HH,m,FW)i)}dO}*I.I/i\\^^zЇчdK&``Z"(6"?uy)y3<-3_Ly_ʖX5XĜCUMY8}8W3itSittėVVr~JJ"NXbN_94#9nDPlD]2]rhFr&e&͓Ȟւ+nP@pP܅u u2ߍL)Ls!s ]Qo6BJ^lV@ ;Un.F򢂷[N WsM,p !oTO,2#&5 ã ßX\,2/*ZԑÞkxTBlowfish selftest failed (1).Blowfish selftest failed (2).Blowfish selftest failed (3).Blowfish selftest failed (4).abcdefghijklmnopqrstuvwxyz2NBLOWFISHj?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:CAST5 selftest failed (%s). CAST5@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #PhꃢRijndael-128 test encryption failed.Rijndael-128 test decryption failed.Rijndael-192 test encryption failed.Rijndael-192 test decryption failed.Rijndael-256 test encryption failed.Rijndael-256 test decryption failed.QP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% Ky xZݨ31Y'_`QJ -zɜ;M*W^EL;k5f'q)|_ REHKEWYs7}:o-a vm`dwmzRYڛ[Tщ@ĊIN>7,%1<+&MFCMQP_[u‰j{˄aiГ|gٞw=3!/2 9$/vM֍xDۆj_̛dVNi@`R{\r >!0("3,:= 6+ 2?(% necntsyxޱZIиWB£@_̪MTAO]Sywek1?-# | GuLnQgZX>kQ3`J$}C)v4b=o&x /uV3[8L% A.al{vUXOB һ=ܲ0Ω'*zGhW^EL;k5f'q)|_ REHKEWYs7}:o-a vm`dwmzڕRYћ[T̉@CLJIN>7,%1<+&FMMCPQ[_ju‰a{˄|iГwgٞ=3!/29 $/vMֆxDۛj_̐dVNi@`R{\r >!0("3,:=6 + 2?( %enncstxyIޱZBиW_£@T̪MAO]Sywek1?-# G| LuQnZgkX>`Q3}J$vC)4b=o &x/u3V8[%L. Aal{vUXOB һ=ܲ0Ω'*hW^ELk;f5q'|)_R EHKEWY7s:}-o amv`wdzmYڕRTћ[C̉@NLJI>7,%1<+&FMMCPQ[_ju„a{˓|iОwg=3!/29 $/֍vMۆxD̛j_dVNi@`R{\r >!0("3,:= 6+ 2?(% necntsyxZIޱWBи@_£MT̪AO]SywekӲ1?-#  G|LuQnZg>kX3`Q$}J)vCb4o=x &u/V3[8L%A. al{vUXOB =һ0ܲ'Ω*W^ELk;f5q'|)_R EHKEWY7s:}-o avm`dwmzRYڕ[Tћ@C̉INLJ>7,%1<+&FMMCPQ[_‰ju˄a{Г|iٞwg=3!/29 $/M֍vDۆx_̛jVdiN`@{Rr\ !>(03":,= 6+ 2?(% necntsyxZI޸WBУ@_ªMTAO]Sywek1?-# | GuLnQgZX>kQ3`J$}C)v4b=o&x /uV3[8L% A.al{vUXOB =Ҳ0ܩ'Π*G^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,c|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-T @6lM/^c5j}wqr  !"#$&'()+,-.jEߕ!] ּG  vwtuwpqrgCQ͚x K"x3Q6CCAMELLIA128 test encryption failed.CAMELLIA128 test decryption failed.CAMELLIA192 test encryption failed.CAMELLIA192 test decryption failed.CAMELLIA256 test encryption failed.CAMELLIA256 test decryption failed.CAMELLIA128CAMELLIA192CAMELLIA256../../cipher/elgamal.celg p= elg g= elg y= elg x= ELG-Echoosing a random k of %u bitschoosing a random x of size %uElgamal operation: encrypt, decrypt failed gen_kw    (19@HOgeneratephi= f= n= e= d= u= RSA-ERSA-SRSA operation: public, secret failed RSA operation: secret, public failed ../../cipher/primegen.coverflow in prime generation prime : factor q: factor q0: factor pi: bit sizes: prime=%u, q=%u, q0=%u, p%d=%uchecking g: mpi_cmp( x, nminus1 ) < 0 && mpi_cmp_ui( x, 1 ) > 0can't generate a prime with less than %d bits can't gen prime with pbits=%u qbits=%u gen prime: pbits=%u qbits=%u fbits=%u/%u n=%d generate_elg_primem_out_of_nis_primeNo way to gather entropy for the RNG WARNING: using insecure random number generator!! The random number generator is only a kludge to let it run - it is in no way a strong RNG! DON'T USE ANY DATA GENERATED BY THIS PROGRAM!! `%s' is not a regular file - ignored note: random_seed file is empty WARNING: invalid size of random_seed file - not used random usage: poolsize=%d mixed=%lu polls=%lu/%lu added=%lu/%lu outmix=%lu getlvl1=%lu/%lu getlvl2=%lu/%lu note: random_seed file not updated can't lock `%s': %s waiting for lock on `%s'... can't stat `%s': %s can't read `%s': %s ../../cipher/random.ccan't write `%s': %s can't close `%s': %s fast_random_pollset_random_seed_fileread_poolC0choosing a random k ../../cipher/dsa.cnbits >= 512qbits >= 160qbits %8 == 0choosing a random x dsa p= dsa q= dsa g= dsa y= dsa x= DSA:: sign, verify failed DSAgenerategenerate/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqcan't open %s: %s stat() off %s failed: %s /dev/random/dev/urandomselect() error: %s Not enough random bytes available. Please do some other work to give the OS a chance to collect more entropy! (Need %d more bytes) bogus read from random device (n=%d) read error on random device: %s "(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl_idea_get_infoinvalid module `%s': %s trying to load an extension while still setuid ppp,,,'''WWW555 AAA###kkkEEE!!!OOONNNeee|||>>>000___^^^ 999GGG]]]===ZZZQQQVVVlllMMM fff---ttt+++ LLL444~~~vvvmmm111XXX:::aaa222SSS"""DDDzzz$$$```iiiPPP}}}bbbTTT[[[dddHHHuuu ???\\\JJJ333sssgggRRR&&&777;;;oooKKKccc...yyynnn)))///YYYxxxjjjFFFqqq%%%BBBrrrUUU 666III***hhh<<<888@@@((({{{CCCwwwXXXgggNNN jjj]]]FFF'''222KKKBBB:::%%%{{{ qqq___>>>|||```444MMMrrrzzz555aaaZZZ$$$VVV@@@ccc 333hhh oooSSSbbb...(((ttt666"""888ddd999,,,000DDDeeekkk###HHHQQQUUUAAACCC///<<<+++ GGG~~~)))!!!fff;;;777LLLnnnvvv---&&&}}}\\\OOO???yyyRRRmmm^^^iii111 uuuJJJWWWEEEsssYYYlllTTTxxxpppIIIPPPwww***[[[===888AAAvvvٓ```rrr«uuuWWWɢҐ'''IIICCC\\\>>>gggnnn///ⅅ SSSeee꣣쀀---kkk+++666ņMMM333fffXXX::: xxxBBB&&&aaa???;;;Ԙ苋 ,,,oooNNN yyy"""YYY===tttTTT000~~~(((UUUhhhPPP111***ppp222iiibbb$$$EEEsssmmmJJJ...%%%HHH{{{οqqq)))llldddcccKKK___FFF777^^^GGG[[[ZZZ<<>>^^^ 999]]]ZZZQQQlllttt+++444vvvmmm:::222SSSzzz$$$```iiibbbTTTddduuu ݇͐sssRRRƁoooccc)))///xxxqqqԫrrr666***<<<@@@ӻCCCwww'''555 AAA!!!NNNeee000___GGG===VVVMMM fff--- LLL~~~111XXXaaa"""DDDPPP}}}[[[HHH???\\\JJJ333ggg&&&777;;;KKK...yyynnnYYYjjjFFF%%%BBBUUU IIIhhh888((({{{Ǟ../../mpi/mpi-pow.c!bp_marker!mp_markermpi_powm../../mpi/mpi-mpow.ci==kk < 10idx >= 0 && idx < (1<Copyright (C) 2010 Free Software Foundation, Inc.This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. This is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 3 of the License, or (at your option) any later version. It is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this software. If not, see . lfjldummy m_size called out of %s memory while allocating %u bytes (this may be caused by too many secret keys used simultaneously or due to excessive large key sizes) WARNING: using insecure memory! please see http://www.gnupg.org/faq.html for more information can't mmap pool of %u bytes: %s - using malloc can't allocate memory pool of %u bytes Oops, secure memory pool already initialized operation is not possible without initialized secure memory (you may have used the wrong program for this task) secure memory corrupted at block %p secmem usage: %u/%u bytes in %u/%u blocks of pool %lu/%lu failed to drop setuid secure memory is disabledfailed to reset uid: %s can't lock memory: %s unknown packet typeunknown versionunknown pubkey algorithmunknown digest algorithmbad public keybad secret keybad signaturechecksum errorbad passphrasepublic key not foundunknown cipher algorithmcan't open the keyringinvalid packetinvalid armorno such user idsecret key not availablewrong secret key usedbad keyfile read errorfile write errorunknown compress algorithmfile open errorfile create errorinvalid passphraseunknown signature classtrust database errorbad MPIresource limitinvalid keyringbad certificatemalformed user idfile close errorfile rename errorfile delete errorunexpected datatimestamp conflictunusable pubkey algorithmfile existsweak keyinvalid argumentbad URIunsupported URInetwork errorselftest failednot encryptednot processedunusable public keyunusable secret keykeyserver errorcanceledno datag10err=%dunimplemented pubkey algorithmunimplemented cipher algorithm{qg]SI?5+! wmcYOE;1' QQfd_cache_invalidate (all) fd_cache_invalidate (%s) did (%s) ../../util/iobuf.c%s: read error: %s %s: write error: %s file_filter(fd)%s: close fd %d fd_cache_close (%d) real a->d.start == a->d.leniobuf-%d.%d: error IOBUFCTRL_FREE failed: %s iobuf-%d.%d: underflow: eof r+biobuf-%d.%d: openrw `%s' [all]iobuf-*.*: ioctl `%s' fsync fd_cache_synchronize (%s) [fd %d]iobuf-%d.%d: fdopen `%s' iobuf-%d.%d: create `%s' can't rewind fd %d: %s iobuf-%d.%d: open `%s' fd=%d flush on non-output iobuf iobuf_flush: no filter iobuf-%d.%d: push `%s' IOBUFCTRL_INIT failed: %s iobuf_close -> %p iobuf-%d.%d: close `%s' iobuf-%d.%d: pop `%s' iobuf-%d.%d: popped filter a->d.start == 1a->d.len < a->d.sizea->buflen <= 512c <= 0x1fn == 512!a->buflennbytes < 512init block_filter %p block_filterblock_filter: pending bytes! free block_filter %p fstat() failed: %s can't seek: %s can't lseek: %s a->use == 1 || a->use == 2iobuf chain: %d.%d `%s' filter_eof=%d start=%d len=%d fd_cache_close (%s) used existing slot fd_cache_close (%s) new slot created iobuf-%d.%d: pop `%s' in underflow iobuf-%d.%d: underflow: eof (due to filter eof) iobuf-%d.%d: underflow: req=%lu iobuf-%d.%d: underflow: got=%lu rc=%d iobuf-%d.%d: pop in underflow (!len) iobuf-%d.%d: underflow: eof (no filter) iobuf-%d.%d: ioctl `%s' keep=%d iobuf-*.*: ioctl `%s' invalidate iobuf-%d.%d: ioctl `%s' no_cache=%d fd_cache_open (%s) using cached fp fd_cache_open (%s) not cached increasing temp iobuf from %lu to %lu iobuf_flush did not write all! iobuf_flush failed on close: %s IOBUFCTRL_FREE failed on close: %s iobuf_flush failed in pop_filter: %s can't remove the last filter from the chain Ohh jeee, trying to remove a head filter Ohh jeee, trying to remove an intermediate filter pop_filter(): filter function not found block_filter: 1st length byte missing block_filter: 2nd length byte missing block_filter: invalid 4 byte length block_filter %p: read error (size=%lu,a->size=%lu) block_filter: write error: %s pop_filter called in iobuf_seek - please report pop_filter called in set_partial_block_mode - please report iobuf_set_partial_block_modepop_filterpop_filterblock_filterblock_filterfile_filteriobuf_writeiobuf_writebyteiobuf_writebyteiobuf_peekunderflowiobuf_push_filter2error opening lockfile `%s': %s invalid pid %d in lockfile `%s'failed to create temporary file `%s': %s lock not made: link() failed: %s Oops: lock already held by us removing stale lockfile (created by %d) waiting for lock (held by %d%s) %s... release_dotlock: lockfile error release_dotlock: not our lock (pid=%d) release_dotlock: error removing lockfile `%s'error reading lockfile `%s'invalid size of lockfile `%s'%10d %.*s/.#lk%p.%n%s.%derror writing to `%s': %s (deadlock?) oops, `%s' is already locked cannot read lockfile lockfile disappeared oops, `%s' is not locked v=pka1fpr=uri=../../util/convert.chex2str_alloc0123456789abcdef0123456789ABCDEF0X(null)../../util/estream-printf.cargidx < argspecs_len!"bug"0123456789abcdefxparm.usedvaluetable[arg->width_pos-1].vt == VALTYPE_INTvaluetable[arg->precision_pos-1].vt == VALTYPE_INTarg->vt == valuetable[arg->arg_pos-1].vtxZVVpZVVVhZVVV`ZVXZVVZ$]xWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxW]xW\xW\xWxWxWxWxWxWxW\xWxWxWxWxW\`W`W aa)aWWWWWWWWWWW8aWWWWQaWWWWWWWW`aWoa~aaaaW~aWWWaaaaWWaW bWW`Y9]]]]]l]l]l]l]l]l]l]l]F]ZY]Z]_bbbbb8b8b8b8bbbbb8bbb8b8b8b8b8b8b8b8b8b8b8b8b]i~irifiZiNiBiF]6i*iiii%bb]hhhhh%bbgdgdgdgdgdg5e5e5e5e5e5e5e5eddcdg)ldEjdEjdkddddkEjlkk8j8jkk8j8j7ldkdkdlddddldEjk-m$mmm m6m?mestream_vasprintfdo_format fatal: too many args for xstrconcat fatal: out of memory ../../util/assuan-buffer.catticlen < 1002ctx->inbound.eof%s[%u.%p] DBG: <- [EOF] %s[%u.%p] DBG: <- [Confidential data not shown]%s[%u.%p] DBG: -> %s[%u.%p] DBG: <- [Error: %s] %s[%u.%p] DBG: <- [Invalid line] %s[%u.%p] DBG: -> [supplied line too long -truncated] %s[%u.%p] DBG: -> [supplied line contained a LF -truncated] _assuan_read_lineno errorproblem starting servernot a servernot a clientnested commandsinvalid responseno data callbackno inquire callbackconnect failedaccept failednot implementedserver faultinvalid commandunknown commandsyntax errorparameter errorparameter conflictline not terminatedno inputno outputunsupported algorithmserver resource problemserver io errorserver bugno data availableunexpected commandtoo much datainquire unknowninquire errorinvalid optioninvalid indexunexpected statusinvalid statuslocale problemnot confirmeduser error firstuser error lastec=%u.%uec=%dcan't create socket: %s can't connect to server: %s BYE@w80(; ,f<ghhzR| (ewAB Hc AA H (HN^n~΢ޢ.>N^n~Σޣ.>N^n~Τޤ.>N^n~Υޥ.>N^n~Φަ.>N^n~Χާ.>N^n~Ψި.>N^n~Ωީ.>N^n~Ϊު.>N^n~Ϋޫ.>N^n~άެ,sb۸ eŸ'4BcϸBdDLcBqBBASSK.'? W cv ,B 3P?pLBWBjBB012BB BB(WB*&B$8#CB%RB+^B+fB,oB,wB! B-B-aa#BrRBrBJBKBLBB%B@B9B/Bu=zܰkNBlHBm]BtB3u4B5B6B7B8B9B:B;B<B=B>B?B@Bo#6BvqABGBQBNBbB_BtBqBB~Bn+iBBB_BCBDBEBFBGBHBI B%BB+B:BIBVBeBmBMLBNuBO{BPBRBSBTBUBBBXBYBZBB[B\TB\B\&B\.B\6B]pB^fB_>B`EFazbBcBdBeeBfbBrB{BBBBgBhBiBjBjBBBBBBBBNBN!B/B<B.,/x)kB"JB&TB.}BkBnBoaBpoBqBrBsBtBuBvBwBxܼByBzB{B|B| B}*B~=BIBTB\BeBqBBBBBBB=BBBBBBB B B/B>BBJBNBB@BuBmB_BVcBW`BWpB{BBBBBBBBBBBBBBB(B?B<B[BXBBͼBhBnB}BBBBBBBBBNBbBB'B>B;BBQBiByBB B/BBBB B)BEBcByBBBBBBBBBBBBBBB0BB,BGB_BkBxBBQBBBBBBuBrBBBBB0B-BABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/010  `He 0Q0  `He@0A0  `He0010  `He 0-0  `He0!0 +0!0 +$@wXX\X]WD]X|]XN]X]X ^ %)+/5;=CGIOSYaegkmq %379=KQ[]agou{  #-39;AKQWY_eikw)+57;=GUY[_mqsw %'-?CEIOU]ci  ')/QW]ew #+/=AGIMSU[ey '7EKOQUWamsy!#')3?AQSY]_iq   # % + / 5 C I M O U Y _ k q w   ! 1 9 = I W a c g o u {      # ) - ? G Q W ] e o {   % / 1 A [ _ a m s w      ! + - = ? O U i y !'/5;KWY]kqu}  %)1CGMOSY[gk!%+9=?Qisy{ '-9EGY_cio #)+17AGS_qsy} '-7CEIOW]gim{0 0 *H 0!0 +$0!0 +0-0  `He010  `He 0A0  `He00Q0  `He@^gpg%d.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink TThh !$4o> \\0 FNo(([oЙj Xs  |!0w88! 00-   ! @@!  $6$ $H6H N N N N O O S \ `q\  \ d