ELF4 4 ( ` ` ` #6H H H $$Ptdk k k LLQtdRtd` ` ` GNUnQpgC SwT?WV  8 BG   @B !VC$!$   I"+ jB%5{#WF   ")*!-1%+$S $ g3 #!S%zb ^j "Xk %" 4  %  ebYH%%8    # q&!L!m" A # X"gG$o }  A#Z k6~FU#Y>t #_m\ PxQ+I"i e y O0 E " ( v  rz! 3  1  - a   1"Z3^:P$] fg  +!M1$Z%ewz$p" $=o 'O 83m#B9_@q 82 $^   BfnA!  #NeBd$3*7$NJ1<"h "$# \ G   u X# $(%8 HS $ 4qt Rz uh}# " !"=j }G!A &`At:oga!A9"% $E$ 0xJRxQ)"+T __gmon_start____cxa_finalize_Jv_RegisterClassesstrchrstrlenstrncasecmpstrcasecmpast_str_appendast_log__ao2_lock__ao2_unlocksscanfstrcasestrmemcpycallocast_str_setast_sockaddr_stringify_fmtoption_debugast_optionsast_debug_get_by_module__ao2_refstrcmpast_random__ast_string_field_ptr_build__snprintf_chkusleepast_sched_delast_sockaddr_cmpreallocpthread_setspecific__ast_verbose__vsnprintf_chk__ao2_unlink__ao2_callback__ao2_allocpipe__ao2_link__errno_locationstrerror__ao2_find__ao2_trylock__ast_pthread_mutex_lock__ast_pthread_mutex_unlock__ast_string_field_initpthread_key_createast_rtp_instance_set_propast_udptl_setnat__ast_string_field_ptr_grow__ast_string_field_release_active__ast_string_field_empty__ast_string_field_alloc_spaceast_exists_extension__strdupast_add_extensionast_context_findpbx_find_extensionast_context_remove_extensiongmtime_rpbx_builtin_getvar_helperast_getformatbynameast_trueast_variable_newast_event_unsubscribeast_check_realtimeast_db_delast_update_realtime__ast_app_separate_argsast_event_subscribeast_rtp_instance_stopast_udptl_stopast_cc_agent_status_responseast_get_cc_offer_timerast_sched_addast_cc_failedast_module_unrefast_codec_pref_indexast_getformatnameast_cliast_sched_reportast_xml_read_memoryast_xml_get_rootast_xml_node_get_nameast_xml_get_attributeast_xml_free_attrast_xml_find_namespaceast_xml_get_ns_hrefast_xml_node_get_childrenast_xml_node_get_nextast_xml_closeastman_get_headerastman_send_listackastman_appendast_var_nameast_var_deleteast_var_valueast_get_encoded_strpbx_builtin_setvar_helperast_sockaddr_hash__ctype_tolower_locast_set_calleridast_is_shrinkable_phonenumberast_shrink_phone_numberast_queue_control_dataast_udptl_get_far_max_ifpast_udptl_set_tagpbx_findapppbx_execstrncatast_udptl_set_far_max_datagramast_udptl_set_error_correction_schemeast_rtp_instance_dtmf_beginast_rtp_instance_dtmf_mode_getstrstrast_strip_quoted__ast_manager_event_multichanast_devstate_changedao2_iterator_init__ao2_iterator_nextao2_iterator_destroyregexecast_cli_completeregcompstrcpyast_sockaddr_cmp_addr_ast_sockaddr_portpthread_selfpthread_killast_pthread_create_stackast_rtp_instance_get_codecsast_rtp_codecs_payload_codeast_codec_pref_getsizeast_rtp_lookup_sample_rate2ast_rtp_lookup_mime_subtype2ast_falseast_variable_retrieveast_category_browseast_category_rootstrrchroption_verboseast_verbose_get_by_moduleast_sched_find_dataast_sched_add_variableregfreesnprintfast_localtimeast_strftimeast_dsp_newast_dsp_set_featuresast_rtp_instance_dtmf_mode_setast_dsp_set_digitmodeast_rtp_instance_set_read_formatast_rtp_instance_set_write_formatast_rtp_instance_make_compatibleast_dsp_freeast_deactivate_generatorast_moh_stopast_rtp_engine_srtp_is_registeredast_null_frameast_rtp_instance_readast_udptl_readast_set_read_formatast_set_write_formatast_dsp_processast_async_gotoast_sockaddr_is_ipv6ast_sockaddr_is_anyast_sockaddr_parseast_get_ip_or_srv_ast_sockaddr_set_portast_get_cc_monitor_policyast_cc_get_current_core_idast_channel_get_device_nameast_queue_cc_frameast_module_refast_get_hintast_device_stateast_channel_callbackast_print_groupast_md5_hash__strsep_gast_party_id_presentationast_uri_encodeast_getformatname_multipleast_extension_state2strao2_container_countqsortast_rtp_instance_get_statsgettimeofdayast_cc_agent_callbackast_rtp_instance_get_remote_addressast_rtp_instance_get_local_addressast_apply_haast_data_add_node__ast_data_add_structureast_data_add_strast_data_add_intast_cdr_flags2strast_data_add_boolast_describe_caller_presentationast_data_add_codecsast_data_search_matchast_data_remove_nodeast_tos2str__memcpy_chkast_rtp_instance_newast_rtp_instance_set_timeoutast_rtp_instance_set_hold_timeoutast_rtp_instance_set_qosast_rtp_codecs_packetization_setast_cc_copy_config_paramsast_duplicate_ha_listast_udptl_destroyast_udptl_new_with_bindaddrast_sockaddr_resolveast_sockaddr_ipv4memmovesetsockoptast_sendtoast_tcptls_client_createast_ouraddrforast_internal_timing_enabledast_udptl_get_usast_udptl_get_local_max_datagramast_udptl_get_error_correction_schemeast_sockaddr_is_ipv4_mappedstrspnstrtolast_rtp_codecs_payload_lookupast_rtp_codecs_payloads_unsetast_codec_pref_setsizeast_rtp_codecs_payloads_set_rtpmap_type_ratestrncmpstrncpystrtok__sprintf_chkast_rtp_codecs_payloads_clearast_rtp_codecs_payload_formatsast_rtp_lookup_mime_multiple2ast_rtp_instance_set_remote_addressast_rtp_codecs_payloads_copyast_udptl_set_peerast_udptl_get_far_max_datagramast_codec_chooseast_queue_frameast_rtp_codecs_payloads_set_m_typeast_rtp_red_initast_queue_controlast_uri_decodeast_pickup_extast_cc_agent_recallingast_canmatch_extensionast_bridged_channelmallocast_register_file_versionast_unregister_file_version__ast_channel_allocast_channel_cc_params_initast_best_codecast_rtp_instance_fdast_channel_set_fdast_udptl_fdast_jb_configureast_cc_monitor_failedast_cc_agent_caller_busyast_rtp_instance_get_and_cmp_remote_addressast_udptl_get_peerast_party_connected_line_initast_party_connected_line_copyast_softhangup_nolockast_party_connected_line_freeast_state2strast_channel_masqueradeast_cel_report_eventast_streamfileast_waitstreamast_do_masqueradeast_indicateast_channel_queue_connected_line_updateast_connected_line_build_dataast_aoc_get_unit_infoast_aoc_get_charge_typeast_aoc_get_msg_typeast_aoc_get_currency_amountast_aoc_get_currency_multiplier_decimalast_aoc_get_currency_nameast_rtp_instance_dtmf_end_with_durationast_rtp_instance_dtmf_endast_cause2strast_rtp_instance_activateast_setstateast_rtp_instance_update_sourceast_queue_hangup_with_causeast_cc_is_recallast_rtp_instance_available_formatsast_cc_get_monitor_by_recall_core_idast_extension_state_delast_variables_destroyast_free_haast_dnsmgr_releaseast_cc_config_params_destroy__ast_pthread_mutex_destroy__ast_calloc_with_stringfields__ast_pthread_mutex_initast_rtp_instance_get_bridgedast_rtp_instance_get_timeoutast_rtp_instance_get_hold_timeoutpthread_oncepthread_getspecificsched_yieldast_set_hangupsourceast_party_redirecting_initast_channel_queue_redirecting_updateast_party_redirecting_freeast_rtp_instance_destroyast_sched_dumpast_channel_unregisterast_custom_function_unregisterast_unregister_application__ast_data_unregisterast_cli_unregister_multipleast_udptl_proto_unregisterast_rtp_glue_unregisterast_manager_unregisterpthread_joinast_softhangupsched_context_destroyast_context_destroyast_unload_realtimeast_cc_monitor_unregisterast_cc_agent_unregisterpthread_cancelast_tcptls_server_stopast_xml_find_elementast_xml_get_textast_xml_free_textast_cc_agent_caller_availableast_rtp_instance_writeast_rtp_red_bufferast_udptl_writeast_park_callast_hangupast_rtp_instance_get_qualityast_rtp_instance_set_stats_varsast_queue_hangupast_cdr_setuserfieldast_rdlock_call_featuresast_find_call_featureast_unlock_call_featuresast_moh_startast_rtp_instance_change_sourceast_aoc_decodeast_aoc_get_termination_requestast_aoc_destroy_decodedast_udptl_set_local_max_ifp__ast_cc_config_params_initast_udptl_setqosast_db_getast_sched_whenast_db_putast_event_get_ie_uintast_event_get_cachedast_event_destroyast_app_inboxcountast_cc_is_config_paramast_cc_set_param__asprintf_chkast_get_time_tast_get_cc_agent_policyast_set_cc_agent_policyast_dnsmgr_refreshast_dnsmgr_lookupast_append_haast_callerid_splitast_get_ipast_parse_caller_presentationast_cdr_amaflags2intast_get_groupast_parse_allow_disallow__ao2_callback_dataast_load_realtimeast_config_destroyast_load_realtime_multientryast_get_srvastman_send_errorast_callerid_mergeast_channel_set_redirectingast_pbx_startast_rtp_instance_set_alt_remote_addressast_pickup_callast_setup_cc_recall_datastoreast_cc_agent_set_interfaces_chanvarast_config_AST_SYSTEM_NAMEast_config_load2ast_get_versionast_variable_browseast_jb_read_confast_tls_read_confast_find_ouripast_set_qosast_tcptls_server_startast_ssl_setupsocketast_enable_packet_fragmentationast_bindgethostnamechannelreloadreason2txtast_parse_argast_context_find_or_createast_str2cosast_str2tosast_io_changepthread_testcancelast_sched_waitast_io_waitast_sched_runqast_io_removeast_io_add__ao2_container_allocsched_context_createio_context_createast_channel_register__ast_data_register_multipleast_cli_register_multipleast_udptl_proto_registerast_rtp_glue_register2ast_register_application2__ast_custom_function_registerast_manager_register2ast_cc_agent_registerast_cc_monitor_registerast_realtime_require_fieldio_context_destroyast_cc_agent_accept_requestast_extension_state_addast_extension_stateast_event_newast_event_queue_and_cacheast_cc_monitor_request_ackedast_cc_monitor_callee_availableast_get_ccnr_available_timerast_cc_available_timer_expireast_get_ccbs_available_timerast_unescape_semicolonastman_get_variablesastman_send_ackast_update_use_countast_shutting_downast_parking_ext_validast_pthread_create_detached_stackast_tcptls_client_startpollast_tcptls_server_writefcloseast_wait_for_inputfgetsfcntl__fread_chkast_recvfromast_module_registerast_module_unregisterast_rtp_instance_bridgeast_rtp_instance_early_bridgeast_tcptls_server_rootast_sockaddr_split_hostportmemsetstrcasecmp_l__rawmemchrnewlocalefreelocaleres_srtp_policyres_srtpast_base64encodeast_base64decodememcmpast_rtp_instance_add_srtp_policylibpthread.so.0libc.so.6__stack_chk_failGLIBC_2.0GLIBC_2.7GLIBC_2.8GLIBC_2.1.3GLIBC_2.1.1GLIBC_2.3GLIBC_2.4GLIBC_2.1GLIBC_2.3.4   {% ii % %ii %ii %si %qi %ii %ii %ii %ti %ii %` d h l p t x |                                $ ( , 0 4 8 < @ D H L P T X \ d l t           ( 8 H X h x                  $ , 4 < d l t                         D L T \ d              $ 0 < H T ` l x                  $ 4 < @ D L T X ` h l t x                             ( , 4 8 @ D L P X \ d h p t |                            $ ( 0 4 < @ H d l t |               , 8 D P \ h t                       $ ( 0 @          H L d h l x |      ( @ h      h    8 X    ( p    @ `    0 x    H h    8     P p    @        @ H L P T X d h p t x                        %  > Z        {    L P T X \ ` d h l  p  t  x  |                    ! " # $ & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8$ 9( :, ;0 <4 =8 >< ?@ @D AH BL CP DT EX F\ G` Hd Ih Jl Kp Lt Mx N| O P Q R S T U V W X Y [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y$ z( {, |0 }4 ~8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L  P  T  X  \  ` d h l p t x |             ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ?$ @( A, B0 C4 D8 E< F@ GD HH IL JP KT LX M\ N` Od Ph Ql Rp St Tx U| V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z | } ~  $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |         S[ t5 $[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhh h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\hWVSÆt  |$$u Fu[^_WVSjCt  |$$u Fu[^_UWVSE֋G t8f[Df[T$$u gu>E1$эD D$uMYUĉD$sD$.TD$ tT$D$eD$D$$@t >MԍBU$L$eE̋U8u Mȉ MȋPEЉEԃ}UD$,$Et_@EVE̋8}1f[эQ}1эD B Ut$$UDUD$@$k)(Me3 t }e[^_]UWVS?q ,x@D$D$<$ug] t$<$fF@vDʼnD$y:D$YD$ y D$t$D$ $/1FYD$y D$D$ <$D$$p,[^_]ÐSQ*p y $[Í&'S!o  $#[ÐSo 4i$#[ÐSÚo 'k$[ÐSjo ym$[ÐSa:o q$[ÐS1 o s$c[ÐSn  :D$y $[Ít&Sên  $S[ÐSzn  iD$4i$[ÐSqJn kD$'k$i[ÐSAn emD$ym$9[ÐSm qD$q$ [ÐSúm qD$s$[ÐUVSÆm u]xt$\d`)9s `9rƃ[^]US.m htt h$Ѓ[]Ë$ÐVL$Qt%vƃ1u1)^Í&1Í'D$@Ð&D$T$H19J@É'D$T$9P @Ít&'D$T$9P$@Ít&'D$#l Pf[tB D$1fVD$H<8 u (,^Ð&D$T$H19J@É'D$Ít&'D$@TÐ&D$@XÐ&D$@\Ð&D$@`Ð&D$@dÐ&D$@hÐ&D$@lÐ&D$@pÐ&D$@tÐ&D$@xÐ&D$@|Ð&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Í&'D$Í&'D$ÐD$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$Ðt&D$`Ðt&D$dÐt&D$hÐt&D$Ðt&D$ Ðt&\$h D$@$t$D$;DƉ$t\$t$Í&',\$ah l$(t$ ։|$$H,$1҅t 4$19|<> |$t$,$\$t$ |$$l$(,Ít&UWVS, g D$D$@$,D$D$0D$D$t&f[f[uEE9s}D$$$0D$W $T$D$D$@D$`T$uD$|8 =uD$Jwt&Jvt,[^_]ËD$0,f[[^_]ÐUWVSmDžgD$<'2$D$,f$<e3uL[^_]ÍvD$(mj'UWVSu^ \EeE1Eԍ t48t/ED$:D$4$Ku1 Eԍ D$ƍ D$4$ D$D$4$1 D$4$, 1"<$P)čD$'T$Eȉ|$$UB--U1EJ:$1EEUč UEԋUċ$| UȉEЋ !%tDJD+Uȉ<$T$UȉT$uEEU<$T$EE̅Et EċUЀ| uE̅t}u EEpuEԃ9pu1MU̅+pp Eԉ@@BUe3e[^_]Í D$SfD$ y D$t$D$$B1먍1랍t&E̅UԸ+BBuv<$P)čD$'T$Eȉ|$$UB-- !%tDJDB& D$4$^‰z +ft&SD$ óZ $o[Ív'V1St$ ÀZ tUB$5@$$@ $@$@$$$[^ SD$ Y @$[Í'UWVS÷Y <CL$D+$ A< vt&< wt f<vT$4$ tml8'`tN $)v;tD$&UD$ y t$D$+D$$l[^_]Í&D$DFL$D$H )‹D$HT$X|$TD T$LD$Pt.D$H| ED$TD$TT$XXt&tl9k`uDt&D$PtT$HL$L| uD$DH ;|$\G 뉍 $vt&T$P$L$DD$Q eF |$D$qҋT$PID$( D$UD$ y T$ D$$v9T$Dz 2L$D1D$TD$\͉A $14$ID$DT$D+$FBl[^_]É1Ɂ$x 1D$\rl | tl8`uD$DH D$Dx @$@$fD$Tl8`~Q T$<$ T$<c,$T$4$mH)čT$'L$$Uԉt$xUD$ $D$ $ƃD$ 4$wE؉D$)D$4$.LHU؋E܅x 9{}ut&HLUe3e[^_]Ðt&,uD$hfD$ D$"y 1D$$dfU؋E9rtl8,`1i $"RG1D$#$D$HvD$hfD$ y D$οuD$hfD$ D$"+& D$hfD$ D$"&XuD$hfD$ D$"&uD$hfD$ D$"LGHD$"$D$uD$hfD$ y D$)St&',\$$K$G t$(Ƌl88`u\$$t$(,Ív $v׋FD$ $D$vD$#gD$ y D$<뜍v'LD$Tl$Hl$P\$C D$ T$$T$$W[Ív'SD$ T$$B $T$[Ít&,\$$äB ҉t$(uu @t8u6ZD$D$ FD$F D$$\$$t$(,Í' tl\taxS v$\x#D$E$tuҋl8/LJ\1ҋ\$,t$0|$4l$8<Ë\D$ $D$|wD$\D$ y D$\듍v'UWVS,|$@à= G(xP $4G(x#D$E$tuՋl8G(,[^_]ÍvG(D$$D$|wD$OeD$ y D$蟴볍'SD$ < @D$D$$$[Ív'UWVSD$ D$D$xD$ XD$y $j\$,t$0|$4l$8<Í`y $cf`I $迲3fUWVS$6 $e$1҅ud$l$V'UWVS\UԋU衯z eE1UЋU jUȋUЋ:D$<$詚teD$<$蓚1҅u,UԁJUЋB$%fЋUe3e[^_]Í&EЋP$U/UčH)č|$/T$L$<$:UԉuԉJvUtjD$,4$蘘t4$tuHỦ4$T$豙t5zD$4$蛙u7EԁHvufUԉB% BِD$4$ND$ D$4$̜uUȍ: D$4$T$,vUЍYD$BD$BD$c$D$h{D$YD$ y D$"Uȉt&UԉB% BN%v'W1VS t1ƍ&F D$FD$$ȓtxNjvu؃[^_ SÚ X&t$?X&[Ít&\\$P苬d t$T|$XǍ4$覒Eօu7t u6|$$輏|$$誏\$Pt$T|$X\fL$<L$4L$,A f[L$(D$@D$8D$0L$$cD$ D$D$L$D$ D$DL$|$D$$\]&UWVS\|$xg@ t$|$D$L?[D$ D$D$pT$(T$y T$$T$D$ H$(T$p;tt ;D$@D$D$ D$D$,<$膏D$T$(D$ D$ 0HT$T$$D$D$pT$$\[^_]Ðt&u$&tPuT$(D$ D$ 5HT$T$$D$D$pT$$肊\1[^_]D$Hv{D$[D$ y D$D$H$ƍ\[^_]Í{T$$D$D$ D$H$T$D$ 苍D$(D$ HD$T$ D$$T$T$pD$$ωD$(D$ (HD$ȃt&'UWVSL裨| D$<`ht&8D‰D$$FD$D$ ueE1UU󫍃EEE%E2EBEREdEsEPEE)EEčEȍE̍} EЍEԍ@E E}  D$@ @@Ee[D$U$mED$t$$EU D$:D$$11Ue3u"e[^_]ÍvUB\~BDlUWVS蜟u |e$l1T$0 ٧ D$$ȧt8uWD$}[D$ D$Yy D$$蝃1$le3|[^_]Ít&ƍuD$$t D$$8uHD$}[D$ D$Y녍D$LD$z D$D$$$aD$L=t$P$蒪D$L4$D$D$4]D$4$DŽ$Purn:DŽ$TietfDŽ$X:parDŽ$\ams:DŽ$`xml:DŽ$dns:pDŽ$hidf/$% D$,$T{f$D$4D$l$$u$ 8 $PD$4$y,$֓T$8paT$1T$, t&?Չ4$蚋T$,D$ T$$ru\D$0t#l` }4$bzpT$aUT$y UT$D$ m<$ΉdUv2JUEƉt$D$ T$D$D$$nUȉT$<$|uU$n}P)ĉT$Ut$+t$$艀EƉt$D$<$vUD$ m<$T$UT$UT$s1Ue3e[^_]ÐU D$D$m$T$ UT$vf܂D$>aD$ y D$mD$$v~l,`9 $z#vUƉT$UwD$D$m$T$UT$ UT$Nv t&SD$ 躑Ó@$[Ív',D$0t$(\$$胑\Ɓt Pu2D$gaD$ y D$PoD$$u4$\$$t$(,1)ÍvWVSt$ t7T$ 薈T$ 8f3u1)Ѓ[^_ÐWVSD$ 訐Ápt $vDž L$$wb190HpaǸ D t$|$$|D$ n|@|$ $|D$ t$Qn|D$F $gt$F $g_4$w|H4${|5t$|$$pƋ t$|$$p*Jv'l\$\{Tt$`Ƌtl$h|$d׉D$,1D8r9|$,lt8퍃tEdD$PD$bD$ y T$D$D$$Tnt0'u|$,t+|$,hD$8u \$\t$`|$dl$hlÍt&D$8D$8D$ D$D$,$@y뾍`q $qZtvD$8D$<D$@D$DD$HD$L,$6fD$8D$@F|D$D$,$pD$8D$<D$@D$DD$HD$L,$eD$8D$@{t&D$8vUWVS, uEeE1D$'@@@ EUЉ$qUЅT$ DhD$Et$D$$el8~pED$AR$ D$D$dD$ y D$kE|$ D$Eԉ$c{1Ue3une[^_]Ðt&`t $oj뤍xD$dD$ y D$D$;R$>krfUWVS謆Å,l$@$D$pU~V1)I1 t&9}~e$$D$t$ T$T$$p~T$$tpƃ|3tD$DtD$$RpT$f 9},1[^_]Ð1넍t&\$LþD$(e$<1$Xl$8$P$TD$D$(T$,l$$w %D$D$(l$$wt~8D$D$(l$$wt_^D$D$(l$$wl8`D$8T$,fl8`D$8= =.=@8=%T$,ǂ*vl8`$<e3$L$P$T$X\=` =몍v $zlD$8D$#$D$KD$fD$ y D$'hD$8= T$,ǂ/ $lD$8D$#$D$D$fD$ y D$gt&D$D$(l$$fu%D$D$(l$$Cut$(t$(qt$(h~D$D$(l$$tl8`T$,vT$,ǂT$,ǂT$,ǂT$,ǂT$,\L$89l3`|$8`D$8T$,D$,$a $i8D$8D$ $$D$qD$fD$ y D$evlZ $mi_D$8D$$$D$D$fD$ y D$e  $iT$,tH\L$8D$ЃD$fD$ y L$D$$D$$dT$,\D$D$(l$$prl 8`T$,D$D$(|$<|$$rl8%`D$<$jD$<$jT$,ǂ(D$D$(l$$ql28`T$,1D$D$(|$$%qkl8`g&D$<$i7D$<$iD$T$,,$v $fFD$fD$ y D$ $D$$yb8`|$8wT$,g $:fQD$fD$ y D$6$D$$a8`o|$8T$, $e!WD$fD$ y D$+$D$$ea8e`;|$8cT$,ST$,ǂ; $eD$fD$ y |$D$;$D$$` $dFD$8D$$$D$D$fD$ y D$d` $adzD$8D$1$$D$D$fD$ y D$`; $ dD$8D$&$$D$BD$fD$ y D$_o $cD$fD$ y |$D$B$D$$f_GD$vD$i&L\$B u t B \$t$ Ë\$t$B Ív< < 믍'S(Hru*T$ (:T$D$$7T1([Í(D$ XD$ y D$D$$$W&W1VS{rTtC8t>w,v1ɺt@ƒ҉u[^_ÐUWVSrt{D$,$[tMtPvw <vD$ D$4$D$\$ t$$|$(,Í $JTt8D$JYD$ y D$ D$$Osvu1tl8)`b $SL 1D$JYD$ y D$ D$$rOt&t>l~b܄D$JYD$ y D$ D$$ OD$ 4$|$ D$Xv`t $Ry멉'\$;j9t$t'@@ tD$$IF \$t$Ð\$it$D$$H\$t$Ív'SiÊD$$H1[Ív'UWVS>t9tD$,$>\$t$ |$$l$(,Ív'\$D$$W_0t$t$ D$4$v;1҅uD$(tt3Ћ\$t$Ðt&(\$t$Ív(\$t$ڃÍ,\$ ^Ô=t$$։|$(|$0tq=tJD$D$ XD$y $D$~24S\$ |$(t$$,ft$$\$ |$(,Ít$$\$ |$(,Ð&<\$,]t$0t$D|$4|$@l$8$T$l$.G1ɋT$u!ȹtȋ\$,t$0|$4l$8<Ðt&tˍYay $|$ D$ot$H|$ D$ot$,$fD$H1f9D$ Ir'UWVS\e L$L1l$$\ûu "t&tnuDD$ED$D$$}MT$Le3u\[^_]3v<\$4k\Dt$8ƍD$,$L?3'\1\$LZÂt$P|$Tl$X `3[y D$t%T$L$ l$D$o<$9Ct1\$T념D$(y 1D$\D$sD$.TD$ tD$dD$D$$9&'UWVS,l$HTt$L|$Ptn}th1҉$ȕtDEt#u tEu1,[^_]Í,1[^_]ÍvpD$[D$ y D$D$CH$8,[^_]ÐS!T(l~ED$\D$ y D$6D$$S8t2([Ðt&`tލ $3&L\$<It$@Ɖ|$D|$Pl$HՋt 4tx@dD$ D$ T$(D$$DD$ D$cD$y D$ksD$D$$)E D$ t8ksD$D$4$ ~|$Ttm|$Ttv(fD$D$4$}\$<$$¸UUt1@utruuɋuEUUEX@U}UuEPtWD$,<$C&tU<$T$h't‹U<$T$U'uU %른FUBD$BD$:d$D$D$YD$ y D$1 SE E0E8EE8EOHyU8D$$R&F$/E0FUD$d$D$D$YD$ y D$T$E8EV F$E?UED$$%uTvRD$4$g%O4$/EtdHJ :UYD$$%ugFO$.Et=H`EOH`UeD$$$u*FO $-.EtTH wUrD$$P$uLFO$-Et"H4`#`UD$$#u*FO$-EttHUD$$#VO$U;-U$Ue Ut%E`l`[1эA)č|$+T$L$<$OUuD$,<$!tU<$T$"ueEH뻋EHUD$$"u]FO$?,Et3HD$<$e"uhEH냁`VUD$$/"15FO $+EuV` UB|$D$qd$D$D$YD$ y D$H vUWVS\65LD$(e$<1lD$YD$ y t$D$dD$$p|$<u !t&tzuDT$<D$@$'D$ t D$ |$<uc$`D$d$D$D$YD$ y D$$<e3D$(L[^_]ÍvD$ tD$ 8tL$uӃ[^_]ÍvEЍ&UWVS,1üDDž(% ЋHcAL% ЋL Љ !%tDJDE`) H9T$|$$w|$ !%tDJDEd+T$H9T$|$$ |$ !%tDJD+T$pH9T$|$$ !|$ !%tDJD+T$H9 T$|$$0!|$ !%tDJD+T$8H9dT$|$$!|$ !%tDJD+T$H9T$|$$XdhDžPDž "    Ј"" ht Dž#|$ !%tDJD+T$1H9T$|$$= ETD$EP$ ETE\D$EP$ E\EXD$EP$ EXD$EP$ D$EP$ D$EP$ E|D$EP$y E|ExD$EP$b ExEtD$EP$K  Dž`#DžDžEt Džd󥋃  p t  , Ј ,[^_]ÐDžDž\&D$D$ D$MPT$L$T$L$$}T$L$fE`uPT$ $T$L$D$ t$8T$L$E`9D$D$ D$MPT$L$T$L$$ T$L$ fD$D$ D$MPT$L$T$L$$ T$L$UNfD$D$ D$MPT$L$T$L$$M T$L$fD$D$ D$MPT$L$T$L$$ T$L$fD$EdD$ D$MPT$L$T$L$$ T$L$(Ed D$T$T$L$$T$T$t$T$ $T$E`XifD$T$T$L$$pT$D$T$T$L$$@T$!D$T$T$L$$T$D$T$T$L$$T$D$T$T$L$$T$Edt&D$EP$tt&D$EP$|t&D$EP$t&D$EP$iE`D$EP$IEdG&D$EP$)t&D$EP$ S'j(D$D$ $ D$?D$X&([ÍS>'t%=t1=tB=t [ÍD$$[ÍvD$$ˍD$$볍UWVS&×D$P$D$T$-D$PD$HD$LD$xD$TD$|D$X$D$\$D$`$D$d$D$x$ :[D$DD$\D$@D$y D$ dnD$D$8\xI1D$E$/ $ \yǐt& pD$D$LD$|$ D$E$\D$DD$ on<$D$D$@D$D$T$<$$$ts܌T$(:l$LT$,Px T$PD$D$ D$T$T$(D$,$T$T$,l$T$$+uT$8D$>T$T$4T$ T$0T$T$<$ rD$$D$t$ D$$1'&UWVS$$J#$D$$e$1tt1D$$P8$e3[^_]ÐQ\QD̍t&D$8BT$T$+D$D$T$hu\|L%̀|t&|L%|qvD$(D$ mD$vD$TD$ml$$D$lD$D$$D$ |t&'UW1VSLD$e$<1D$] 6x}tuDfl$<u "t&tiuDED$<"f[t$,$1WP1;=xf[@xT$$T$(t`T$,t&D$;<$tD$l$<$|$(t >T$(D$$T$$$D$!tT$$D$$ D$T$ T$,$_.T$ $Kx{E9T$ |$,$T$OT$$T$xP9YT$|$$T$ D$0T$$D$ T$T$ T$`T$st&l$=1D$",$D$<%Kp@l$P+vPvl$T$T$T$$D$190T$,<$D$T$uE|$$|$$t&4$!#T$ $=l$T$D$|$ $T$D$ l$T$T$Zl$T$D$|$ $T$D$ l$T$D$D$B $T$KT$l$B $T${$|$l$jT$l$|$$CŋD$퉨+~t&Srt t [Í&$@uP t$0[Ív$pʍ&',\$$trt$(#t{\$$t$(,Í&D$fD$ y D$D$n$봍&L\$<ql$Hl$Tt$@D$|$D1,$D$T$,D$PBl8$`1tN $v;1D$fD$ y l$D$nD$$v\$uT$8L$0l$<$T$D$ L$a\[^_]Í& ju>uFVD$4T$FvD$4t$t4t&D$;4$tat'ƅuѸMe3 e[^_]Ít&EЋMЅt9MD$; $tuЍtWEЋMЅuǍ}ЉNj$D$EЉ$tFuދMȸWvUD$=$5t똍&Uȉ2Uԉ$`Ku̹u %t&twuɉ}D1n' $Îb$e$1p$$Չ$u<$e3M$$$$ Ðt&$D$4t$LD$PT$$tStNv$$LD$T$D$ D$$;&D$LD$,D$H$T$Lu$T$0T$D$P$0D$$(T$8EPaD$y T$<$D$:D$ D$l$…ҍD$L!ʁ t€DэHD҃+D$,xEP92T$L|$T$$|$8T$8$xE P9AT$8|$$T$$!%tDWDE+|$0/P9$|$T$$ID$4Ehl$$> $D$Hl$D$ D$D$$D$,$T$$,e3<[^_]<:mxE@u 벐t&tjuD뎍D$>cD$ y D$l$D$'$ZLgUWVSMpU utE^7[|UXe M1Ƀt\h`dTDžl&p}D$D$D$ T$D$D$P<$/tUEEvD$&<$tE<$EuƋM9MtF}thb}Ee3 e[^_]ËtL⍴&}</`dDžlu|D$D$4$8hXD$T$ D$4$D$ \D$ttspT$ |D$D$ $T |D$D$t$ $t| D$D$$bt&}}\ԓ|D$D$T$ $|D$D$4$d-LL$ 4$D$D$4$D$D$`|D$D$t$ $p|D$D$t$ $Vh|D$D$t$ $,LblD‹|D$ D$D$$|D$D$ $ t&|ĒD$D$ $\4|D$D$t$ $npZ|D$D$T$ $Dh`|D$D$t$ $lt@l^|D$ jD$D$4$G1|D$ jD$D$ $@|D$ D$D$4$|D$D$4$bt&|D$D$4$8`D$D$4$T$ pD$D$4$T$ hD$D$4$L$ &c@8`dTDžl5t&c@`ɍ8dTDžl&"8`dTDžlt&"8`dTDžl}t&\/`dTDžlEt&4뎍TDžlt&h4$2P)ĉT$hD$/Ɖ$T$8pX`D$ D$$L$p]y UT$xt$D$ .lL$$u:$LSLƋXHPL $P.PLp$)čut$/D$EL$T$D$ D$D$4$*9 $PPEE)ċET$/$LL$D$xD$ .<$L$ML$lL$D$<$LUXXD$AxD$A|LD$D$p $D$ D$LhTt$t$|T$ L$L$D$D$4$pܖT$ |D$ jD$D$ ${Oh|D$D$L$ 4$F|4D$D$4$!:Ef[>1f[XA|LD$D$p $D$ D$L\UWVSt$07Ptn:T$$ltZPt+ftiuDED$;4$t[^_]1v',$$$4gO$(e$1$0T$ D$D$D$$4$D$/D$$e3u$$$(,ZUWVS1e $1ɍ$pT$P$ëNDŽ$lT$X?F4wl$lL$TftiuDE"D$ PD$D$PD$D$$l$轼n$uvPl$<$>url:`oPl$LPPt# 1`T$L8L$L9+L$LYF$l$l$lT$\L$T$D$D$ D$D$,$轻D$PL$TD$ D$HL$D$D$PLD$$l$rt $ll$D$P$,t&$l$lL$<$F0t 8F(T$\|$$lD$ D$D$PT$D$D$D$<$ͺ|$$l<$蚻F,t:8t5D$$lbD$D$ D$D$$yF0t 8YF($lT$TL$(L$L|$$D$ F$T$T$XL$D$ D$D$D$D$$L$L4$D$F$L$ D$@D$D$)1$e3[^_]Í$lT$P tjuDE2fID$$F($l|$($lL$ T$D$D$PD$ D$D$D$ND$<$I$lT$TL$,L$L|$$D$0$lD$(F(T$T$XL$D$ D$ F$D$D$$D$|$HT$HT$0ՅtAt$4<$T$4|$$D$0 +D$0|Huɋt$4t*D$,4$D$xtpt$xhD$8$|x(T$<$+D$8 k|$F<$TD$8h$v,$xbF8P9|$l$$D$8h(,$xF<P9|$l$$覷D$8h4,$_xFHP9|$l$$dD$8h,J,$x6F@P9|$l$$"D$8h0,$xFDP9|$l$$dž8L$<$D$8 $OƋ$|e3Č[^_]Ít&t$4-։t$x>"tgD$D$x$4$/Ux@9w>|$t$$4Et$xt$x[느L$8D$8T$ T$( L$L$,D$4|$$8T$(L$,tL$L$4|$ $hT$(dqt&UL$8D$A T$($tT$(=D$8ǀ V0NlFDT$ $T$(L$,D$ |$虸T$(L$,aFD1V0NlF@T$ $T$(L$,D$ |$\T$(L$,F@V0NlFHT$ $T$(L$,D$ |$T$(L$,FH3V0NlFl$L$|$4$(D$|t3$D$D$ D$t$$ïL$\D$pT$H4L$\T$D$ R>l$|$4$YT$l$|$4$آ1Xt&L$HD$ L>L$΍$$L$\D$D$ D$pL$$kD$\y L$`_L$d:[L$xyD$HDŽ$DŽ$DŽ$DŽ$$vT$`D$dL$@D$}>T$T$lD$ $萬L$@D$TPD$Xo-}ҋ$DT$PD DЋD$XD$lT$DL$@D$$gT$DL$@L$0L$Tl$ 4D$$|$,L$(L$PT$l$D$ L$$L$LD$D$$L$袛D$h6l$t#T$L҉DT$PDT$TDT$XDՃ PE艔$1ҍtQL$dT$lD$>L$ L$`$L$ЋPyL$lT$DD$ $T$DL$LD$$ D$lD$D$hL$0L$P|$,l$T$L$(L$Tt$ $L$$L$XL$ $L$躨L$xD$ >L$L$d4$L$L$`L$蒟TL$\D$H9L$HL$HD$pDŽ$ DŽ$ DŽ$ 4L$xDŽ$ DŽ$ D$ ^>L$L$d4$L$L$`L$Nl$|Fh8|$h$D$ et$D$D$ D$D$L$L $Ed$ `D$<$F<z$PL$lT$tf[toEʅ,D$XD$TT&$L$LͿu vtiuDE-fft&E‰D$Lt&PL$dD$q>T$l$L$ L$`L$f7$Pt&$D$D$ D$t$$ML$xD$ `>L$VP$T$lv1T$l$m&D$tf[T$PtoD‰D$PPL$dT$lD$>L$ L$`$L$P$D$Xo-$D}L$TD Dȋ$D$lT$DL$@D$$T$DL$@D$lD$PL$L$L|$ T$D$$D$XL$l$D$D$TD$D$lD$ $$DŽ$DŽ$DŽ$DŽ$D$hMD$|ud$t L$\$ D$p1$PIt&D$l(DŽ$D$X$$닍sy D$.TL$_D$ tD$&>L$D$D$$!1T$tfҍf[D‰D$$,D$ \D$_D$D$D$,D$ D$D$$$tj$@D$$L$$$L$$L$$L$ L$\L$"af{1t&'1T$$\$L$(衸z%t$t$ t+t2A1҉D$ AD$$D$L\$t$ÍV\\$VDt$f\$L%$$P$de$<1$T|$@$X$`4$D$?D$<D$8$ D$,D$0ypD$41|$ t&tzuDD$D$D$ D$$ $_D$$ɀUe3uCe[^_]ËGD$x+$D$ȞD$TD$ y D$%t&\t$TƉ|$X~P\$PeD$L1Bta?t\!D$+|$D$hD$ FD$F D$4$PD$Le3u-\$Pt$T|$X\ÍvD$$認qUWVSLUe M1ɍ1臠` !󫍽`!󫍽`|$$}T$$|$$$Me3 *e[^_]f$D$،$)̍L$/@ $T$D$<$D$芌$̉ǃ)|$/@D$T$<$~l80`* $ 8D$l_D$ y L$|$T$D$lD$$]vLD$Pt$@\$<ÞÜ p|$Dl$HD$,y g_|$D$ ml$D$(D$4$虔 D$$[} D$T~u>|$D$ $mD$(l$4$D$D$,\$|$D$ mD$(l$4$D$}D$,\$D$ |$T$$D$D$ D$D$D$+%D$ $Jq<:-:D$D$T$ <$ss8 t*@t#8tD$ %D$D$<$v  $bxP9v|$L$$^t~`t ?}t8 @ D$D$ D$D$D$%D$<$ pU$ET\\D$@D$T$D$ D$D$$o$%腜H$% $I9<$5$}xF@#P9|$$T$ro$՛F%$辛% $褛t$%聛Me3 Se[^_]ÐD$ |$D$ D$D$D$ $D$F%D$nft 8}D$D$<$sF|t18t,D$ ^%D$D$<$usF\:T$D$D$ <$NsPsT$D$<$L$ s5${HG9dT$<$L$pT$<$D$ D$nT$D$ D$$nx;WD$ y D$D$,$V|s|`}$ %fq8h҉z&rD$@<$8z0Fxf[t 8:EщD$r%T$|$D$D$ D$D$<$kkYV F@T$ $D$ |$trF@ D$ V T$|$$r0$TD$${&$t&G$|$T$ $tF@!2T$|$$tjuv~x?fvT$D$ $||$L$f[ҋE‰D$%t&D$ :D$D$<$,oD&D$ D$D$D$C@D$<$iD$F $iF@D$F $i*FXD$ ~ L$|$$o~XHt&F FTD$ L$D$$LoFTf;WD$ y D$TD$,$wD$<$D$ hD$}m7fFxf[t 8:EщD$ T$F\|$D$ D$D$b%D$D$<$4g"|$F $g׉FX!D$F $gFTD$ D$L$$hL$|$$qljFXiL$D$$pFT#I'UWVS~WD$P$D$T$g:[D$PT$8D$xD$TD$|D$X$D$\$D$`$D$d$t&D$x$pT$8D$ p<$T$`T$e D$40D$$ eE@DljD$R0D$$dD&t DljD$p0D$$d D$0D$$d !D$0D$$wd!D$0D$$Yd#D$0D$$;d1D$$d1M%%h9%%%tD$$c`D$1*D$$c1D$$_c>+D$$KcEljD$1D$$cEljD$=1D$$bHEljD$[1D$$bEljD$y1D$$bEljD$1D$$wbD1D$|$$Pb&H]D‰D$ D$ȢD$$b蘆A<$kX'D$$aПD$$a1$$\o5V$e$1$Du9$e3$$$$ļfl$D$ |$,$D$pVD$ l$$D$$N u%(, t|D$ l$D$$}N  $T$}Y D$ $%e D$D$$`tvD$ l$D$$M  $T$X D$ $d D$D$$` D$ $X D$ $Vd D$D$$_1|D$D$ $_D$%D$ $j_1D$ D$ D$ $.U'1_U1UWVS\EԉUЋUeE1Ul.L2UЋ9!ʅҍ%MDf%th9tM%DЋuЍD$4YD$ y T$L$t$D$D$$Pd t&%th9tM%DЉT$UЍ4D$4YD$ y D$T$D$$O&UЋEԁ¼LuЁt UЋPu#}Ќ MЋ UЋd  UЋP EԹ!TEȉ}Թ!uȁtMԋUЋuԋ|% ЋUЉ|%cAL ЉMЋ ʋMԉUЋ(։,M̩}̹ [ uԋ,uЋuԉ\SBUЋY 4$SMԁMčxE UԋP9] |$t$$HE uԋ 1|$D$‰T$[D$%D$ $[UЋD$ $$TUЋD$ $_Eԋ 4$XỦt$T$$`MЋu ЈUԋ t3MЋ$T$SUЋMԋD$ $@_uԋ t0MЋ$T$^SUЋD$ $_UЉ$RpRUԋP9 UЉt$$T$GUЋrh4$QxUԋP9M |$t$$FUЋrh4$wQxkUԋB|P9 |$t$$yFUЋrT 4$3QxUԋP9R |$t$$2FUЋrXd4$PxPUԋP9 |$t$$EUЋ4$PxUԋBlP9, |$t$$EUЋ4$[PxUԋBhP9 |$t$$]EUЋrp4$PMԃ\M̍xUԋB\P9 |$t$$EUЋ4$Ox{UԋP9n |$t$$DUЋrl4$OxlUԋB P9|$t$$DUЋr`t4$DUЋe4$NxQUԋP9|$t$$CUЋ[4$NxGUԋP9"|$t$$CUЋQ4$aNx=UԋP9|$t$$`CUЋG4$Nx3UԋP9|$t$$CUЋt>>t94$MxUԋP9{|$t$$BUЋ*4$MxUԋP9|$t$$BUЋE‹EpuЋMԋhlpt|HLlX,\ 0D$p$IUԋB\t8uSuD$4$/O$mLpUԋB\P9 t$|$$oAUЋr|tL>tG4$(LxJUԋBPP9r|$t$$*AEԋA UЋrxt;>t64$KxvUԋBTP9<|$t$$@UЋt;>t64$KxUԋBdP9|$t$$@UЋdS`EMԋU9| M|  AMԋUԉ|%J=?EԃHUЋ$BMԋUЉpt |MPuuЃT ЈPUЋUЋMԉ, $1҅txMe3 e[^_]Í&`x9|̅Gt&MԋuЁTMȋ}ȁt!Ct&UЋMԋUЉ uԋUԋ|%EԃHUԋ,$7=UЋEԋǀ,Uԁ¸UċuԋD$F $e;fUԋMԋEĉ|$ T$ $UMD$ AUMUԋ[UԋMԋEԉ|$ T$ $UMD$ GAUMaMԋvUԋMԋEĉ|$ T$ $UMD$ @UMUԋUԋMԋEԉ|$ T$ $UMD$ @UMyMԋfv}ԋUԋEԉt$ 耉$UD$ |$d@U MԋvUԋMԋEԉ|$ T$ $UMD$ @UMMԋ+vUԋMԋEԉ|$ T$ $UMD$ ?UM1MԋvUԋMԋEԉ|$ T$ $UMD$ w?UMMԋvUԋMԋEԉ|$ DT$ $UMD$ )?UM MԋADbUԋMԋEԉ|$ T$ $UMD$ >UMMԋA UԋMԋEԉ|$ T$ $UMD$ >UM)MԋEvUԋMԋẺ|$ T$ $UMD$ L>UMUԋB\vUԋMԋEԉ|$ hT$ $UMD$ >UMCMԋAhUԋMԋEԉ|$ lT$ $UMD$ =UM3MԋAlUԋMԋEԉ|$ T$ $UMD$ o=UMMԋvUԋMԋEԉ|$ T$ $UMD$ =UM9MԋavUԋMԋEԉ|$ |T$ $UMD$ UԅBht& $|$T$>MԅA\t&T$|$ $>Uԅ fT$|$ $x>UԅB (3t&T$|$ $P>UԅBDDOt&UԋMԋẺt$ T$ $UMD$ :UMUԋB\vT$|$ $=Uԅ$/fT$|$ $=UԅBlFQt&$t$|$=UԅfT$|$ $h=Uԅf $|$T$@=MԅfT$|$ $=Uԅ1P)čt$/T$|$4$3D$@4$+>zEԉD$$2UЋB|t$D$hD$ EԃD$Eԃ D$E$/CEԉD$$:K t&MԋAlD$A $/uԋUЋFlYt&MԋAhD$A $/uԋFhcMԋD$A $/uԋfMԋD$A $h/uԋfMԋD$A $8/uԋfMԋA|D$A $ /uԋF|MԋD$A $.uԋMԋD$A $.uԋt&UԋMԋEԉ|$ TT$ $UMD$ 4UMMԋAT|UԋMԋEԉ|$ T$ $UMD$ 4UMqMԋ8vUԋMԋEԉ|$ dT$ $UMD$ A4UMMԋAd,UԋMԋEԉ|$ PT$ $UMD$ 3UMMԋAPFMԋATD$A $[-uԋFTMԋD$A $0-uԋ_MԋAdD$A $-uԋFdvMԋAPD$A $,uԋFPfUԋB\D$B $,MԋA\A $t$T$P6MԅA\t&%% h9%%%` $?8UЋMԋLT$|$ $5UԅBPt&T$|$ $x5UԅBd)t&T$|$ $P5UԅfT$|$ $(5UԅBTt&D$D$ x D$$TB‰,tt&l4`uEԁ $6tܐأD$4YD$ y D$D$$2 l~zD$TD$ y D$oD$$2|$,|$4$D$,<$,1҉Ћ\$0t$4|$8<Í`t $5t`v't$Ɖ|$\SD$D$ $t$|$ÍUWVS|D$@$T$H|$@e$l1LÎD$\$D$Df@1tftD$@@D$ $@DT$@@@$D$ $DT$@L$\@@(1B$D$$L$ D$$)T$@$@B BT$Hy 1L$X$D$hL$TtT$LD$h$D$D%JRt  T$\1<%T$D$D$@ D$D9|SōmD$,$X>D$@9,$nS%T$D$D$@%T$D$D$@t$D$@ !ST$D$@{ ST$@D$HT$HzL$\<2T$Ht }XT$Ht 8l$H!t$L%TD$DjR$sPt.$n,$#1%=VD$ ,$ʅEL$XsTT$D$L$74$51$le3|[^_]Ít&$lt&$D$@%QtPiuD鍔$lED$,$2tL$T$l$L$t$1t}=EŋL$H|u{tuo-T$LD$$e5$l|$ |$ll$L$D$ D$D$ 2D$D$<$#t>ED$;$2$D$<=2T$<,$T$D$V&-ITT$LD$ D$XD$$$D$R3L$LD$ $fD$R4T$R|$$|$ll$ D$ T$D$D$$lD$1D$D$<$"t&E-Vf[I$D$@2OT$HD$B $V#T$HT$HzR,NL$HQt _T$H$l4D$ D$D$D$|iD$4$!D$@E;4$NT$H4z T$HD$<4$'01ɍ tf[‰D$[2t$t$lT$|$ D$D$ D$D$4$_!D$@o4$MN< L8Cx9p ,u f;rt uL$@$lD$ D$D$D$;2D$4$ D$@K24$M|$D 2D$hL$h $K8$D$@aMύf[92<D$@o,$5Mi<3tt$\m2tM1<v߃2<w؍t&뷋t$\-2gT$HBxt 8T$H|E$lt.$ltEruD|$@?TfDFD$ D$D$!D$$XtD$:TD$sD$.TD$ tD$D$D$$'D$@ǀ$XtD$:TD$sD$.TD$ tD$D$D$$`'D$@ǀ($$t!D$@ǀ$T$H|u D$HD$12l$$lD$D$ D$D$,$mFsT|$ D$$D$D$D$XD$&T$Xq2D$|$ D$T$$|&4$账ĤD$%TD$ D$XD$5&$D$D&J%D$,D$ITD$ D$XD$%$D$&=>L$Xq2D$sTD$ D$L$$%Lt&'UWVSLD$(l$pD$$ D$D}U$cT$DǂƋD$Dt$T$$?t$DLpD$D$XPPLkD$Xy $n=3D$ UD$_D$|$D$XD$D$ D$D$D$l:2` D$X$D$DD$$XtA$'DžPD$X$DžXXlt$$;A1D$ $.(T$DǹD$D#$;FD$DT$FD$D$F D$Dq$FD$D$FE\wlL$DǾ@ vtWAuD0蝧1  $XT$DD$_|$$D$O3D$UD$ y 1D$UD$sD$UD$ tD$D$}_D$$D$DǀUy D$UD$sD$UD$ tD$_D$D$$PF1y D$UD$sD$UD$ tD$_D$D$$F1y D$UD$sD$.TD$ tD$_D$D$$dž1>y D$UD$sD$UD$ tD$_D$D$$9F 1y D$UD$sD$UD$ tD$_D$D$$F1y D$UD$sD$UD$ tD$_D$D$$F1*vUWVS+Øe$1$$@D$D$ @t$<$ T$8D$ $|$D$L$8 $$bt<@t2LD$_VD$ y D$ D$$L<$_Vy T$ L$T$$L$(D$I 4$BT$$L$(filt&n@`T$8T$$TG<JD_@tMT$T$$D$4${ @T$$Lt3fl 4`\ T$$$7T$$tU&T$$D$<$tD$- $D$D$_VD$ y D$ T$$F<$b`|$4$D$`l&` $jvxD$4$L%th9tM%DщD$Xu%@t 99{i1hDž``L\!‰X\! tƋ8< X\ $E\D$T$ $XD$ TD$ D$$T$\X$T$D$h \D$ $T$$XD$z$D$T$$D$D$ D$\< D$$D$ 4D$ `a09`ht $&u 4D$D$$+BvT+BvD+Bv4+Bv$+Bv+Pw6t&4|D$D$*$L$ DL$EX, @ HQ $L L5.LL L@ L5ܡ,V h` R @h  Hbh~ EhhG $K0h9hdq`1EUe3e[^_]ÍvhX hP TɉXh04с% tsh@ud l0I9`Dž@t> $h0vlDž@0>DžHhph $pC094`DžH: $#wWL$ y D$D$*L$$DžH4$ ` D^ $ h(x;XiPT!! tX`d!! uDX fX% X> &t&Ef[Dž,DžPDžThPL$,$h(D$ D$h` $D$hwW4y D(E8t'0`t&4`D$*$L$ DL$D$4$D$ 5D$`T$ $h|D$4$D$ 5D$Gh1҃wW.5T$ D$D$4$hhv D$D$4$h,$D$4$D$ 5D$h,$ qD$D$4$JRt& $RP1TD$D$T$ $MD$8+$D$$D$wWD$ y D$=fD$hD$ D$$hXT< D$ $\T$XD$'Dt$D$B)$D$4D$ WD$u fh譔`Dž8OTy D$ D$' L$<$fT$<$1Ʌ8hL$8h4$ L$L$ |L$|$P{h<8E  $|3Df$|3DfL DL 0vL L LkL֘[L 輘L 記L藘L~L dL PL?wL&gLfmD$D$$XvmD$D$$0TvmD$D$$vh  8,$t$|$ D$$YhhL$8<$ |L$L$ L$t$蔽`dvD$ 4D$D$$&h3D 胼4D$S*L$ D3DXL$$xt$D$D$ 4D$$hX8H(D$ $e4D$Z*L$DD$:4D$ $f(D$ $4D$L*L$DD$4D$ $&ܪD$D$4$=|` $7x f3DžXt&`wW4y D& $f3DžXt&5D$D$4$fn $scv4PD$*$L$ DL$N(D$ $4D$*$L$ DƉD$4T$D$L$f`D$3$$$`0` |$ D$D$L$4$`v\5D$D$4$>h:t&C5D$D$4$ht&u5D$D$4$wWL$ y D$D$*L$$hDž@0t&x(D$`L$$hwW4xL$ y DL$EPD$*$Q4D$ *L$DD$`L$$Hg$\T$X$gDt$D$) $D$D$ WD$h D$04D$D$ D$D$$`2wW3L$y D$ D$* $qT$<$1Ʌ8ZwWL$y D$ D$* $$ $a|3D94`Dž@ $wWL$ y D$D$*L$$FhDž@0094`DžH$ $ wW 1ҍt&;t>t  ujD$T$lT$8tEuT$8TD$D$ެ|$T16D$<$xD$<$1HwɉMD$8tu vtuT$HD$LD$_%T$D$ D$D$T$8$NjD$DWD$LT$HD$ h%|$D$D$DT$$4T$LD$HD$k%T$ T$DD$$f?D$Xt?T$DD$$T$HD$r%$D$(D$ D$LD$aD$PD$4T$4HdD$<9%NjD$<<$ōmD$$0D$8#|$8D$@D$12|$|$lD$D$ D$D$<$XD$4%<$FD$49,$4$0t)|$8t"$0 to$D$4%T$<$D$4K$$D$4%t$D$4%t:8t5$D$42D$F $K< t 91$ e3c[^_]ÐG6T$$CD$Pl()` $Fy D$a&T$$D$\D$GWD$ D$P&T$(:6D$D$<$qt"6D$D$<$SD$8T$,D$|$D$#ID$ D$4D$$D$qt6D$4|$D$#D$$D$ fD$y $T$(rt&eD$4|$D$#D$D$ fD$y $j*t&T$<$1҅‰D$41T$,D$D$$D$4|$D$#D$ĬD$ fD$y $ZUWVS5rN}eE1<Dž@Dž 󫋃Dž$Dž(Dž,Dž0Dž4DžDDžHDžLDžTDžXDž`DždEemptEyDžg Wl$lD$ $D$D$4$$ׁ` hd1tft tD$$c tlD$$=s< $8DžDžDžDžF1D$ t$D$$zTD$$NT$D$1$(uv6D$@hT$L$ t$$ju@D$7D$\h@t$T$ L$$@3 A D$\fD$ y T$D$'!D$$辱9Džh@ǀ` d t7 vtpuD>P}86lj&@L$ |$4$T$Ⱦ PlD$ $D$ѻ@<%t>uDžDžDžDž\~CD$\D$\fD$ y D$i!D$$%&P}8~7lj@L$ |$4$T$u|PlD$ $D$@<v6t>uDžDžDžDžJ<w&PD$N!D$\fD$y T$ $輹K`D$D$ dD$ED$l$lDž |H $t$O1Ʌxʉ҃DVVPt&Džh@ǀ  t9 t&tpuD>P}847lj&@L$ |$4$T$pPD$ $D$y@<v6t>uDžDžDžDž<w<w䍴&PD$9!D$\fD$y T$ $ >i7D$@hT$ L$$k?,7D$@hT$ L$$"Q@Chtǀh 1Ƀ9rtftD$,$۸DžDžDžDž6D$\ft$D$ D$!y D$$VPt&7D$@hT$ L$$蜲u@~D$c!$D$0D$\fD$ y D$m6D$\ft$D$ D$5! @=6D$\ft$D$ D$J!DžDžDžDžr@+D D$\fD$ D$!y D$$膣3 $胧s04D$D$T$ $zD$"$D$|D$\fD$ y D$t,`1 $ӦlL1D$\fD$ y D$"D$$膢3tE]30 $Rv2D$\fD$ y D$"D$$ ;4$貧@  D$\fD$ D$!t& \fy D$ |$D$("4$躱t&BD$V!D$ D$ \fD$y $y$̮8\fy D$ |$D$="4$4&$耮hX8\fy D$ |$D$T"4$9 $蕤D$$ר|$ D$c"t$$D$D$= 3D$\fD$ y D$"D$$ǀL D$ D$D$, $肨)t$D$ "<$D$7D$ Я t$D$7"<$D$8D$ 螯1<0ȰD$\fD$ D$!ukt$D$H"<$D$:8D$ 9=$茤u&lll`b $脢EL$ $#Q\fy |$D$ `"D$$t$蘧L$,$*l) $軡04D$D$ t$$蕗4Ƌ0D$T$ D$$ct$D$"$D$D$\fD$ y D$04l`\fy |$D$ `"t$D$$T$,$谩;-t8T$D$ t"|$t$$褭fuauxu T  lET$D$ w"|$t$$&t 8DiL$D$D$ $L$@d|$D$z"4$D$D$ 3D$m$D$D$ T$L$$ [T$@dt$|$ D$}"D$D$$@1D$|$ D$"t$$ $L\fy ,|$ D$]"t$$D$@D$袙(D$\fD$ y D$"D$$k>t$T$D$ "|$$躕%|uT̀|>D$ $t$T$輓04D$D$ $D$%D$ $輦1D$$ID$$諙T$D$$j4D$\fD$ y D$!D$$ƀ\D$\fD$ D$!+_ܯD$\fD$ D$!^D$\fD$ y D$!D$$*D$\fD$ D$!cf! $萤$胤7\fy D$ |$D$,"4$UWVS\D$,$pt$L$tD$<$xL$8e $L1ɉD$4D$,Eu$&tiuDE|$LlD$>4$OtD$;$9lj4$D$ƍD$4$;2D$D$4$џt$01WG u  t;t81T$$hD$;,$臚t~"~|wT$,Btfx UNKN@OWNT$,t:Rt$T$9T$蹓T$,9l$D$$虓|$01tT$0D$@$ʙtL$,tD$09D$$L11|$L"yD$8t$L$01tT$0$豛L$8t<$蕛HT$<T$41t:t6}t01d,$D$Me u1L$41$Le3\[^_]Ít&t$0t&D$,y 5`ɉtQT$T$(D$ D$' t$T$(f$|$$ԗT$4f[4$D$8ҋT$0E1D$`1D$ ZT$D$|$L"|$MD$"<$D$<`& 8uNL$,AtfxBUSY@v`[D$D$,$> 8t[ SJ8uT$,Btfx UNCO@NDIT@IONAf@ LT$,BtfxNOAN@SWER@Ήωȃ tD$ D$t$<$苏T$,Bty T$ZT$sT$UT$ tD$(D$8D$T$$ՐD$(|$$@։׉Ѓ tD$ D$t$<$َL$,Aty T$ZT$sT$UT$ tD$(D$8D$T$$#D$(]L$,Atfx UNRE@ACHA@BLE?D$t$<${T$,Bt։׉Ѓ tD$ D$ t$<$ L$,At8D$ZD$ y D$t$D$8$S 88P 8 8&8/uT$,Btfx ։׉Ѓ tD$ D$ t$<$XL$,Atw&D$t$<$L$,At L$,AtfxΉωȃ tD$ D$t$<$dT$,BtCΉωȃ tD$ D$ t$<$&uwT$,Bt։׉Ѓ tD$ D$t$<$L$,AtD$ t$<$T$,Bt!D$ t$<$L$,At0D$ t$<$迎T$,Bt[D$t$<$藎L$,At+3D$t$<$oT$,Bt t&'U?WVStEl eU1҉d1󫍽DžDžDžDž?󫋍tlElQptG$D t/t  t&tzuD$$pP)čt$+T$|$4$~L$2D$ D$D$hL$4$D t8t$mt 8;<$蚐ptB4P9t$|$$虅p%}u ftPquDR_tuEA4$P&0pA t l 7` $׍pAtHQ4D$D$IcD$ y T$D$(9D$$dD&$蠓F8=ItB4D$B $tA4Tt&tEpy <$yP)čt$+T$|$4$臃4$ߒpy tt8uD$tD$ D$BD$D$1҅l1 Me3 q e[^_]Ð $hT$D$D$ T$L$$V& tt4$踑]4$xItBPP9|$t$$t&tt8utD$D$ t$BD$D$褌24$D$v~1|&}!%tDQDt)yBDP9|$t$$#py NvtpH:>14$辋txBDP9|$t$$轀&ty G(‹`tUT\D$ D$' |$4$葌\fT$4$FtA4D$ADD$99<$D$D$D$ IcD$T8&tttt$ 4T$ $\`D$ \`utA4T$t$ $,tB4ttt|$ PT$ $\`D$ 舂\`tAPDG4$跉H3tB@P9L$1t$$~&}tD$BDD$D$ D$D$D$P<$v1҅hl1A҉DY $``p9tB@P9pt$1L$$}tBPD$B $ztAP}ttL$`pt T$\@D$ p$ր\`tB@ttt|$ DT$ $\`D$ v\`tADtt$AD<$D$D$ D$D$D$PƅHT$4$(MD$ L$D$$с.@p$ ptB@P9&pt$$L$|GD$D$$詏dt d<$1D$c{ttt|$ DT$ $\`D$ ~\`RtADD$B $?xtADdT$|$ $فtBPD$B $wtAD)D$8D$D$IcD$ y D$$t1A@D$A $~wtB@mT$pL$`$ t`B@5T$|$ $tBDET$|$ $躀tBD,/tttt$ @T$ $\`D$ }\`tA@ztt`t$pt T$\@D$ p$|\`tB@%I tQtt8utD$D$ t$BD$D$跄!%tDWD)|$4$D$mD$9D$D$IcD$ tB@D$B $%utA@T$p`t$$~t`B@&t1B@D$B $ttA@T$t$ $P~tB@ufvUWVS D$(e$1ҍt$8%?u "t&tPiuDED$,4$莁t$D$4$%stx=tD$(|16D$4$rtD$<$薎D$;4$tD$ 4$h@<wfE<vH9D$4$t0T9D$4$t`9D$4$ԁD$(TD$,t$MI$8ꍻy c$"Il$ D$2;|$4$ʁl$D$ 4;|$fEщT$T$,$,uB$e3H[^_]Ívt$(!|$,tQD$(‹`t\TT$$D$ D$' |$4$T$$fT$4$~XD$(a‹D$(D9~A9D$D$t$l$D$9;<$D$l9D$ 迉D$cD$ y t$D$);D$$4yT$4${DQ UWVS\E̋ueE1EuNƤҋ E򍓀9EЉ跜8$l~H)čT$/L$|$$UwsU$LL$D$M$轂OMȅt(2D$D$<$虂 }ȍ9ỦƋt@$vt2M̋AD<$D$9D$w9t$D$<$vE>4$o}P)čL$/MԉT$ $t$zrUԋMMĉτt/MľPU t&tyuDED$<$|t@Uԉ$MD$L$$a12D$D$4$?N uĐMȍ9D$ $蛅@Mоǁ4P 0 ωMԄu tyuDU$譀MD$; ${"ƃnD$4$4$ǍmD$EtowD$&4$t{tD$;4$]{tWE0҉u "t&txuDUtquD$& 4$ztD$;4$ztMEQ 0DŽu txuDE̋Uԋp$t$lzM̋EЋQx0$T$l3l8 EЍy MD$P:t$0D$EЉL$$0D$HD$dD$ stMD$@ $yPD$;$UytGtA1<:Uu%{v<])BtS<[uBut&tEԅt t >UGPt2MԿPu vtruuԅDʅt?EйP҉u$&txuDMD$; $xttEȅtMȋ}Ѐ9tGMȉ $G}UȋMP &tyuD}ą%MD$; $xt }ЋUā@:Űt9T$$ wEtUM̋  UЉMԁMԾPtzuDM4u2MȋED$D$ L$D$$qw!1Ue3e[^_]ÐUĉ${MċU@P &tzuDUЁf'l83UԍD$y dD$ T$D$N:t$$p:t&<:E̍y *`tPTUD$ D$' t$<$wwUfT$<$/u1҅1EԋUċMD$:D$D$ dD$T$L$4$E1e1,D$dD$ y D$D$9$ot&UЋÉ0D$$CgȵD$dD$ y D$t$D$I:$EovE̋PDtUԄUЉMԁMԉ $=yf4$ y vut&`2 $rMƁ@ E̍y `ɉtSTUD$ D$' t$<$DuUf)T$<$r1҅…ҸoEԋMD$:4$D$D$ dD$L$~3t&`2 $qt$y D$dD$ D$:t$$SmEwT$<$o1҅\D$dD$ y D$|$D$9$lfT$<$co1҅}SvUWVS\D$(T$$‹+D$LtXt3l`\[^_]Í0$|fuD$(ǀD$(1|$LD$4t$t"0ɉf<>t DuAD$,T$ $mT$ HD$,L$8l$0L$,D$8ftUul91T$8,D$1bD$ y D$4T$D$$jD$pD$4VL$4t$41D$0D$,ft$<~D$(,- `y ɉ/Ib :Tl$$Őt&T$$FD$l$ D$4T$<$z6u׃\[^_]Í&D$4L$<~t$<6t&` $mG6D$F$` D$$o蔍8l88`D$<,$nkHPT$$t%>t 0 t&>t Luz$Ak9L$$@u&QtuD$4EL$4)f $l4L$(D$D$1bD$ y D$4D$$Wh\[^_]Í&TD$ D$' |$4$Dofl$4$lD$(yL$,D$8y D$1bD$sD$=bD$ tD$4D$D$$gt$4t$D$ t$|$$-^ 40l9D `G @D t"l9I ` 04$T$sDžDžƋ׋ t<‹@D r %Dž t!‹@D #%> lh9 `  |%=| =q u% D$$^ t`D$$iD$D$$`D$ $hD$D$$` tp t`D$$hD$D$$@`D$ $dhD$D$$ `t: t*D$$ hD$D$$_,t"$>WD$D$$_@PǀDTt$|$ $0m8H<Lt$|$ $bD$D$ L$$L$BhlDHptPL0tA>t<4$dx~ P9 |$t$$Yp t>>t94$ddxBp P9K |$t$$cYt pdt>>t94$cxBhu P9 |$t$$XP $WdHDlu%&tAzuDD$ D$B@D$BD$D$=cp@PDŽu tVxuDt.8t)Ɓ $d Apt.8t)Ƃ$d\ A@ttsaxWǀt!8tD$:D$$n[A4t!8tD$-pD$$@[Bt!8tD$:D$$[ t<&D$$e, t@t&D$|$F$dD$D$$Zvuʋw4D$0BD$,D$(D$$AdD$D$ D$ ܸL$D$:D$D$L$$WUe3 e[^_]Í&9*` $^XD$D$b$L$ L$?ZNf,( ldh0&DžDž|& $]l9'f04D$D$T$ $SD$D$L$ D$зD$L$BYl9(,D$D$T$ $CSD$E$L$ D$D:D$L$Xl9D$ t$|$ $pSD$D$T$ $RD$F$L$ D$D$L$LX0& tD$$U |oarf04D$T$ D$$RD$C$L$ D$D$L$Wl9`Y $r[l9`  $9[l9S` $[$f‹@D$Ad$D$ b:D$j:D$Rx@<$]\P)čt$KT$|$4$kQ4$`P҉u3t&!Vxu$]&0%4%xv $Y@DD$ T$D$$OD$H$L$ D$D$L$SUq $JYED$D$d$L$ L$Tfʁ`T$ $D$ |$S/t&|$`hT$ $D$ RAh|$`pT$ $D$ JRApUD$B`$KAp@D$B`$KAhpP4$CYP)č|$KT$t$<$QND$A`$-Kv\RsT$UT$ tL$D$,D$T$L$$RT$|$ $[TBp'2T$|$ $5TBhhs $|$T$TsT$UT$ tL$D$D$T$L$$REsT$UT$ tL$D$D$T$L$$QtD$D$%$L$ L$fQt$D$ &L$$L$bnsT$UT$ tL$D$D$T$L$$P SD$ :ltD$$)K1[fUWVS\ l|$x$T$8Lu%T$t<$21\[^_]fGED$$c#G D$$c8@@F@lND$D$tD$ D$ z%D$F@$;I$~<$VD$ L$$OuЉ<$Q$pJpH)čt$+L$T$4$?1>"D$:$jJjp@<w<v4${JD8"4$hlxt$D$D$-L$x$L$ |L$D$D$$4fJst8X4D$ D$D$D$|iD$4$4;$[aE;4$xat8t#$+;Pat=$ ateh:$[`T$ `ƀ` a f;$[q`;$ W`p` $1@tCvL\$m|$l$T$4$?VT$0D$ ;m|$l$T$$$u$T$xt ~ ;D$dT$dD$$&NjD$h T$h\D$$t& NjD$lT$lD$$P& NjT$< T$8@T$L$]UWVS8;|e$l1D$,$D$D$$><|$$lD$D$ D$D$<$J[D$,<$8C$<ҍD‰$B$%D$B@dD$CP$D$D$dD$ D$ & $D$dD$ D$PP$D$9fdy vȉs(l(e(tT(:`kt$<$V:G`D$$$UĉT$ D$D$ƋD$$#=U$D$T=D$T$$Rc ǀ<>t:>t5Bht$$D$l xf[D$$=D$$ =D$D$ ~VT$D$$ =D$D$ VT$D$$x i=D$D$ VT$D$$8 t$D$ VD$T$$ $"t$D$ VD$T$$"D$$Bt T$D$$pTD$T$$PD$$X mv'` $v2D$dD$ D$=P$D$b t& $Rt&&`* $v2D$dD$ D$EP$D$ ?::`w1ҋt&*` $Z0pD$dD$ D$IPT$$fl4:B`dy  $̿D$dD$ D$3Vy T$$d K $adD$dD$ D$eP$D$  $rD$dD$ D$VP$D$ 1ҋ2:B`dy q $ZD$dD$ D$5V $I~GdD$FdD$`P$D$D$dD$ D$ 9:*` $@dD$BdD$=V$D$tD$T$D$ n TD$ T$D$<$tXP&)ԍt$CFHVD$|$$t$L$ D$$DD$T$$4FdD$GdD$bPT$$D$@D$dD$  kD$$1U$D${$=D$)=D$$y[| ǀ<2`&UPWVSeE12% 󫋅px4$LP)čD$/T$t$$ZtYlT$BD$1$D$=D$3gD$ y D$ |9,u#tyuD$jy8$Hx$B8P9|$t$$GD$D$4$1D$@$ 2f[;D‹D$=D$D$ T$D$D$$t& x ׄt,PftzuDP @τutyuD ǀ<D$D$$ %9$*T${*諲t 8\$D$ʻUe3 e[^_]f2D$D$4$%)t&$9)U&` $ Rf|$ 8T$ $D$ uKB8t&1D$3gD$ y D$1D$$ T$|$ $B8D$@4$P D$;f[DщD$=T$D$D$ D$D$$sB8D$B $ B8et&VSuTD$D$D$$ ">$ D$'4D$B\T$$D$T[^Í'UWVSeE1D$@@@ E$D$4$D$D$$ !4$(?4$¸1>UD$D$$B>t>D$D$$[E> $a&\$D$裷Ue3ee[^_]ÍvR>D$D$$>D$D$$_BD$ >f$>t&R>D$D$$p\>D$D$$P4$hD$$D$ t>D$$4$D$$D$ >D$4$84$D$ >D$D$$S'\$P%$TƉ$X׉D$D$D$$ >$ D$\$D$\T$$D$蕵$P$T$X\É'L1\$D$ gD$y $L$$l'$|n$Ɖ$e$l1D$($ՉD$D$$ \|ш$k%=* t# tE<BˉD$$l3XD$D$ D$D$<$V?$ D$(>!D$(裥\T$($D$w$le3$|$$$ČË$$lT$D$ D$D$?D$D$<$0?Et&$kD$ D$$藐&LD$T\$<ßt$@D$/D$P|$Dl$Hpgy h|$D$ l$D$$D$4$ |%=vX==t~D$(D$$|$l$4$D$ D$D$(\$*!ကtDȍBDɃ)JF$D$F $F$%D$'$D$D$"cD$ y D$9v|$T$ $F$HD$0F$D$ D$0V L$T$T$,L$($T$,L$(uV$T$T$0L$L$($L$(‰F$1/u $|U.i$׉$Ɖ$$%$lT$?T$$^=$D$,|$,tsD$,D$D$$!틄$ltuD$T$,,$4$|$$$ČÐFD$K+$D$pD$HdD$ y D$qf%D$D+$D$D$HdD$ y D$]OvUWVSl$ÝgV4F0D$T$&~-AD$ D$D$<$& $FT$HD$HD$FT$ D$ l$D$D$$:OL$0T$<$L$0]V9 v'UWVSlE\$D$81ɃD$<AD$@$D$T$D$@D$0D$hD$DD$lD$HD$pD$LD$tD$PD$xD$TD$| D$4D$4f^y D$ ~Dl$D$|$4$D$L$Htt$Ht&D$<lD$< cD$PD$ nD$D$LD$D$n$D$D$lD$D$PD$ D$LD$,D$dD$nD$D$hD$ D$PD$D$L$苧|[^_]Ívi t&\\$L[4)t$Pt$`|$Tl$XD$ @?4$k\y T$$T$l$|$\ $l8FHD$Fl$ D$H?|$D$D$$T$$D$ I?l$|$T$4$i1\$Lt$P|$Tl$X\Ív $Jtvl8V`,T$$D$ O?l$|$T$4$f`T $o8 D$dҋtt | uruh #$rl8`T$$D$ ]?l$|$T$4$vT$$D$ n?l$|$T$4$v $zFHD$Fl$ D$N?|$D$D$$#zXtL$ $葘L$ d L$ $eL$ u $_L$ zd L$ T$($'L$ D$(9N t> $ ,d T$($L$ D$(9 L$ $軗L$ BT$("\|$0l$4l$0|$8׉T$,L$<_t&T$$D$ ?`|$l$T$4$ $ĜT$$D$ A`|$l$T$4$4T$(D$ >`|$l$T$$&uL$^,$D$&$舞or:D$$$t$ D$$h$T$TT$, $u&<v$?et$Tl$TtA|$04$9T$0t$$D$Õ+D$,tTuɋ|$0ucf<,tGQ< u$Gt >$R$$D$4D$ D$T$T$D$5$D$D$cD$ y D$u$,cT$H\D$cD$ y t$T$D$5D$$贅D$VD$sD$.TD$ tD$D$D$$\f,t$(Ƌ|\$$迠Ø  t^Fu8tD$$k|D$4$M\$$t$(,Ðtu"Fttt fl8"`t $興vFD$I$D$HD$fD$ y D$:\$$t$(,ÍxFD$D$$,c&l8H`u&1҉t$|R| $貇vNjFD$I$D$tD$fD$ y D$dfUWVSޞ÷ Lt$`D$ I4$gD$0y D$]D$8D$|$ĔBD$4D$8D$<t$,t$ED$L$D$D$bD$ y D$]$`x"}t,$ $`x"ujt`$`l $`$oD$$y\tD$$a$`NN}tE$`$贕$`x"utD$$[ $d$dD$D$$;Ƌt$`z"c5D$$[9FD$ D$D$,$Ӭ&$dD$D$$j:Ƌ8 txExD$E $REx$`x"lE$`D$D$<$f ^%~D$K$D$D$bD$ y D$wZu-D$ D$D$,$訫jt&D$$Y$dD$D$$9%ƍ}D$K$D$@D$bD$ y D$Y$`x"u7t-D$Pd$T$dD$$@YEu)D$ D$D$,$葪fQ$`x"}t!,$譿 $`x"$4$$2R$`DŽ$2fDŽ$6D$|$4$n|$t$$\4$Z$`$~>$`x"uX}t,$v $`x"u5t+$`h$`$}$`Łw$`x"D$$W$dD$D$$6Ƌ&$`z"D$$BWED$dD$,$薨$dD$D$$#6Ƌ$`z"D$Pd$T$;bD$$Vx$dD$D$$5,$ƍD$D$褧ED$K$D$$D$bD$ y D$ V$dD$D$$5ƋExD$E $M@6Ex$`yt8uXD$bD$ y |$D$aD$$`U^<$<< $<PD$D$$ V$`|$L~T!t$`$t$`x"uL$Lu|  $$]| ^uD$bD$ y |$D$aD$$TD$$SMp$`K2wt 8[A< @ @^!$T$TUMb)i)э4bT$@T$y T$HT$D$ KD$,$|$D$ @D$$NU T$T$@D$LD$D$KT$ T$H$T$RD$D8*`; $V$T$@|$D$D$KT$ T$H$T$RR$`x"1҉ED$D$,$wE1҉1҉$ TMb)i)jt$\4$,^DŽ$,fDŽ$0tD$l0Ƅ$-D$xD$ttD$\0Ƅ$,D$hD$dt$DŽ$$$,D$$UOt$\4$]DŽ$,fDŽ$0tD$l0Ƅ$-D$xD$ttD$\0Ƅ$,D$hD$dt$DŽ$$$,D$$Th$8$$<DŽ$8DŽ$<2t| $8B< %$<tP@輁T6*$`x"/| $`$D$bD$ y D$KD$$gOD$bD$ y D$JD$$0O:D$bD$ y D$JD$$ND$bD$ y D$JD$$ND$bD$ y D$JD$$NST$4T$0UT$,T$(T$$@dD$KKD$ D$D$ D$bD$y D$:D$$KiP W`UWVSLt$`Wi0< t$Gdž< hy } t{T$dl1@dl$ D$b|$D$FD$$MT$d@$M t]t:CT$4l$D$ n|$L$$T$4 t9Xa  t9 T t@`h98 t$gFt)$R@$BF$4F t$L t$K t$K,t$,E t$Et(|$80$Eu|$8dž < tH(8 $xEdž< $ u,|f9B $EE$ ( u҉$*E0 dž$ t:<94 0 ǀ<~$D0 ű, t$Pdž, @ t$dž@ D t$džD H t$džH pt$DdžpF D$l$D$|$ D$$Kp$GttD$$[DdžtXtD$$7DdžXL[^_]Ðt&1҉l8Fl$ D$[|$D$8D$$KIdž4 sBt&` $Mf`f $LNJY`ɉtWTT$4D$ D$' |$,$OT$4fT$,$\MhFhHD$Fl$D$W<$D$D$ jXt&lFD$E|$$D$D$hD$ Gl +\AD$hD$ D$E|$$|Gl$ ҉T$<1ɉt$8։l$< `<6tL~FD$+FD$hD$ |$D$El$$F6lut$8ɋl$<FD$E|$$D$D$hD$ F=t8T$D$ al$|$$Xt8T$D$ gl$|$$B3P |$8#$$F< PDT$$Qu‰|$8D$ l$|$< @l$ D$|$D$D$$E< Px(Al$D$ |$D$4$< @h&xD$hD$ D$E|$$Eǃh& $HlFD$E|$$D$vAD$hD$ Dl D$hD$ D$E` $JH9lg` $H>T$4l$D$ p|$D$4$T$4X .t&T$4l$D$ w|$D$4$T$4 ` $cGl` $-GPlB` $F6둉T$,$PE_|$8< P/|$8Pt&,\$$^t$(t$0l8N`u,4$D$D$t1\$$t$(,Í $BFvFD$$D$9FD$hD$ y D$AfUWVS,@`f]?tǀT $#GXxJ &$AGXx#D$E$MtuՋl8Z`y G0D$GHGXl$t$ D$GD$$UBGd$:<$R;,[^_]fGX`y l$ D$FD$|wD$t$$@tv'UWVSN\'vy $Pt$rH $TJ $FJ $8J@ $*JSF$<_F$~OT$,hD$D$Url$T$ $7T$0|$D$Ur,$T$ T$,T$T>T UWVS.S\D$n$D$HD$1D$LD$ (]D$4D$y D$0$F%5D$80D$DfG D$nD$@GD$t&$6GXx'D$E$BtuՋl8D$T P0PD$D$,T$$|$D$ZLD$ ,$5T$$FdžT u-ED$ D$D$4$E\$<|$Dt$@l$HLot&,ay D$|$ D$eLl$$.T @`D$FD$,D$ |$D$gL,$=T PPD$D$,T$$|$D$gLD$ ,$4T$$džT F)t&ay D$|$ D$_Ll$$-T @`D$FD$,D$ |$D$aL,$T$0՞}2T$,:1%te D$$xr?D$ D$D$4$9D$@$'E@1󫍍GL$D$$/!сကtDʍPDɃ+P)č|$'T$D$<$t&D$TD$ y D$-nD$$n!PGD$TD$ y D$9nD$$6!Q2D$ $/1]Dt&LL$P\$T$$D$ $T$=udt&D$8^T$8D$$D$ D$B$T$t,$D$$,*:D$D$X|$Xt$ D$$t$XT$HT$0 t$\u&<vt$\>|$Hl$Ht=t$4<$T$4|$$D$v!tR+D$0|Hu͋t$4u<,tF < ut$\Rft$4-։t$\>"t'uD$D$\$t$\뉍t$\[ʋD$8pD$L4$D$tiT$D$$p uˍy l$<*dT$D$ |$dT$T$4|$ D$D$D$$dT$4x*T$T$4|$D$ D$4$ T$4džd|$T$4$D$ D$)L$dpkD$`ɍ`kDщT$T$8D$ $dL[^_]Íl$ID$$w 7D$@II]'t 8D$Pd$T$$D$4$蝁l8`D$@86&t 8+T$@$=$\e3 s l[^_]1҅tD$LD$$ ey T$HT$ D$XL$ T$4t u!FDD$48ED$4D$4D$TD$D$ $D$D$4D$vlD$4eL$D$<$hD$$SvD$4 vD$4 vT$0$4D$4$[&1$D󫍄$DD$DŽ$DDŽ$H $yLD$ )fD$y D$E$1DŽ$*0$ $󫍄$D$DŽ$DŽ$ $LD$ )fD$y D$(F$DŽ$#D$0kIt 8D$0xID$8t D$88SD$0 8vA T$$|\D$DD$FD$zF$D$D$)fD$ y D$sT$0$If}@hTt|$$$$$HT$|$$y|DŽ$ *T$0$IpgDŽ$ #$dD$,|$,1DŽ$dI$ut }(E(uPD$)fD$ y D$D$^F$$T$0$IKI1t$4DŽ$dT$< &4$9shD=(T$4$h$dD$$t$hT$ $(v$Ij1cv1҉$P1IL$$f UWVSóh< D$ $" $rD$PFT $L$$|$D$L$$ȉ4$[@5 |Ddž\e% Ћ|t|$$T$`}?`|$( !%tDJDFP+T$(8HL$ N ;T$ L$(L$,T$|$$xT,$zxFP9|$l$$T$TL,"L$TT$XD$ $0L$(VD$y D$E'D$ L$L$,D$ $H1<[^_]ÍL$(FPT$T$$D$ L$L$, $ET$$u=FPt&L$(FD$ |$L$L$, $u=Ft&L$(T$T$$L$L$, $4T$$FPL$(|$L$L$, $F@$T$T$&@xe@dž\et&FD$F $FOD$F $N L$(L$,FPD$|$‰tx t$T$$ЋT$$u T$$o@f$JD$VD$ y D$D$'$D$VD$sD$.TD$ tD$D$D$$q,t$$t$0\$ 3 d|$(Bvml#`1th $tVt1D$hD$ y t$D$/D$$6t&PRt&CJf\$ t$$|$(,ÍQ=J؍JЍ!JȍJ/J븍J밍I먍_J렍J똍hJ됐&UWVSl$be$\1w%lW JgT$@y D$<t P | T$@:R`(D$4$8A KT$<|D$ [T$l$D$G$ȈGD$<g|$D$ \l$D$4$T$<dž|$D$ ^T$l$4$ $1$\e3o l[^_]ÍT$@~nD$y gD$ tIT$\T$D$ D$$t#)IT$D$<$ tIT$\T$D$ D$$At#>IT$D$<$Tl$@ Ggl$@Zl$@dGl$@f |D$4$b3FKD$D$4$6qB 4$T$8D$T$8_D$ 5ID$HT$8D$4$T$8D$ HD$HT$8D$4$T$8D$ ID$HT$8D$4$T$8EUWVSgS\$$|`ND$i@ D$,y T$0T$,L$8L$L$0D$RD$4D$ D$T$ $ D$8T$4D$WD$$p \ K/%D$($JtP t :<$HJD$(t D$(8s,L"{T$| `#DžPUDž Dž Dž Dž`DždDž Dž Dž DžHDžLDž< 󥋃pHtp t D$tL$tTL$4$D$T$t,$dD|% Ћ|HcAL% ЋL Ћd Ј@D$|@Dž\eDžX L$(DD$x!}tq` !%tDJDEP)zL P9|$t$$x]=|$pY D$p$5pEP92L$pt$$L$6 ! !%tDJDEh)zP9i|$t$$! !%tDJDEl)zP94|$t$$ldh(,||%=,t"\[ !%tDJDED)zP9|$t$$% !%tDJD)zBP9n|$t$$>! !%tDJD)zP9|$t$$ֿDž0 Dž4 l$$l0X uKL$(ҍ~KD‹T$|TL$pD$D$pT$L$4T$8D$D$D$T$ L$$@\[^_]ÍH "X ЈD$xD$t|DL$t% Ћ|tL$$T$菾T$t#xvD$LD$:D$D$($BfD$LdWfK$D$D$T$$T$$$T$$T$$D$T$4t6T$4:t-t)8t$T$lT$:T$$t~t&$u>1$e3$$$$ Ív$tHT$81D$$t$$듋uo1|$pD$pD$$D$$[qD$D$ UD$y D$<$c$$9tF!$l$%l?=`$l$uF 1|$pD$pD$ D$$D$ $ֺT$lT$XD$4FD$@{$%F D$P$:D$HD$LD$t:4$胴T$8xP9|$t$$聩up>4$5T$8xB\P9H|$t$$6D$8T$8$D$H輝D$8#D$8D$$}D$8$(D$8D$$\ v$\xpD$$輹tMuӋT$DL$@D$ VbT$L$\T$ D$VbL$D$D$$[\x_T$8Dž\ t^L$8 ^T$8| D$8D$D$$eD$ƍD$X$PD$XlD$\pD$6&'UWVSg@*EeU1҉E;D$ D$$Գo $Džu$&tyuDz8kLoL,ȉZDžDžDžD$<$4$NƉ;4$|$Dž$u$tPyuD"9t8x|tr:tmD$$4Kt68t+ uDžDžt&}e3=e[^_]ÐD$; $bH7vt$<$htj1tftwO, &$$D$$uōy fT$D$ 3D$L$ D$3t$D$D$$kx Oǂ) 1D$BP$D$BP$ȔTǂǂ`ǀ4p8`D$(t$T$ L$D$3D$ D$D$$B4$P)č|$7t$T$<$ $DNLD$ T$L$D$34$f LD$$htED$;$tD$z D$F $,2H!!сကtDʍPDɋ+p P9' t$$L$覕fy D$C@D$ D$ D$$GD$D$D$2D$D$ $Et 8WL9tx!󥉅Pt T$$l%``$ygOD$%44$|$ D$ fTƒ ЈT|$ D$'44$|$џfu31D$ *4|$T$D$4$)}t$|$ $PP\lD$D$14L$ t$$!t󥋽`|$$^p`D$$/D$84$L$ t$D$D$D$D$BP$DD$A $1 fy fy f]Ƃ2C`p $肚Z#|$$͜oL9 T$$ɉtS9tNrht>u<<$聛xSF9|$4$L$胐  $膕D$$TtWuɋD$ R4L$t$L$ D$R4t$D$D$$x FDǂ9~‹9}t tQFD$ )D$i'D$$^4RhD$$`t$|$ D$ T$D$D$JLD$D$4$躊u D$<$D$l4T$ L$D$$8D$(t$D$ D$D$$.p?+`1Ҿ:j%蹶$|$k$GppG9t$<$D$Ip9/`# $舌 T$4$L$D$z4D$D$ ,&TD$t$ D$4|$$誑t$P´耉$D$ |$轏;Ћ|Bq $9D$D$4L$ t$$D$BP$軈 D$4$D$5LD$|$ D$膐D$BP$KD$A $$t$|$贑4E $MD$<$LD$q4T$L$D$D$ 4$՟t$T$$躠#t$P´$D$ |$vu?|$BP$ֆ|$$t$mljHY|$P´h$D$ t$ʌu9rht$BP$-Bht$$|$ǏƉBhk|tD$<$rT?vUWVS\5eE1@EEtPD$<$BD$<$E/E܋DZMԍL$y D$ _MЉL$T$$&Nj|U؉D$E܉$TMԍPD$ `D$<$L$MЉL$;1Ue3de[^_]Ðt&E;UЉu8DEЉD$GD$D$D$ D$ D$D$$ t@MD$$MUD$4$EԉUԉEҖ4$EԉEԆG ^E]11v D$/@@@ EEb1E܉D$E؉D$E $֐ D$D$ D$D$$1ҍL5<9LT<$`z|$$'t :##UԉUЋ !%tDJD+UЃ=H9ST$Uԉ$T$Ku$U͏UăEԋH9MMԉT$$L$ń|$$ÜD$<$#DZMԍy Mt&D$D$<$`DZD$y D$$D$ `D$<$81EЍD$ EԍO L$UĉMȉD$EЉ$iUċMȅuqD$G $Հ EЍD$ EЍO T$L$UĉMȉ$UċMȅuDiEԉL$MЉUĉD$ $%UąL$MЉT$Uĉ $Uą dtt&U?WVS\E蒣k0eU1҉$1D$3@@@ TE DžPDž8Dž<Dž@DžDDžHDžLDžt H`P, t&tzuD,D$ D$$`(e(ǀǀǀ p(ƅǀ((t$P(ǀt (T(u t&P$Hu싅(}ǀǀu(tt&H@u$1DžDžDž‰ DžfDžt&,D$4$(8,D$4$0B8~D$(D$$&0R00{M0,M ?,aD$4$g0rD$4$DD$4$** D‹(dM ;H.(dD$0D$Yy D$T$ D$g$(ǀdƅDž Dž2f,D$4$P$Tu r@0BD$D$ %D$T$"-t&$8Dt\ (0D$8$D0VLD$$,{[0rJ>A4$QP)č|$3t$T$<$]}|,D$,4$ȇt f<v,D$4$L$q((ux0,t&,OD$4$`0B$(%jf$$Dž$0\&(4$dD$z D$0BYT$ D$zg$D$(D$D$y D$ŀt&(ǀdev,&OD$4$P,1OD$4$.0D$ D$B$蓒(HƉ-t&(0`D$z D$B$ލ0@t@ Dž 0BD$D$ :D$T$(yv,4$2~0(BD$D$0$c~^E ,D$4$G,D$4$ՅQ0PJ(ׄu$tAzuD0,4t&0D$ D$B$ߐ(HƉy D$D$4$辈uj(L,^D$4$0:[rD$4$̈́(()vD$D$4$6(,D$4$dT0r 4$Cx(P9} |$t$$?xf@Dž ,`LD$4$ރ0r4$轂x(A\P9 |$t$$w0,}uw(tgw1 ‰vGtJ@4rt${w<$wvЅuY y , ( 9}N G (P?I;| ((u)  Ј (9t t(u(v,T(p0tsx <$̀(pQP9 t$|$$u(0P(ҋ  ( (fttLU  0D$ gt$,D$<$t$Ƀ(t ,0D$hT$ L$<$fuG( ,L$0D$ h|$D$ $G ,D$h4$|$ D$蓀fu;(,|$D$ hL$D$4$(fu‹fff$E ‹Mt3t/(`~S*(1D((#8# ЋH#<# ЉL#@# Dƒ( t2(@u#t(1$)($~r $pr(Hp@\t8u (FT(T$L$D$Gh|$ D$D$COD$X$By Xt1yX$[q}e3=(+e[^_]Ë(T 0;QB0PD$ D$D$B${tD$YD$ y t$D$ fD$$v7PD$4$)},((,pLD$4$|)0r 4${x (ATP9M |$t$$p0,E ( $%q+P(u031tft(ǀ`l8;`" $ yPt$D$h$)Ɖt$ D$D$t$ ,t$tt& = ,D$ gT$L$D$4$ ~J((%D$4$zQ(ǀ(<,mLD$4$z,ID$4$z^0(JRt :t $X(0,(0$qL D$|$D$gt$ ,$t$+sD$0$Ղ$ts(((|$PT$ $D$ p (D$$4Wi(.PD$(Y t$y D$e,t$ D$$/s~& D$et$,4$y(0+&E t H? (‹ǀǀǀ Z(ǀ(&(ׄt/P t&tAzuD1ƅy0zu <$vpa (AXP9Jt$|$$k0,( T$|$ $r(f(ʁPT$ $\D$ |$tn(B\&sɐV D$(T$D$gt$ ,D$(D$$t$o`$t)Ѿ@tAzuD$D$;4$tt(z|k$ 2DЍu;OT$L$D$D$ @D$D$@4$e蝐(f1t TDƉD$ (0$D$L$4$O} <$)tp(GpP9t$$t$"i 0`Dž\D$<$nv\T$ t$D$,M$>|\ɉ`[ D$t$ ,D$g$D$D$t$m(D$AP$Fe((((t$P耉T$ $D$ _k((A\D$AP$d(0F\, D$BP$td(`,U,+dD$4$s,wLD$4$rH,LD$4$r0z<$qp(P9Lt$|$$f0,(ʁPT$ $TD$ |$i%(BT]=s$cn D$;h$t$ ,D$ROD$t$ k(ATD$AP$b(0FT, D$|T$D$t$ ,D$g$t$j| ( ҍB?H(ʁPT$ $XD$ t$h-(BX` $|$T$k(A\0,v0z<$op(P9Dt$|$$d0, l8*` $\m D$e$D$t$ ,D$D$t$hA $t$T$j(AX 0,t&`0}}|$ 4`D$PD$P|$B$Tn!ကtDȍBDɃ)r (P9J t$|$$bU!ကtDȍBDɋ(+4r P9 Mt$L$$b0,(P(t$|$´p$D$ e(Bp $|$T$h(AT%0,=&T$t$ $h(&(BpD$BP$^(Appt$|$$2h(Ap9Jt&(AXD$AP$3^(0FX,ef,LD$4$l,LD$4$l0zv<$kpb(P9t$|$$`0,(ʁPT$ $D$ t$cuS(](D$AP$\(0, $t$T$vf(0,(ʁPT$ $D$ t$buS((D$AP$\(0,L $t$T$e(P0,,LD$4$j50z<$fip(P9w_t$|$$f^0,(D$GP$([0,](ʁPT$ $D$ t$Aa(F(D$AP$Z(0,,zaD$4$2i.0z<$hp(B`P9wjt$|$$]0(,7 $t$T$c(W0,(((t$P`T$ $D$ _(A`6(A`D$AP$2Y(F`,LD$4$g0z<$fp(AdP9wIt$|$$[0,T$t$ $Sb(B`ny(ʁPT$ $dD$ t$^(Bda(AdD$AP$X(0Fd,A,LD$4$f0z<$ep(B|P9 t$|$$Z(P|D$:$epD$4$($tG0,} $t$T$`(Ad@0,I0YD$y T$ t$D$YfD$$^0,0(ǀ$,(((t$P|T$ $D$ \(A|(A|D$AP$V(P|,LD$4$dua0B$\n(t7 T$t$ $c_(B|1҅,LD$4$Ddg0z<$#cp(AxP9t$|$$"X0,Uωʉȁ´P$D$ t$|$A[(#(((t$PT$ $D$ Zu|(U(D$AP$6T(1$t$|$](j0,(0,@,MD$4$L00z<$Kp(P9wZt$|$$@0, $t$T$G(i0,(ʁPT$ $D$ t$qC(K(D$AP$<(0,,MD$4$bK00z<$AJp(P9wZt$|$$A?0,t $t$T$E(i0,=(ʁPT$ $D$ t$!B(K(D$AP$q;(0,頾,ND$4$J,MD$4$I0B$SG(3˜ $W0, $t$T$_D(J0,ν,MD$4$@Iun0B$R(tD@鈽0((O˜ $W7,SD,MD$4$Hu`0z<$Gp(P9t$|$$<0,ȼ,MD$4$:H,%D$4$H0B$Q(^(ʁPT$ $D$ t$B?uS((D$AP$8(0,Ż $t$T$B(0,鎻,MD$4$G,MD$4$FV,MD$4$F,MD$4$Fuo0B$;P(tE0B$L(0,鲺飺,MD$4$Fh0B$O(taY0D$ BD$(D$($60Z,0D$ BD$(D$($[60uC,骹0B$K(0,tBD$D$BYT$ D$f$D$TD$y D$=0,, ND$4$D0B$$N( Ј0,麸BD$D$BYT$ D$f$D$TD$y D$>=0,a,ND$4$C,#ND$4$C,2ND$4$C,?ND$4$sC ,GND$4$SC,NND$4$3C,yfD$4$C3,mND$4$B ,yND$4$B,ND$4$B,ND$4$Bl,ND$4$sB,ND$4$SB,ND$4$3B],ND$4$B0z<$@pq(P9w}t$|$$50,%(0D$z D$B$H0C(/,˵(ʁPT$ $D$ t$8# ((0D$ D$B$iL(O0,(0rMx((0 D$z D$B$G0( Dž,陴,ND$4$ @0B$I(N0`BD$ L$D$D$UND$D$4$/( M(0,γ(0AL0(,镳(0D$z D$B$Fu<0,S0rK( *0YD$BD$BYT$ D$=g$D$D$y D$70(,鵲0YD$BYT$ t$D$6gD$D$y D$$270( ,C(0D$z D$B$D(Y~80,0 (,DZ0YD$BD$BYT$ D$Fg$D$PD$y D$A60(,R0YD$BD$BYT$ D$Bg$D$ D$y D$5((D$AP$z-(0,驰BD$BYT$ D$g$D$D$y D$350 (,D0z<$:P)čt$3T$|$4$/(,)0,BD$BYT$ D$g$D$LD$y D$v40t (Dž ,}(0D$z D$B$A0us(xc,+(0D$z D$B$A0(xr,ծBD$BYT$ D$g$D$D$y D$_30 (,pBD$BYT$ D$ g$D$D$y D$20 (, (0D$z D$B$@(=;| 0Dž,阭0YD$BYT$ t$D$LgD$D$y D$$20 (,&0BD$BYT$ D$g$D$D$y D$10| (Dž,鱬0\D$z D$B$6?u`0i\(h,^ $t$T$2(0,'0YD$BD$BYT$ D$+g$D$D$y D$00 (h,鲫馫,ND$4$7u*0B$@(tV`, OD$4$6@0B$i@(t &UWVS6Ke$1T$@l$dt(PtiuD鍄$ET$dD$3D$T$ D$$9$e3D [^_]ÐD$@T$@l$dD$ dT$D$$4$1T$@DŽ$$D$l$$$4 Ј$4 $:G $D$l$$:f$1 $$D$D$T$\/D$PL$PD$TyQsD$b&D$D$XD$ t$l$<$q?T$@…D$HL$HD$L1^|$HT$@:[T$DT$P t&tN/T$@,$T$3uT$DT$G$3(uċT$P,$T$3uw뫅5$D$TD$T$T$H$螤l8`iHtX$uMȃ Ѓ|$$[?Pt |$$??D$LD$L$+$tN(1|$\|$LD$L1$*(빍&D$@T$A|$HD$L|$H~l$L1mtϋT$XT$E$/uD$`JD$D$ ED$D$`$9 ~T$@D$`T$$+t <$1c.D$`$"CMT$DD$ $D$ƍD$9D$TYL$LD$H$-D$T$-D$PD$$D$D$D$l$ T$l$$9D$TD$Tt/D$TMD$ <$D$ƍD$P9D$HL$HD$LD$X$D$ T$<$D$9D$LD$HT$PuLT$DD$ $D$ƍD$8D$TpD$H1$,D$T$,$l$ $T$D$l$<$m8D$HD$H1$v,gD$$gD$@xF1D$$Y2t% t$Q&y t&D$@u] tc)D$i D$|$ D$$,bVvD$@똍VYy D$ |T$L$T$ D$|L$D$D$$d%L$D$ D$l$<$7D$LJD$H(|$P$D$ D$l$tYT$D$47D$LD$T0JD$ <$D$ƍD$6D$H<$6D$L^D$Hfft&'UWVSEDU?ñ8zXFn9NjTt}OL$;D$ȋ\$,t$0|$4l$8<Ð~:[D$F@ $n$VF\$,D$@t$0|$4l$8<$D$T$*$T$D$$ $XD$ǃpOD$$*1&t&1c$D$T$L$#T$L$:[D$$L$#L$|1ҋ6D$ D$D$$P|$D$4$(*!1cfT6$L$=D$$~$4$D$D$)1ɃO|$D$4$)1t&1ɉB\BD&D$D$ D$<$PD$<$`#4$D$D$")T$!ǃpD$󫍓f[OD‰D$OD$$(1'tHD$t$$muzA $D$ZD$e[D$$1Me3 e[^_]fdr k D$'@@@ V $D$ WD$|$$uWD$$]WTtt :JKE‹D$LWD$ $(W\tt :JKE‰D$1WD$$WXtt :JKE‹D$IWD$$G`D$^WD$ $D$lWD$$}Glt!8tD$ [D$ $U$W$D${WD$+$ $D$WD$Gxt!8tD$[D$$G|t58t0$D$dD$DщT$ $WD$$D$4$T$ D$1L$D$$9WD$$!D$4$T$ D$L$D$$D$WD$$> D$WD$ $tu E‰D$WD$W$Et$D$$)D$X $D$t$D$$D$X$D$D$'X $D$D$8XD$$t JKD‹D$MXD$$Sf[D$D$ D$D$$ $D$[XD$D$$ D$jXD$$c&;Ht u| T$XD$JK$jtȉEƉD$XD$$6EƉD$X$D$ EƉD$X $D$ EƉD$XD$$ EƉD$X$D$  EƉD$X $D$Y EƉD$YD$$- EƉD$'Y$D$ =YDD$ $t$ &;u f;Ht uSYD$T$$x D$dYD$$V  ,ut&;Ht u{YT$D$ $ ,u ;Ht uYD$T$$ D$Y$D$ D$Y $D$| D$YD$$Z tJKD‹D$YD$$(  ;Ht u| YT$D$ $ GpD$ZD$$ W^y T$ L$4$D$A3 4$tD$ff L$ D$D$$? D$A4$T$ T$ D$4$f T$ $D$D$ GhD$ZD$$ @tGtD$3ZD$$ FZD$ $x 4$D$T$ D$$t$1L$$6 OZD$$ :t$ $ t1T$$ L$D$$?mD$uƉ$\ZD$ $d`4$D$訧t$L$$LD$eZ$D$*D$yZ $D$hD$ZD$$D$ZD$$JZFD$ <$D$D$yvuڋtJKD‹D$ZD$$:蓳1t&t$ $3  -D$$ D$'@@@ d[D$$ 9l$84$@ljrT$h$vF1ҋ@D$ D$D$$褽| !E$TxzD$$&tQu͍^y D$ BT$D$T$ D$BD$L$L$$x耞Dž/$藞F@D$N[D$$I1@^T$MЍpD$ $qMЍ=MD$ $TdMЍFMD$ $7EԅPtt*u$t&tBuvE1Ue3e[^_]Ðt&ED$$`u믍&Ptu돍&D$4\D$ y D$\HD$$U4\D$ y D$ED$hH$|D$|iD$D$ D$|$4$?fEԅuvBufEԋd`|$4$uED$,$-cMЅhEZMЍ+OD$ $3MЍ1OD$ $MЍ[D$ $MЍaMD$ $MЍmMD$ $ueEԅPluBuUԋYUԋKUԋ=MЍMD$ $AMЍMD$ $$ MЍD$ $EԅufBuUԋMԋD$T$ |$4$MЍND$ $kMЍzaD$ $NuSEԅP`Au 80BuMԋcwzMЍ`D$ $8MЍQsD$ $Uԍ EuPu D$'@@@ EEԋEUB 80 "Bu MЍ[D$ $uUEԅut&BuUԋ{MЍ[D$ $uIEԅoufRBu:MЍ"&D$ $MЍND$ $wMЍ[D$D$ ${MЃMtD$] $xtEԋMЉL$Uĉ$UąuSBM1)EȉUtUσUȃER҈UuދUR녋MЍ[D$D$ $uWUЃt$D$]UUąt$D$ D$_D$E$ u$T$Uԋ%UMԃ|$4$D$T$ Tv'UWVSjlMuEԋUM̋Mue5u1UȉMąt`f } D$ D$M 1҉D$$%E:M̋UЉL$$B Eԋ tF4$UЉt$T$$EЋM Ј}ԋuЋ|% Ћ|cAL% Ћ ʩt,t\Uԋ>E@EЋpT4$pUԁUx UԋP9 |$t$$cEЋpXu 4$Uԁ”Uxa UԋP9 |$t$$EЋpd 4$x UԋBHP9t |$t$$EЋ 4$x UԋBhP9u |$t$$EЋ 4$EЋt >EЋI4$x5UԋP9^ |$t$$MЋuԋUȋ,\ }Ћ0D$p$wt0EЋduЋ}ԋUЋ KuԋEBUԋMȋuċ} Q"t$|$ D$T$UT$UԋʉD$EЉ$EOEMԋUЋuЉϋ|% Ћ|✾cAL ʋ ʋEЉ$?pk}ԋP9f t$uЉ$t$;EЉ$Uԁ„Učp}ԋP9 MЉt$$L$} UtED$$lEЋMEЋph>t}4$yUԍxB|mP9 |$t$${EЋph4$5xUԋP9||$t$$4UȋE99EЋ 4$x UԋP9 |$t$$EЋp`t >EЋpT64$~x"UԋP9 |$t$$}EЋpX4$7x UԋP9> |$t$$6EЋ4$x UԋBdP9 |$t$$EЋpl 4$x UԋB P9# |$t$$MЋuԋ}ԋlhtp΁ ,uȉ(ǨEЋuԉ0ɉ4~Huԋ8< t!ʋM!04uЋ}ԋX|%SUԋHHuԉL蹅Eԋ tD4$|Uȉt$T$$MЋu ЈE}e3=Ee[^_]Ðt&MԉEMԋD$A $}ԋD$G $|t&`M9| M| &MЉfTD$ y D$' D$4$vf=M̉4$L$.&4$UԍxO P9wt$|$$EЋUԋD$B $Mԋ1҉D$$اEЋEЅE̜3ED$t$|$D$Z;D$pD$ cD$y $t&ED$t$|$D$f;D$EЉD$D$ cD$y $'Eԋ !bUԋMԋE|$ T$ $UMD$ UMnUԋUԋMԋEԉ|$ HT$ $UMD$ UMMԋAHDUԋMԋEԉ|$ hT$ $UMD$ QUMMԋAhCUԋMԋEԉ|$ lT$ $UMD$ UMMԋAlBUԋMԋEԉ|$ T$ $UMD$ UMMԋUvUԋMԋE|$ T$ $UMD$ tUM&Uԋ |qvEЋ>4$P)č|$+T$t$<$8& !%tDJD)rUԃ@ P91 t$|$$3EЋt>>t94$Uԍx P9@ |$t$$EЋt>>t94$Uԍx P9 |$t$$MЋkuԉ0]E ,t&=MԋHH4$UԍxBDP9|$t$$ At&M̉4$L$fUԁ”UMԋD$A $uԋEEMԋD$A $muԋ&UԋBlD$B $;MԋAlUԋBHD$B $MԋAHDUԋBhD$B $MԋAhcUԋMԋEԉ|$ T$ $UMD$ UM MԋvUԋMԋEԉ|$ T$ $UMD$ UMMԋA UԋMԋEԉ|$ dT$ $UMD$ UM#MԋAd UԋMԋE|$ T$ $UMD$ Uԅ:E[vUWVSu UEúO׉eE11tf4$DžDžP)čD$'T$t$$<;n< ff ~ ;u%iu$tPyuDu21tfD$2t$$3!}t<4$x#P9\|$t$$p@t >D$D$$<$PyF9ET$|$4$%B@D$@$tt8u5Ft&$5Ɖ:$x&B8P9|$t$$艿D$D$ D$2D$D$$0kt8t8t$tt 8t$at >%/D$ED$D$ D$ED$$.Ue3e[^_]Ðt&4$0P)č|$'T$t$<$>D$;<$t8& !%tDJD)rZP9t$|$$賽%t8u#z8[T$$薹zP t-p  t&txuDD$"$t fD$bD$ y D$#<D$$^|$ 8T$ $x|D$ ¿x|u+B8<$|<$T$|$ $B8mx b$N|?2D$D$$E0t&B8D$B $`B8f|$ T$ $x|D$ xx|?vT$ @ $x|D$ t$x|Qp@[kЃ fDžf?fE}0t&t$ T$ $x|D$ Mx|t$B $裶B@D$B $~D$B $VkT$t$x $xƋp@1T$|$ $跿?JT$t$ $莿D$bD$ y D$D$<$製Qt&UWVSEl+;][D$8LE;lj=D$<a?XD$@E$D$D$$D$ $D$ofeux D$81VtD$81ɀ8ϋD$b\ Du4 $X0r1Dž 09}* DO2) Ycy D$L$t$ D$S|$$خ$\މuWU  t[f$$\yl0p1AD$#S$D$$D$YcD$ y D$3vz" })xuz"ST4$跧Dž$fDž(B"t0l*9`Xt&1Ʉ$D$|$4$Bt|$t$$;4$~K28yl9qYcy D$L$ D$T|$$x< +K2C<$4/%$8 =x@t& 0\T$Ycy T$D$ U|$$ 0\L$D$ U|$T$$輧w&5S 11u< 8z"uU x 4 0t88D$YcD$ y D$UD$$}\<$胅@D$$I4$L$ D$&$臯t&8D$D$$f!<< xP 7mDž@T0D$L$ D$t$$)/ t Z 0tlZ lt,+0B#s8.(,?04-`-t$T$艩BDt8un!ց怀tƀDQDʉ҃+q2P91t$|$$虢f+`=+o(601vcv9t&'` $<v?YcAy |$ D$TL$D$D$$B"y`1 $ƪ`4$H#Ycy ADD$A@t$ P|$DD$sSD$j\D$$B@P}pDD$D$ vSL$t$$\D$D$ xSt$L$$tyuD?$!1` $(efɍtFzuDɋ l8`D$$I6@D$$蓩螳D$B@$ٛ$s##Ycy D$D$ UL$|$g$|$D$ UL$$L$ٟ$[|$D$ UL$|$$ݴ0D$=D$]D$Ycg$M$I蓃@D$$D$y L$D$ JU|$$L$t$D$ RU|$$踞E$D5$#t$1D$ VU|$L$$詳$&U .%Xtfl YcGy D$BL$ D$S|$H$D$wD$8I| El(,04 <Ycy D$|$ D$SL$$葠 T5 Yc>y |$ 1D$ UL$D$ UL$D$]D$$^1/` $F;vl9AYcL$ y D$.UL$D$ D$$ԕ< ~ D$YcD$ y D$SD$$\D$$rl8 ` $8\!o,` $@`* $轗D$D$ D$$^` $g;u $K Ycy t$D$|$ D$D$T$D$lD$YcD$ y D$y$IT1@$D$OBxD$B $pAx$^S$_]SD$D$ x D$$],t~"\‰\lsD$T$D$@D$YcD$ y D$w$^3` D$ @$D$ |$uA@1G|D$WT$D$D$YcD$ y D$v$QD$<$8G|$D$$HxG@ $zأYcy D$L$ D$*Tt$$Jv $z]>Qt$ DT$ $D$ +tu9BDD$A $mFD $t$T$"wAD; Q$o UWVS輐Õu lEdDžx4$eU1҉hDž|DžzP)čL$_t$tT$ $ot<; <  f ~ ;uh9Yu#tquD<$赓D$ƍ|D$D$ xD$2D$4$t8xt8t$~t|t<8t7$}|t%8t t1$  x<$yplB@P9t$|$$nl`hy"E;D$ D$Ɖ$9tuPho軖 LD$$藁Ƹt(F D$ D$$ hx1D$ D$D$$Bp"dT$$xby `:[D$pe\t$D$ 6|$$蒃p lp|% |hptB"D$L$D$ D$FXD$FT4$D$lt\D$ 7L$`p|$t$$mtktpt p"Me3 te[^_]fp"Džt$tltDžpsta3@JlH$lP4&dD$$lx$uP)č|$_T$t$<$jdD$$*x$4lu4H)čt$_L$T$4$tjxt$(|$$D$e7D$ LD$eD$y D$(D$ D$D$$6l,DžtkxD$$4\ep;PD$py ft$D$je`L$ D$$ok`t$D$oe$vp0] pW\pt.P t&tAzuDp ǀ``#󥋅pupD$$跀pPtpD$ $菀`:[pe\L$D$ )7|$t$$l$nhl$p5 ` D$|$ D$.7L$$lh!_4$l|pDžtǀ\D$ H7L$r&p$D$D$r~vlllt$ @T$ $40D$ j40u7lA@h=l4$|Džt T$t$ ${mlB@t&`D$D$|$ D$6T$$kDžtBlA@D$A $HclF@'fl$ph,9…%th9tM%DЋpT$`|$ D$6D$4D$T$$jhpl $ e fpT$op|lP9s Tt$$L$dh=l4$zpǀ&hI$rJt&t$lt$l5_#J4&`dD$$q$nP)čL$_ $0T$t$cdD$$gq$nP)čt$_T$|$4$c^0t^t$,E‰D$$xL$(D$7D$ D$eD$y D$(D$ D$D$$]eS%ҍMD%th9tM%DЋpT$`t$|$ D$D$T$D$6$glh| $IwDžtYh$IDHohlI)H4&fdD$$o$lP)č|$_T$t$<$ bdD$$so$4l4H)čt$_L$T$4$axt$(|$$D$7D$ D$eD$Dl$l;GDžt`D$|$ D$6T$$@fxS%%h9%%%ll$¤L4&dD$$n$bkP)čL$_ $0T$t$j`dD$$m$kP)čt$_T$|$4$(`^0t^t$,E‰D$$xL$(D$~7D$ D$eD$hl/%th9tM%DЃ%th9tM%DpT$`t$|$ D$D$D$6T$$GddD$$lt$D$6$D$lD$eD$ y D$cDžtpT$iplP9Tt$$L$w^lp4ƒuppp`Xҋp8pfJDpIh$<@T;^D P44$JdD$ D$D$DLXEƉ$t$|it$RY4t$D$ D$T$U$D$!YzaD$<$PvFLTt@P(tqu艵T(ETTT&X&Dp | 9(t 9~+ҍB?I;| p X0u |4d|$$ZtBI|$$Nu#VNd t :t $ -d vuċ D$ikt$ t$4$Nf D$ t$<$D$JD$t$<$@@q Cdt$|$ T$D$uk $eV $D$oI  T$ %$T$%T$It$|$ D$kt$4$Mlu`*hhD$kt$ <$t$YMfWh $Dlt l9^`1PPP PPPP$N `nD$k4$|$ D$hLf4$Ct 8xDž^ dxp|$t$$L$HUdlL$t$Dx$L$Ut$@x$pVD$Lx$G b&xXt$<$TG 4$D$Jtԋpt$<$L$Llt$<$L$K$NTuDt$<$ULD$D$$btgǀ(D$$jV(t(Pt T$$9V$Su@Xt$<$L$J`T$t$<$JpL\L$t$<$Jt$<$D$Jt$<$dD$cJHiɍ;Dȅ:8t8HH8L$$T$t$D$ HD$e $D$D$ D$D$x8t&ǃ ǃ &l?M`#d ut&P$ ;u臞%$ǃd t$|$T$ 4$D$hO$5vV NL$|$ D$D$h$Otu9`cD$D$$ۅD$ hD$|$D$$ &$?`D$$zK*uŋD$ hD$T$L$ D$hT$D$D$$?xtdž '&$>D$$J:uŋD$ h|$D$|$ D$hT$D$D$$->x蜖džD$ht$|$ t$4$nDEt&aSt&t$Av@FXD$FPT$ D$hL$D$4D$$]=?f&(&D$ht$|$T$ 4$lC|$D$ht$|$ =$4$K54F ~T$ |$L$D$h$KVV|$L$ D$D$h $B_|$D$hL$ $|$G4*D$ht$ L$t$4$B?` D$D$ D$$*<$L5$>5$05$"5$5&lD$D$pk$t$ t$1:|$v9}e3=e[^_]Ít&D$D$T$t$ D$?k$t$>:| p t&jD$ jkD$t$t$4$CFD$bkt$ t$4$@f\D$ fkt$D$t$4$(Cvt 0 $Kǃ $=D$D$ $IT$ DžD$D$D$$b/$T1D$$Kp8s`ID$ %D$%D$$;D$ck$t$ D$8D$t$8cD$|D$T$t$ D$Hk$t$7| p t Tt&x$6|^1xt$<$:B4$D$(>tԋ4$L$>txt$<$L$8? 7P$D$=t<%$D$=t :[$D$=t$<$HD$D$$‰t D$$I(t(Pt T$$QI0/t4$R: @t<$2:V D$D$1t $+D$$|9D$kT$ $D$fdD$ .AWD$ kD$<$t$t$]:x|$D$ kD$T$4$2:>1҉$]mDž0Dž<DždD$`D$t$T$L$ D$lD$$0lHH8L$( $D$$HT$t$D$ D$ D$D$D$dD$&1҉谉<t `$t$T$J)x7tlD$|$$)|\lD$z\D$ y D$T$D$uh$.x$-t&sT$UT$ tt$D$hD$T$t$$L.bsT$UT$ tt$D$hD$T$t$$-sT$UT$ tt$D$hD$T$t$$-JsT$UT$ tt$D$hD$T$t$$/- sT$UT$ tt$D$hD$T$t$$,LD$<$s3bVTt@P(tqu艵T(ETTT_dD$t$D$lT$D$ $,|L$$T$t$D$ D$COIL$ $D$dT$t$D$D$ D$D$"D$D$Qk$t$ t$X+ǃ0OD$<$1F$;")\<$D$D$2`<$T$D$2hX<$D$D$2-[|D$z\D$ y D$D$h$/*|$)D$D$k$t$ t$)lt$D$D$gl$t$ t$)ǃ\&D$<$11$fD$4$11$Cht$ $+hD$4$11$D$<$k11$ZD$D$k$t$ t$(ǃ0$+D$ $0D$k$T$D$LdD$T$D$ <($:ǃlO`D$<$.uUF$n8 |D$z\D$ y D$ohD$$'c`D$<$b.uR~Dt:DžT@ Ttƒ BTuߋTDdZ`D$<$-@F$74hD$D$h$T$D$ &|$L$ D$D$h$L-_D$z\D$ y t$D$hhD$$|&b.$)D$~k$T$D$D$D$ 2&|$%t$|$ D$kt$4$,\D$<$,Nh9tODžTPTt&(z(9TuЋT(Dl)`mt$W)WphD$D$eiL$|$ D$$%9i`D$<$+ulN`9tRDžTPvTt&(z(9TuЋT(Dt`D$<$%+~D$ <$)tBF|$D$D$T$ D$miL$$ $XtnDžTPƒ BTtATt8ݍ%D$<$v*u1F$4TD}`D$<$/*uF$3t8Hh`D$<$)u"F$3 HaD$<$q#u1F$-0&F$,uHMD$<$*#u\N89DžTP‰z(9TT(ƍND$<$":#ND$<$"2ND$<$"#aD$<$j"u/F$ ,,T(D2aD$<$%"N\9DžTP‰z(9TT(ƍ D$z D$F$(u FD$FT$ D$iL$D$D$$ǃ T(DAaD$<$!F$*O D$z D$F$'u FD$F|$ D$i$D$D$D$ǃ D$z D$F$w'u FD$FT$ D$iL$D$D$$Dǃ MPaD$<$uF$)!^aD$<$uF$X)iaD$<$u(~saD$<$ru;ǃaD$<$Mu)F$($<$(xaD$<$u"F$(Oǃ(@yMD$<$uTNH9DžTP‰z(9Tt|Ttr(΍MD$<$lN!9thDžTP‰z(9Tt+Tt!(΋T(DST(D:=MD$<$uXN 9DžT(‰z(9TTt|(ʍaD$<$b5VD:trTP‰(Tr$xTt%t!$ˋT(D?$ɋ(DMύTD$&<$`(t (DTD‰$P $rw$t8t4ˍaD$<$utF$%8Qɋ D‹T$D$&t|$$ tr뼍+dD$<$+N49DžTP‰z(9TtETt;(΅t<$ T$$&(t$(JT(D9D %׉$D$&<$}t$$(DžTP ((ATt|TtrҍwLD$<$D N#9DžTP‰z(9TtSTtI(΋T D|$D$T$ $t T(D@N9DžTP‰z(9TTtz(ʍLD$<$N`(9thDžTP‰z$9Tt+Tt!$΋T(DT$D‹(D$:$;xD$<$w|$0D$D$jL$ |$$YlLD$<$uJVt:u}FD$ j$D$dD$T$D$  aD$<$F$?!ǃ$gH)č|$;L$T$<$o -TT$<$wv򍓸T$T$ T$V$T$D^T$L$.;waaD$<$uF$E %aD$<$xF$ LD$T$$t@8(uEFD$jD$D$L$ |$$ƃ!($$z$T8tGtCTǃJaD$<$ju2F$ ET%aD$<$"tbD$<$ u0D$ D$F$} OЉD0bD$<$tbD$<$u0D$ D$F$! <OЉ&bD$<$jt4bD$<$Tu0D$ D$F$xOЉHxCbD$<$tMbD$<$u0D$ D$F$iOЉXbD$<$tSgbD$<$tbD$<$F$D$D$D$ D$D$1F$vlT$ FD$FD$L$ D$Cj|$D$<D$$ !}bD$<$F$ThD$D$D$ dD$D$1F$$lD$ FD$FD$T$ D$IjL$D$<D$$L _bD$<$uF$d3bD$<$bD$<$`D$<$tbD$<$D$|$F$FD$\j$D$bD$T$D$ Y lD$ D$F$l FD$ D$F$cOЉh bD$<$bD$<$u&D$<$xt cD$<$b`PD$|$F$ t9FD$oj$D$D$T$D$ @ ǃDIpD$|$F$ $FD$lj$D$D$T$D$ D$ DžD$FD$}i$FD$FD$hjT$$D$D$D$ ?R\&D$<$N`(9DžT@‰z$9TtPTtF$΋FD$cjD$bD$L$ |$$T$D`$t<(D$D$wjL$|$ D$$$DcD$<$ #cD$<$ 1cD$<$ MD$<$e QMD$<$K MD$<$1 F$H_@D$z D$F$7FD$FT$ D$|jL$D$<D$$ǃ@ Hٻ ND$<$o F$ "驻D$ FD$dD$<$:zFD$D$FD$jT$$D$TD$D$ /D$F$4kff FD$jD$D$T$ L$$κD$F$jffFD$j$D$D$|$ D$ZfǃdD$ FD$dD$<$5FD$D$FD$jT$$D$TD$D$ ?cD$<$ uF$!0龹TcD$<$T uF$0钹_D$<$( dD$<$ D$<$ fmcD$<$  ucD$<$ | cD$<$ zcD$<$ cD$<$r UcD$<$X cD$<$> 'cD$<$$ cD$<$ aD$<$.~D$<$ǃ V$H)č|$;L$T$<$D$,<$36ƒtxulv`uIFD$j$D$dD$|$ D$<Ot $3t|$FD$jD$0D$L$$D$ K<퍃 D$F$[ FD$jD$LD$L$ |$$Zm%D$F$ PFD$j$D$ D$T$D$ mND$<$cD$<$F$+4ȵD$cD$F$q lD$FD$FT$ D$jL$D$ D$$>QcD$<$uSF$4&%D$z D$F$ i yND$<$~tFcD$<$htcD$<$RF$<錴D$ D$F$IЉ \lT$FD$FL$ D$j|$D$D$$ǃ `ND$<$ND$<$8ND$<$eND$<$K dD$<$1dD$<$ND$<$!%dD$<$~<$ ǃ8&D$<$ǃ %D$F${ ˲FD$jD$D$L$ |$$z鍲1<$ǃ8&g%D$F$JFD$j$D$D$T$D$ D$z D$<$ FD$j$D$8D$|$ D$ǃ 韱F|$D$D$T$ D$ kL$$J]ND$<$urF$ tWH,V$H)č|$;T$L$<$.HհaMD$<$k(D$<$Q~<$ c<$Džo%D$z D$F$GlL$FD$F|$ D$k$D$D$D$ǃ%%D$z D$F$Ưl|$FD$FD$kT$$D$D$D$ dǃ%dmF|$D$HD$T$ D$/kL$$+Dž OD$<$F$O LpD$z D$F$upFD$F|$ D$&k$D$D$D$YǃpFbLVMD$<$<~@6DžTPƒ BTTՋ~  ԭD$z D$F$}lL$FD$F|$ D$j$D$ D$D$JǃZSlD$F|$T$ D$kD$D$L$$ǃ YlT$FD$FL$ D$k|$D$PD$$ǃZ闬D$z D$F$@ol|$FD$FD$jT$$D$D$D$ ǃ~ xTDlD$F|$T$ D$jD$D$L$$ǃ锫 D$F$wFD$jD$LD$L$ |$$&9%D$F$\FD$j$D$ D$T$D$ ުV?VDž҉(:Ttif‰$r( (>t&t" ΋VFwN<@ ɋ$DTD$@$~TD$@$Dž (t(T D$:$Dž$t,D$:<$$t $(D$/$t  t :uAD$\D$ T$D$L$$(t(8tt8t(D$:$ ~ P$D$ D$ \TT$D$L$D$D$ 0D$HD$$ PT$_cT$TD$D$T$ $ A$YA4P9$T$ T$<t[<$ A@P9  |$$T$$tW$$xA8P9|$$$|$|($2xA<NP9|$($|$%$xADSP9|$$|$ $AX1APATTT$|$ D$D$$%A D$D$D$ TD$$AD$D$D$ TD$$|$ D$T$T%<$T$VD$T$T|$ T$<$yyD$T$$T$ TT$QD$T$T|$ T$<$?AHA4D$ Q0T$D$$A4(AH A8D$ Q0T$|$$gA8D$\D$ T$|$D$D$$AH(ADD$ (Q0T$|$$u-ADD$A0$ADT$(|$$ADgAH$A$3`D$`D$$D$eql$$T$ l$D$%D$$$D$1D$D$fqT$ l$$Tfx 1ǃt%ǃ tĜ[^_]Ív"tlj@$b l$D$D$ $6 D$$$B D$$ D$ D$D$@D$SF$ D$ D$D$D$_F$ D$ D$D$D$lF$T D$ $ D$ $ D$ $| D$@ $dD$|FD$D$ D$$D$FD$D$ D$$^D$FD$D$ D$$TD$FD$D$ D$$$@D$FD$D$ D$$ :茦D$0D$$%D$$,hvaT$ FL$$$D$D$d,$$ҋ$Fx~FT$ L$D$D$f,$a t`$ff0$kKD$D$$%h踝4$D$pD$l D$hD$`D$\ E։D$d1D$XD$LD$@1MD$4D$(cD$D$$D$TD$P D$H#D$D D$< D$8 D$0 D$,D$$D$ D$-D$ D$ D$ D$,`J:X&fk`>~vaD$sD$.TD$ tl$D$\D$D$$Cf$D$D$ql$T$ $ x $$8 v$D$D$ql$T$ $$|D$D$iql$T$ $w$:eD$D$nql$T$ $EC<\$,D$DÐbt$0|$4l$8D$ 5$:[7Zy |$t$l$T$@D$D$LD$D|$t$l$D$ 5$,\$,t$0|$4l$8<Ð&UWVS|E aUDžeE1[51ɉNj t1ɀz" $Xe譹l `1Ue3Ee[^_]Í BeT$ D$k[D$D$y t$$Yv B"z tt ?$[许l8D$eD$ y D$[D$$1D$ D$D$$(fz ɋlV BeT$ D$i[D$D$D$;<$rL<$P)čt$?T$|$4$D$;4$$ > :t:iW6 kD; $rE; Džt!8tT$|iT$$@D$;4$tD$ Pt$D$$FPeD$ "D$y D$ G[t$$`nGD$@"D$$ǀ D$<$ <G9IƋv>$9O z  1$\蕴e%&;R1$FƋ7T4$ !J&eD$ D$D$$[$ $ 1HD$BD$e[$D$$D$eD$ y D$}1D$D$$ T$ D$ g%MD$[$D$ D$eD$ y D$$Iݬ1e t&t&|ey D$ T$D$[4$8t&` $7?lDžtς1$ MDžtj8te#ft$<$l<$D$$ t&  tz ey "D$T$D$ r\t$$ii|$D$ B@D$BD$ z"uE xE;YD$ D$$4D9/4tA  /l8 ` x$x5r 4~i$'D$ 6  B@D$BD$D$Ƌ @$=$I4$1D$ 1DD$D$$KBDD$B@D$hD$ ЃLD$@D$$4|g&1$ve"et&z hl8(`t~ $vey BD$BeT$ D$[Ht$$D$wD$qvO$y_$veԬ)1)}&VXt:S[D$D$4$O$17BLD$,BHD$( D$$ D$ D$ D$\$D$D$ D$eD$ y D$$fO`} $[p`= $D$ eD$y D$[$F&fD$B<$Et&?fD$<$_t&et&eey D$ T$D$[4$]t&_]78f # |$y $g"D$eT$D$ p\t$$Sx9|iT$4$D$D$ D$D$ ο;g$T$:A;4$1D$$D$ 4D$BDD$B@D$\$D$#D$eD$ y D$ 4##D$ D$D$$%v$[\l87` f%g;D$ D$D$D$gD$4$2$[ɧBLD$$BHD$  D$ D$ D$\$D$0 D$eD$ y D$of$ Dž8Tt&# $y@ǀ ey 9tn $D$D$p fD$ V\t$D$T$$tt4!T$D$ Z\t$D$ $XtfD$T$D$ [\t$$t^ tvNv k&l: $t 82ƋQ$fl8` fD$D!D$eD$ y D$4\D$$4D$[$D$@D$eD$ y D$$r $oD$d\$D$p"D$eD$ y D$YfD$<$3?t $B|D$BDD$B@D$\$D$($D$eD$ y D$@D$ gD$$$=D$eD$ y D$\D$$W l:6`  $ D$#D$eD$ y D$\D$$@$=) y RgeL$t$D$ \|$$ 1$G3t$D$ \|$L$ $I$l8*` $B|D$\$D$$D$eD$ y D$`{T1D$BDD$B@D$\$D$h$D$eD$ y D$$5_諠agn f$=m ` $gD!D$eD$ y t$D$;\D$$O,2h1$fܟFmD$I\$D$!D$eD$ y D$Ͼ$ t38u1.R1Ѝ!t$y D$eD$ t$D$6[$+$!Jў UWVS|UF<T$,D$D$ D$D$$!Kv$g)t& ?gD$T$$蕽yD$$Gl8t`JJwt&Jv ~ t&8 P@<w&<vz B~ f8 D$ D$$=.=-=fy }.'p&D$|$ D$+Qt$$ 0'D$|$ D$9Qt$$1Ʉ8D$ T$D$$ $蚵@&=fy T$D$|$ D$ Qt$$E^D$ 4$谶tD$/4$虶tD$ D$$GD$ D$4$)D$4D$,D$(T$0D$ D$$gD$D$D$D$ |$ D$D$$虩$It&==[=D$=f&y D$|$ D$3Qt$$t&1AD$&D$A$,$=rD$$,#&=fy v&'D$G$ݩ%7$ BD$$A =LʁtD$D$D$ 1$~"<$P1ҍx)ċ|$GT$D$<$C`|$D$ $D$_BAD$P$D$&D$=fD$ y D$购$8\UD$$&$|$D$BDO'D$B$賧iA'UWVS<|$Pp5w o|D$D$ D$D$$F E@$$D$$y +`%T$l$D$ sD$(D$F T$,$"V F D$D$$N T $ɛF T$$ǀ 4VD$$T$ dT$,D$(l$D$ zT$D$F $KD$<$[|$ D$iD$$D$$QT$T1<[^_]ÐD$$f'UWVS$ú3e$1 NdFXF`@ D$y D$n$c_cL$4L$4G]T$8T$l$L$ D$-<$VtWL$4VT$0l$L$ L$8D$-<$L$T$0tu1$e3  Ĝ[^_]ËT$8hD$D$-|$T$ $:L$4T$8l$D$-L$ T$<$覰L$4T$8l$D$-L$ T$<$,g[D$D$ D$D$$F` 1Xnhy ‹F`p*e\]L$8L$ D$ .|$,$舰fu FThVETT$0]fD$nD$F`$L$8hD$ .|$D$L$F`$IS_cL$4F` &L$8D$ .|$D$L$,$}pn`D$E $萛t&VTyT҉L$$D$ .|$T$L$8D$ .|$L$FTD$F`t$GL$4E|D$ E D$T$0L$$`T$0N`E|L$,I|L$<9D$<GD$D$$L$DD$;L$$Rh T$(L$8t$LD$4vFl$\u tiuDED$\$>T$(<$T$L$$PzAL$\:L$ T$D$$vYL$0AL$HT$ @T$0D$D(D$$萧L$@l(D$D$$D$ GL$L$<$L$"3D$$D$}$D$$D$D$$Rt&T$8<$T$u4L$@'D$D$ G$L$ L$$PT$P$HD$\$LT$`$TD$pe$1T$|$׉T$LD$`f D$\fFlD$\T$`D$D$$T$ $而y D$cT$XT$$D$T*D$BhD$TD$ 2}(D$D$ D$D$$T$P e$l$D$T$D$ D$D$<$膈 !%tDJD)) H9T$|$$D$ $肤 8 E$ʄu "t&tʃEJuDʍ$D$!$ t9h,$NxF` P9|$l$$S$D$ $D$D$D$/$聐D$@$$$蓕$D$:,$lD$:$D$lJD$:$D$P(zD$:$D$h D$tT$t D$$D$dD$xt.T$tD$$D$dD$x$$tC8t>D$,T$XD$D$TL$Dl$D$UcD$ T$$ÎL$D9ʍ$L$D$\L$DqD$TT$XD$]cD$ $T$$肕fu=D$xT$TD$ acT$T$XD$$$T$їT$dLQ?$T$D$$~it:u@,$T$H胓T$HHB9L$l$$臈T4$}Lt$$ڇt$$Qt^D$d,$HF|P9L$l$$D$F $ۄT$dD$ltGD$l8t>D$l$蒒hm P9_T$ll$$T$萇l$PtGD$P8t>T$P$ChP9T$Pl$$T$AL$htGD$h8t>D$h$hP95T$hl$$T$D$\gT$`@#(D0,!ЋT$X4D$Tl$D$ cT$D$4$ZT$p1t T$p$%Nj4VT$`D$\f[tBdT$\D$ ,D$D$TL$0T$,T$`D$cD$:D$ T$(T$$T$XD$D$$T$D$TT$Xl$D$ cD$T$4$2~D$TT$XD$ c4$D$l,T$D$9諙VK$e3,[^_]Ðt&`BhT$Ty T$X7 $;!D$PD$ D$PN T$L$T$HL$D$5T$HL$Df*T$X1D$D$TD$c$T$D$ 蘉D$|T$t|D$$2D$dD$x>T$t<+D$D$TD$Gc$T$T$XD$ T$$&+T$XD$D$TL$D$[cT$D$ $V T$ $T$HL$DD$ l$T$HL$DeV T$ $T$HL$DD$ l$T$HL$DV T$ $T$HL$DD$ l$zT$HL$D[D$PT$T$HL$$藉T$HV F`T$ $T$HL$DD$ |$T$HL$DLF`-D$tF|D$ D$tV L$T$T$HL$D$T$HL$DF|8$$$1D$lD$PD$dD$hD$xD$F $~D$F $~F`eD$dD$ D$dV L$T$T$HL$D$T$HL$DD$F $K~T$dF|MD$|l:<`D$1D$4$D$TT$XD$ qc4$D$hT$D$-5bD$T1T$XD$cD$D$sD$.TD$ tT$D$$蜅dž8 D$D$4$ZD$XT$TD$ c4$D$hT$D$4+T$TD$D$XD$c$T$ D$"T$|*T4$tt$$Vt$$͗T$F $|D$dT4$#t\t$$~t$$a|$T$ $F`D$D$4$e $!+T$XD$D$TD$oc$T$D$ ڃT$T$tL$L$D$]L$DF|D$F $t{0D$F $L{WD$F $${h1dT$$跍T$`T$ƋD$\$衍t$D$b$D$ *D$BhD$ y D$ǂD$|:2T$T$dL$L$D$@L$D‰l$T$ $l$T$ $l$T$ $у *T$T1D$D$Xl$D$ cT$ D$$T$|*UD$dD$xUW1VS\ T$<$p ) e$L 1T$TzD$<? T$<YT$LT$y T$HT$L-T$D$ 0$Ɖ舫FxD$F $xD$DD$XFxlD$PEL8x|$$ D$EPK%|$D$ D$D$D$$wFxt 8ELt8uF\D$EP$ D$ D$D$D$D$T$@$1wFP|$Dt8uELt8uEXvD$$ hD$D$ PD$D$P<$v !%tDJD) H9T$|$$Sz@T$D蔁3D$D@D$l<$YiD$ iD$$ T$D$ PD$D$P$u\$%D$lТHT$l1+$ $D$l%訢D$@9$D$l蒢F%$D$l}$ $D$l%dt$%D$lCT$<T$iD$ D$$D$JT$8?fFXD$FPT$|$ D$0D$/D$l$$^dž \$Ly$Pe$<1D$8l$$`$Xl$uL T$8$$<e3%$L$P$T$X\Ð!Nj` 1tBXD$NGD$ 1D$ XD$y $m[&UNj`TD$ y D$' D$,$cf |$,$a&l4$D$ diD$qiD$ڭt&TD$ y $T$(D$' D$bcT$(f|$$a@t& =RXD$(D$GGT$0T$ XT$y $lD$(|$,$3^|$$^ffUWVSl vJFXXT$džl[^_]Ðt&l[^_]Ðt&u䃸lS $$tl% }t$D$L$D$t2D$XD$ y D$X]&FXy T$@D$FPD$LT$$D$1D$XD${D$ D$$i D$BXD$BPy D$MT$@T$D$ 3D$XD${GD$L$D$6D$[XD$ y D$:tD$$:pFD$ D$D$<$ҋ> 9 u$t$Tl0)` $=nGD$UO$D$HD$ ;D$VD$ y D$I9w k+kD$ D$D$<$=T$L$$T:Gx4$D:D$ED$ D$t$D$4$0tj[  t u X k @ sL$ <$T$T$Q7lt.D$D$$%[t$D$GO$D$8D$VD$ y D$6jD$ D$D$<$ vD$G $i.GxED$ D$<$D$*d11[D$@7D$[XD$ y D$D$L$5 ǀ<u-jD$ D$D$<$`D$ T$D$$@YD$6D$[XD$ y D$LD$$K5u-sjD$ D$D$<$| ǀ<`D$ T$D$$5@ǀ<l8*` $8ijD$[XD$ y D$LD$$_42t 8tD$$VjD$ D$D$<$6D$ 7D$[XD$ y D$LD$$2u-FD$ D$D$<$Ń ǀ<`D$ T$D$$~=GxD$ W L$T$$10 Gxl`z`FD$ D$D$<$‚.$  $u$t$~B tD$$r0]kD$ D$D$<$迁+ GED$ D$N$HD$9D$VD$ y D$/ LJl t ]3]D&D$ Mt$L$\L$ D$MD$D$t$$.vGxD$G $&Gx8 t҃‘Plt.D$D$$1%8RD$@J$D$7D$qXD$ y D$.u- 8D$ D$D$<$Co !X t ,TD$<$5t$D$N$D$9D$VD$ y D$%-t  D$$,^ {t7Z$@3u$t$D$G $ $Gx? $0pGD$N$D$HD$9D$VD$ y D$+l)`l $/VAkD$VD$ y D$$OD$$L+LJltGt@ ftQuޅE@L$<$T$7D$[XD$ y D$LD$$*_dcEz" 2Ty D$$ *9D$VD$ y t$D$]ND$$)ED$ D$D$<${  l)`O $y-9:D$VD$ y D$+OD$$/) $|#TD$$m1D$eOL$T$D$\;D$ VD$y $ 9z"(<$ND$VD$ y D$`OD$$d(& 0[T$L$$)GxD$D$ $k7k @dD$@:D$VD$ y L$T$D$OD$$c'6u$t$ $FD$ D$D$<$Axu$t$Xu$t$7j]FD$ D$D$<$w+u$t$ }9t lD$$%4$ZL$D$4$Pt$L$$,4$&@$JD$$$$kD$9D$VD$ y D$ND$$$lt.D$D$$?o%vHt$D$MN$D$8D$VD$ y D$L$jD$ D$D$<$yu $_TD$$P,D$NL$T$D$:D$ VD$y $39X=[[(t&u-kD$ D$D$<$tl8*` $'D9D$VD$ y D$vND$$"9FD$QN$T$D$HD$8D$VD$ y D$i"4jD$ D$D$<$s8 tEBlt.D$D$ $w%ED$I$D$D8D$VD$ y D$![ $2$$$ u$t$詻u$t$舻$Nu$t$M u u +kG Q߉|$ D$G@D$GD$Ћ#v WdaKuD$D$4$=Ћ@$$R$؍u$t$7ju$t$I$u$t$TP *D$o$:D$VD$ y D$-OD$$$-Wn<$`KD$VD$ y D$ND$$v$;UWVS8çLT$l$`$d$he-$<1D$p$$$DŽ$ D$|D$pK@$D$l@T$l$r$%$ $D$ll7 L$dl$t>%ŋD$lf@L$dD$xD$tt|7 uwD$xD$]$D$;D$VD$ y D$%D$pD$t#$<e3D$t.L[^_]Åt9tx}n$ $ D$|kT$ D$ $)L$t;D$VD$ y D$]L$D$$b8t&D$|Ƌ`cTy D$ D$' l$<$1"f:t$<$1ɅL$|t&kD$ D$D$D$p$lD$pT$l$T$tT$lL$t$T$lBt D <wf<vD$l%<>t<8t7$T$phB<tP9Zl$|$$T$lB$l$tT$p| lB9s`BT$p`$ 9l$p9l$lMtuvl9*` $Z"D$t$ D$$ m|$ D$4$"$ WD$l$ k $6t 8 |$p\1 ;$ $ l27`D$t0 $=\D$$ D$M]$D$0]D$$T$l$ $T$pB<T$lD$p5D$pST$pt t$pFD$p@D$p}u  t D$p1D$pT$pD$Pd$T$L$p$D$p+ x1v;V u~uFx] |$t$G>D$E$'u͋l|$t90$F#4$} D$pH$D$pRT$lD$p$=D$tT$lz T$lz"D$pD$t$ $T$lt$D$D$p $'SD$tD$lH@4T$lt 8OD$p$Kuvl$x!ကtDȍBDɃ)zF9JL$x4$|$L$t$p 09 t#P1$a t$p ǀ8T$lz"1L$p$$ $,‰$$ t"l>`t"l9`V$D$$uD$py T$ld|@$=l,L$p 4tW$ȋ$$$|$t"l9`\$$D$$mD$pgL$xL$D$ Wt$l$$#$JlL$|L$D$ Wt$l$$|$p 8O$tF$t;l?i`<Ad$D$lD$ML$xD$pD$ Wt$L$l$$$$@d$D$lD$T$p PD$-pD$$$lD$$|$$lD$$|$$D$p @t'D$lD$$$`D$p с0000D$$mD$ nD$$ nT$L$D$D$ D$D$<$$tl|$D$$D$p 4u!m$$D$pD$$T$p |D$$ L$p D$ D$D$$$}D$p l|9O `% $=D$8mD$D$p$RT$p $ǀ<Q=$D$pD$D$pD$t|$D$$6T$l$ $T$pBxT$l$ t$xD$$xǔD$p$<$ 1|$tDŽ$<$` !%tl$p|$tDJD|$+T$x$H$T$l$=lD$tmD$ VD$y D$]$OT$lD$p$=lD$tT$lD$pza$ D$p$D$px'hmD$ y VD$D$Y,$PD$p$\~uT$l$=gD$t/D$p!JKBD$p@ǀT$D$ D$$|ƋD$l't$T$lD$p$B7D$tD$pixA-vD$pD$$ezl9`{T$lD$p$kT$lD$tz"6$=D$ >D$D$p$ND$pH>D$pk't&D$p$p=D$tD$p>$=D$>D$D$p$ NT$lD$tz l)`j $wT?D$dD$ D$3WD$p$!l$=D$\?D$D$p$lMT$lD$tz l))` $|?D$dD$ D$9WJ fT$lD$p$G8$=D$>D$D$p$LD$t@vP1$Wl$p ǀ8l90` $ PD$d?y D$t$ D$NWl$$Jt&8l?*` $fl$pd y t$ D$SWl$PD$ @D$$ ǂD$ D$D$$xT$lD$p$LmD$tT$lD$p$=_l91`D$tm $zWCD$dD$ D$LXL$pAD$<$D$CD$(eD$ y D$T$l$=l $nt$pFD$W$D$=D$dD$ y D$,$ lK$=D$x>D$D$p$ID$tS|$p $k$=D$H>ʚ`y tITD$ D$' l$4$f|$4$D$ D$ (eT$D$D$<,$|$pl$pD$pt$ DD$ |$,$ |$pGD5|$tt$pD$F $FDl$p$Ygfff$<D$ D$D$4$))ȃD$kD$T$lk$$T$T$pDc?$4$D$p$D$$D$tXt$pl$pD$p|$ DD$ t$,$D$ppDvT$pt$B $L$pAD g $$ҍtJd$^k|$py pd 4gkt$dL$t$ DЍP@T$D$D$zWl$$b$v $X$Bddy t$ D$WD$@D$l$$N $v4$Bdt$ D$Wl$D$lD$$$$j $D$p mk4t$ D$4Xl$ҍvkD‰D$CD$$>t $$|$4L$8L$0L$p@dD$,AD$(D$$Bdt$D$Xl$D$ BD$$ D$ x=D$D$$l? ` |$pL&L$xD$ Xt$l$L$<$CL$xD$ !Xt$l$L$<$L$|$D$ Xt$L$l$$u|$p 4ɉDʃ4$L$ D$$T$D$$L$|$t$D$ &XL$l$$$m$D$ 8t ǀ<t$pt ǀ $=D$!mD$D$p$CD$p|D$Q$D$@D$bD$ y D$T$lD$p$D$l%9ƋD$l$ L$ l$t$D$<$D$4DD$(eD$ y D$VT$lD$p$mD$pD$$XD$t$lT$L$L$xD$ Wt$l$L$<$T$l${< |ǀ<$=D$XlD$<$A $$L$4L$0@dD$,GD$(D$$Bdt$D$Wl$D$ pAD$$ D$ x=D$D$$$t"l?`$D$p$L$`|$`l t$`$$GdƼ$dt$,D$4ulD$0D$(Ol$$$D$ L$$L$`D$|$ApT$hD$ D$D$D$$PT$hl$D$|Bd$$D$(Ol$$D$4lt$,$D$0D$ t$$D$t$BpD$ D$D$D$$T$h|$|D$x5|$|tD$|ǀ *$Q|$xtD$xǀ *$4G$$D$pD$Sl$p 4[t#l9O`(ǀ<$=D$@D$D$p$>T$lD$p$LKDD$tl&諁T$p ,$t$|$l$pED&FD$tX$D$|wD$dD$ y D$ $$@dD$$@dt$ D$Wl$D$BD$$ $vA@D$dD$ y D$D$W$W|$p t$p u|$`D$|L$`8<8<|$`@D@DL$T$h$t$`D$|T$hlltS$PT$\vt($$J$uԋT$\D$t$`t$`D$|tTP$ t,$P$$$ uЋ$E$t$`L$`t$|<D$x8<D8@D@$$?$1փ|$x@9P|$x$t$dT$h$|$l!T$h!<$׉$bt&W$D$ Ot$$L$T$hl$V$$T$hD$ Ot$L$l$$c$D$ Ot$l$T$<$`xD$xT$$T$h$T$h|$D$ Ot$$l$T$hD$xlltTP$t&t,$P$$$ uЋ$E$D$xtQP$ ft,$$$H$ uЋ$E$L$x $FD$P$T$l@3D$|$$D$xL$HGlD$ kD$$ D$Pt$l$D$|$ D$$P0,<$[ $D$p vk4mkt$ E‰D$`CD$D$Xl$$.|$p $ǀ<TB$D$pD$4D$p|$=D$BD$D$p$)8$D$$BD$t $ Ady D$t$ D$Wl$$\V|$4$gt$|$,$ƋD$ppDp L$x`D$xT$ht$ $L$dD$ |$0T$hL$dn $t$|$`L$xT$hHldlL$xlD$A`T$h$Vt$xT$hd(sD$.TD$ tl$D$ Pt$D$D$$lD$t$ D$Ol$$vUWVS,W0m4$0 <94 0 dž<t|D$@l$D$t$&ul~eGn8D$^$D‰D$DD$VD$ y D$ SvLJ4 u,[^_]Ë`% $mfUWVSN'lLt$`D$8D$<D$$ gt8D$(Vy T$,D$(D$ !^|$l$D$4$T$,D$ %^|$l$T$$|$$uE0 D$(D$ 8^|$T$ D$l$4$kT$ tNL[^_]ÍD$(D$ *^|$l$D$4$0$l$$'낍&|$D$ :^l$4$D$辑L1[^_]Ít&D$<$T$8~dž`tT$BT$DxGD$|$ D$ T$$`\ $}@`- $NB`D$4 $`D$4 $fWl:*`~ $gnD$UD$ y D$~ D$$T0Ƌl8*` $1FD$UD$ y t$D$z D$$`D$4 $1D$w&Pe$1$t$8$ $öJ$󫋄$$$x|$D$ D$%l$$胺;Ƅ%D$ $o@@$\:l$ $\D$D$,$'$\@D$@$h$dr_\D$ y D$DŽ$pD$^$Xff$lS$`uoЋ$e3&$ $$$Í& otT$,$D$x^$D$nD$_\D$ y D$tT$,[vXtD$:TD$sD$.TD$ tD$D$D$$GD$_\D$ y D$t^D$$޿T $ÐU?WVSe$1$$G$DŽ$o g $u$tBiuD鍔$ED$@$t$t ǃtxua$PiD$jD$ D$bT$4iD$$贾$e3 ļ[^_]ÍD$hD$ $D$D$D$?$豾D$dD$lt8uD$hD$hD$lT$HD$T$ D$D$/$hD$DD$Pt 8+D$HD$HD$PD$Lt 8D$XD$ D$PD$D$D$:$D$D$D$~<$D$T$D$ ׽D$D$D$/$$D$ $$螽D$D$D$:$$D$ $$eD$D$D$@$D$tD$ D$X$2D$D$D$:D$p$D$ D$`$D$|l$D$4tD$$"D$4$D$<tD$$"D$<$|$HD$8tP D$D$<$zD$8t*D$D$<$TD$8D$4u1|$8D$4$8;D[|$|$$$D$(DT$(hdFdH9Ul$T$$ED$t8f[D‰|$|$$m$D$(T$(hFPH9l$T$$ڵ$8f[D‰|$|$$$D$(kT$(hFXH9l$T$$l$8f[D‰|$|$$$D$(T$(hmFTH96l$T$$D$\8f[D‰|$|$$&$D$(蒿T$(hF\H9l$T$$蓴D$h'8f[D‰|$|$$S$D$('T$(h7FhH9l$T$$(D$x8f[D‰|$|$$P$D$(輾T$(hFLH9l$T$$轳D$4T$8dždžFxD$FPdFLD$F0$FLYFhD$F0$FhE/F L|$D|$P\$1t?u)9¿tcUe3e[^_]Í<$UЉM蒥ƃ)t$@|$D$4$虚U1M9uf1uȋ8! t€D׍xD҃)ȉuԋUԋ:Uԍ! t€D׋}ԍ}ȋ}D}҃)}Կ;E f1 $D$&MnM̅tL$4$賭t2tsD$&<$;tljL$4$聭uοv4$HP)čL$T$ $M̉t$SM1@1Q2UW1VS\谹É&eE1t >e:\$U诣UH)čt$L$T$4$躘uED$;<$(Et Eȍ[m}EEEEUFEMȅED$;$転tUȉEȉUЋUD$=$蕢f[U̅tẺEẺE̋}1UT$UЉ$藣gUЍamD$$zMEJU1UD$;$t[muUԍamUЍ7PU̍mUȐt&D$=4$谡tUԉ4$T$ڢ E>UЉ4$T$¢ E&Ủ4$T$誢 EUȉ4$T$蒢 ED$;<$1t^1tOUe3e[^_]É4$U5H)č|$L$t$<$C1ɋU>EEvU !%tDJD+UB)ԋU|$D$T$<$ǕD$;<$Gt vD$=<$(f[Uԅt EԋUЉ|$$Ct/t#D$;4$t룍v1hUԉT$Ủ$ugGUЍ7PD$$۠utQE&UЍmD$$諠t Ez11*#EEEE-t&UWVS|U M!}UUM̋MẺUЋUMȋM UU$Me M1ɅUt U̍f[EЅt MЍf[uȅt Uȍf[Mąt Mčf[Ut Uf[E?EM ${H)ĉL$MT$+$UL$胓UD$,$Ut:l`UmD$oD$ ym|$T$D$SD$$EEȉt'D$@f[<$utxMȉ9EЅt#D$:4$MUE̅tỦ2D$?<$>pEątMĉ1D$;4$ED$<$äD$;<$EMȉMԅt EԋuUf[MEBBB BH6BMĉEt&MЋUE EċEEԋUD$=$AM̅EЋUD$;$MȉMt EuԹ VLtuԹ7PukMЋUEJEm&U9UCUUEtEUUe3Ee[^_]ÐUEUQuԹmu>MЋUEJEfuԹ}uMEMvUtUu*MԀytu!yluyuMЋUEJ EuԹ[muMЋUEJEhf}luBUԀzru9zu3U2nt[oUЀzfuSzfuMzuGt&U̅tUЀ:lu9zru3zu-t&UЅB=@;zotUEBE}ԉ׍<$HMԉ|$ $D$EҞUt3t'D$,4$יt>tf}}׀8EzWt&MЍf[>`E $kEĉ}RUčf[BD$4$E*0UЀz''VSDD$<$肕l$DtL$D9|$H1hL$H,[^_]ÅD뭍&\$$Dt$t$(,É'UWV2S$L%$D$,$D$(e$|1$JljD$$1tft$(D$<D$@D$DL$, :D$(t$JD$,t0t$J tiuDE$JT$D$24$4$T$@T$T$DT$ T$t0D$"4$ot@D$$&8tV4$D$@?PDօtD$,$t f1\$,t$0|$4l$8<Í뭍UWVSl$蟥x>*$8-$B2D$@T$LvT$XT$4$D$HUD$\T$LD$ D$@4$T$,D$D$@D$D$@D$D$@ D$D$@D$ D$@D$yD$@f[T$DP4P0t&D$\D$=$贎txPl$\$D$;T$<蒎T$l9`1huԉt& qMԉD$ $訍u܉1ɋuԍ` Űlx:`E}ty}ts4$;Mȉ $E-MT9UvQ$})Et&tQuEEfEԅuQmD$D$4$M Hl:`EЅt u Me3 E e[^_]Ðt&uE ${DmD$pD$ ymt$D$]D$$, &l9*`J $3oD$pD$ ymt$D$D$$资 $貈mD$pD$ ymt$D$eD$$c}BUMD$T$ $ʋ#U,U $#RnD$pD$ ymt$D$D$$ԃ $ч nD$pD$ ym|$D$MD$$肃ETt&t&'UX}} ]eE1Ȟá uuu)Ue3F]u}]Ðt&tӉ4$輈P)čD$T$t$$E}<$菈P)čt$T$|$4$}Uԉ$4$ED$:$tD$:4$UUEt EЋEԉt$U$yUEԀ8suԹ28Ҿ:EЅEЀ8$D$@UDUEԋED$@UMĉ$UMąTEHEȄI}Eʉ $D$;}ME}迆MąEt ED$;<$M虆MąEt EЋuԉȅt EԀ8DD$?$MaMąEt E̋UЉt EЀ8DD$?$M)MąEt Eȉ-TUȋE%AUЋE"/vxi'xpx6t&E}}}EЉ$MĉD$wMąE't& t&'t$t$ \$3 t$y4$y\$t$Ít&UWVSLt$`D$$֒?ym0p4$+>0pD$8ymGtD$,4$wtml$8t$8D$,$F}GtuNloD$0pD$ ymD$ D$$~<$1L[^_]fvGD$8u t&vD$8mD$(D$,$|ƉGtu.oD$0pD$ ymD$ [<vwD$]4$`t x:ZD$:4$BtT$<D$ T$$G16D$,D$(,$D${D$,4$D$tt*P@<wt&<vW뮍mD$4$VtP@<w <vW ksT$oymT$ 0ptD$D$$D$l$D$T$$|D$$GD$8DoT$l$ D$mD$4$sp@<w <vD$$T$,D$|$rT$,D$l$$\u\l~p<$~|$D$e$D$qD$rD$ qD$xT$\e3<\$lt$p|$tl$x|Í&`tÍ ${|k뫐D$`pD$rD$ qD$D$D$Z$"x4$1Hr]vqD$rD$sD$rD$ tD$8D$D$$wt&4$1qD$rD$ qD$D$`$vw4$1q fUWVSܒõ\U EM$eE1|0q}$|P)ĉT$t$/4$T$qD$:4$=|o]D$ $ |ED$ ${kt=D$ ${t)ƃtD$ 4${t(qDždqD$;4$@{t D$:4${t+t#$D$;ztCr$D$|zD$|$ztrD$ qD$D$T$$T$tpD$rD$ qD$D$$tЋUe3e[^_]Ít& rDžSDžDžqD$rD$ D$T$/&1뻍t&pD$rt$D$ D$qD$$s"%rD$rD$ D$L$@ED$T$$l51׹4󫉕UmtD$L$$RjDž<$P $P$1ҋ $ D$܅["L$D$ D$L$$L$arL$ L$iev<$PI&ED$D$$UƋ$D$D$a|$ $WxtpD$rD$ qD$D$$!qlD$pD$rD$ qD$D$ D$$pND$$wl3`Dž $tJrD$rD$ qD$D$$CpDžqD$rD$ qD$D$$pDžCsD$rqrD$ tD$t$D$|$D$$o %s Null Session-Expires header %30dSession-Expires: %d refresher=uacRefresher: UAC uasRefresher: UAS Invalid refresher value %s Null Min-SE header Received Min-SE: %d SDP syntax error in o= line %30llddis%zd %s%08lx%08lx%08lx%08lxOUTGOINGINCOMINGsip_pvt_ptrsip_pvt_ptr->owner&(&domain_list)->lockOnOffSetting NAT on RTP to %s Setting NAT on VRTP to %s Setting NAT on UDPTL to %s Setting NAT on TRTP to %s SIPNoop%a, %d %b %Y %T GMTDateSIP_CODEC_OUTBOUNDSIP_CODEC_INBOUNDSIP_CODECt38pt_udptlfecredundancynonemaxdatagram=t38pt_usertpsourcesipregssippeerslastmsuseragentregserverregsecondsipaddrfullcontactSIP/RegistrySIP/PeerMethodschandefaultSIP mbox event,sip show channelstatsLostSend: PackRecv: PackDurationCall IDPeer%d active SIP channel%s subscriptionExpiryLast MessageFormatUser/ANRMailboxLast stateExtensionUser%d active SIP %s%s retrans_pkt__sip_autodestructexpire_registerauto_congestsip_reg_timeoutsip_poke_peer_ssip_poke_noanswersip_reregistersip_reinvite_retrysip show schedContent type is not PIDF presencetupleUnable to validate tuple application/pidf+xmlFailedUnknownActionIDstartRegistrations will follow&(®l)->_lock&(iterator)->_lockActionID: %s SIPADDHEADER__SIPADDHEADER%.2dSIP Header added "%s" as %s Empty address P-Asserted-Identitysip:PrivacySIP/%sPICKUPMARKPickupAbout to call Pickup(%s) T38FaxMaxBuffer:%30uMaxBufferSize:%d T38MaxBitRate:%30uT38FaxMaxRate:%30uT38MaxBitRate: %d T38FaxVersion:%30uFaxVersion: %u T38FaxMaxDatagram:%30uT38MaxDatagram:%30uFaxMaxDatagram: %u T38FaxFillBitRemovalT38FaxFillBitRemoval:%30uFillBitRemoval: %d FillBitRemoval T38FaxTranscodingMMRT38FaxTranscodingMMR:%30uTranscoding MMR: %d Transcoding MMR T38FaxTranscodingJBIGT38FaxTranscodingJBIG:%30uTranscoding JBIG: %d Transcoding JBIG T38FaxRateManagement:%255sRateManagement: %s localTCFtransferredTCFT38FaxUdpEC:%255sUDP EC: %s t38UDPRedundancyt38UDPFECUNREACHABLEUNKNOWNUnmonitoredLAGGED (%d ms)OK (%d ms)Allow;methods=Supportedreplaces, timerreplacesMax-ForwardstlssendonlyinactivesendrecvNeedDestroyOBproxy%-15s Using peer obproxy %s%-15s Using global obproxy %sPeerStatussip prune realtime [peer|all]likepi%d peers pruned. No peers found to prune. Peer '%s' pruned. Peer '%s' not found. WWW-AuthenticateProxy-AuthenticateProxy-Authorization-- wrong response code %d Invaliderror executing time(): %s &(reg)->_lock&monlockCannot kill myself do_monitorsip reload&sip_reload_lockZero length domain. Added local SIP domain '%s' outgoingincomingfup%-15s %sUnholda=rtpmap:%d %s/%d a=fmtp:%d annexb=no a=fmtp:%d annexa=no a=fmtp:%d mode=%d a=fmtp:%d bitrate=32000 a=fmtp:%d bitrate=48000 a=fmtp:%d bitrate=64000 insecuretrustrpidsendrpidpairpid_updaterpid_immediateg726nonstandarduseclientcodedtmfmoderfc2833shortinfoautonoforce_rportyescomediadirectmediacanreinvitenonatprogressinbandneverpromiscredirvideosupportalwaystextsupportallowoverlapallowsubscribeignoresdpversionfaxdetectt38rfc2833compensatebuggymwicngAuth config :: %s SIP Network Change sip set history {on|off}offYesNosip show mwiSubscribedUsernameHost&(&submwil)->_locksip show objects-= Registry objects: %d =- -= Dialog objects: N/Asip show inuseLimitIn use* Peer name%-25.25s %-15.15s %-15.15s %d/%d/%d[Automatic][Configured](default)sip show domainsSet byOur local SIP domains:%-40.40s %-20.20s %-16.16s sip show usersForcerPortDef.ContextAccountcodeSecretReg.TimeRefreshdnsmgr%a, %d %b %Y %T%d SIP registrations. sip show registryEnDisRemote-Party-IDprivacy=screen=fullcrypto:%c -> %02X Oooh, format changed to %s Fax CNG detected on %s * Detected inband DTMF '%c' astfaxFAXEXTEN_sip._udpUnable to locate host '%s' openclosed BSCall-Infogenericas%08lxHuh? Not a SIP header (%s)? Ready--terminatedconfirmedearlyOn the phoneawayOn holdNot onlineofflineonthephone %s callersip:%s@%s%s ;tag=AuthRespauth%s:%s:%08x:%s:%s:%s, opaque="%s"realm=nonce=opaque=qop=domain=missing Digest. Digest callingcalled"%s" "%s" ;party=%s;privacy=%s;screen=%sunknownDiversion"%s" ;reason=%s(d)(None)peeriprecvipuripeernamet38passthroughRealtimeCached RT A N D (Unspecified)-none-ForcerportDynName/usernamesip show peersshowPeer status list will follow-- No RTP active%02d:%02d:%02dClientServersip show tcpTransportAddress%-47.47s %9.9s %6.6s %-47.47s %-9.9s %-6.6s OutgoingIncomingstrictActiveInactiveAcceptcur * Subscription (type: %s) * SIP Call Call-ID: %s Owner channel ID: %s Our Codec Capability: %s Format: %s T.38 support %s Video support %s Theoretical Address: %s Received Address: %s SIP Transfer mode: %s Force rport: %s Our Tag: %s Their Tag: %s SIP User agent: %s Need Destroy: %s Last Message: %s Promiscuous Redir: %s Route: %s DTMF Mode: %s SIP Options: %s (none) Session-Timer: %s S-Timer Interval: %d S-Timer Refresher: %s S-Timer Expirys: %d S-Timer Sched Id: %d S-Timer Peer Sts: %s S-Timer Cached Min-SE: %d S-Timer Cached SE: %d S-Timer Cached Ref: %s S-Timer Cached Mode: %s Username: %s Peername: %s Original uri: %s Caller-ID: %s ;rportUDPTL T.38 data;user=phoneanonymous.invalidAnonymous0123456789Init: %s"%s" ;tag=%s"%s" ;tag=%s%s@%s%s%s%s<%s%s>;tag=%s<%s>;%sViaFromCall-IDCSeqUser-AgentTLS,UDPTLS,TCPTLS,TCP,UDPallowtransfervaluetransportsfriendmailboxesamaflagssipoptionscallingprescodecs(not set)Disabled, no localnet listEnabled using externhostEnabled using externaddrLocalnet:(Disabled) (Ignoring context)(forced)NeverEnabledsip show settings Global Settings: UDP Bindaddress: %s ** Additional Info: TCP SIP Bindaddress: %s TLS SIP Bindaddress: %s Videosupport: %s Textsupport: %s Ignore SDP sess. ver.: %s AutoCreate Peer: %s Match Auth Username: %s Allow unknown access: %s Allow subscriptions: %s Allow overlap dialing: %s Allow promsic. redir: %s Enable call counters: %s SIP domain support: %s Realm. auth: %s Our auth realm %s Use domains as realms: %s Call to non-local dom.: %s URI user is phone no: %s Always auth rejects: %s Direct RTP setup: %s User Agent: %s SDP Session Name: %s SDP Owner Name: %s Reg. context: %s Regexten on Qualify: %s Caller ID: %s From: Domain: %s Record SIP history: %s Call Events: %s Auth. Failure Events: %s T.38 support: %s T.38 EC mode: %s T.38 MaxDtgrm: %d Q.850 Reason header: %s Network QoS Settings: --------------------------- IP ToS SIP: %s IP ToS RTP audio: %s IP ToS RTP video: %s IP ToS RTP text: %s 802.1p CoS SIP: %d 802.1p CoS RTP audio: %d 802.1p CoS RTP video: %d 802.1p CoS RTP text: %d Jitterbuffer enabled: %s Jitterbuffer forced: %s Jitterbuffer impl: %s Jitterbuffer log: %s Network Settings: SIP address remapping: %s Externhost: %s Externrefresh: %d %-24s%s/%s Global Signalling Settings: Codecs: Codec Order: Relax DTMF: %s RFC2833 Compensation: %s Symmetric RTP: %s Compact SIP headers: %s MWI NOTIFY mime type: %s DNS SRV lookup: %s Pedantic SIP support: %s Outbound reg. attempts: %d Notify ringing state: %s Notify hold state: %s Auto-Framing: %s Session Timers: %s Session Refresher: %s Timer T1: %d Timer T1 minimum: %d Timer B: %d No premature media: %s Max forwards: %d Default Settings: Allowed transports: %s Outbound transport: %s Context: %s DTMF: %s Qualify: %d Use ClientCode: %s Progress inband: %s Language: %s MOH Interpret: %s MOH Suggest: %s Voice Mail Extension: %s Realtime SIP Settings: Realtime Peers: %s Realtime Regs: %s Cache Friends: %s Update: %s Ignore Reg. Expire: %s Save sys. name: %s ---- SIP RTP<SIP/2.0 %s %s;received=%s;rport=%d%s%s%s;received=%s%s%sRecord-Route100%s;tag=%s%d;refresher=%sSession-Expires%s%s%s;expires=%d485error processing via header Access-URLsip:,sips:sipsIN %3s %256saudio %30u/%30u RTP/AVP %naudio %30u RTP/AVP %nvideo %30u/%30u RTP/AVP %nvideo %30u RTP/AVP %nUnknown protocol '%s'. IN %3s %255ssip_tcp_worker_fnUnable to launch '%s'.&tcptls_session->lockIP6IP4a=recvonly a=inactive a=sendrecv TrueFalseSAVPWe think we can do text o=%s %d %d IN %s %s c=IN %s %s ** Our prefcodec: %s Audio is at %s m=video %d RTP/%sb=CT:%d Video is at %s Lets set up the text sdp m=text %d RTP/%sText is at %s m=audio %d RTP/%sa=fmtp:%d %d/%d/%d a=fmtp:%d 0-16 a=silenceSupp:off - - - - a=ptime:%d T.38 UDPTL is at %s port %d m=image %d udptl t38 a=T38FaxVersion:%d a=T38MaxBitRate:%d a=T38FaxFillBitRemoval a=T38FaxTranscodingMMR a=T38FaxTranscodingJBIG a=T38FaxMaxDatagram:%u a=T38FaxUdpEC:t38UDPFEC v=0 t=0 0 m=audio 0 RTP/AVP %s m=video 0 RTP/AVP %s m=text 0 RTP/AVP %s m=image 0 udptl t38 Tx: %smaddr=RequireMin-SE;lrptimertpmap: %30u %127[^/]/%30ufmtp: %30u %63sbitrate=%30uT140fmtp:%d H26MP4OK.UNSUPPORTED.imageaudio %30u RTP/%4s %nError in codec string '%s' Found RTP audio format %d video %30u/%30u RTP/%4s %nvideo %30u RTP/%4s %nFound RTP video format %d text %30u/%30u RTP/AVP %ntext %30u RTP/AVP %nFound RTP text format %d image %30u udptl t38%nimage %30u UDPTL t38%nPeer audio RTP is at port %s Peer doesn't provide audio Peer video RTP is at port %s Peer doesn't provide video Peer T.140 RTP is at port %s Peer doesn't provide T.140 p->owner%30u%naudio %30u/%30u RTP/%4s %nreason=user-busyno-answerunconditionaltime-of-daydo-not-disturbdeflectionfollow-meout-of-service__PRIREDIRECTREASON__SIPREDIRECTREASON__SIPRDNISDOMAINno NATSIP/2.0/UDPSIP/2.0/TCPSIP/2.0/TLSSending to %s (%s) Refer-ToReferred-BySIPREFERRINGCONTEXTSIPREFERREDBYHDRreplaces=TRANSFER_CONTEXTbuild_route: Contact hop: %s list_route: no route list_route: hop: <%s> $Revision: 325280 $SIP/%s-%08xtmp*** Our capabilities are %s NewChan%-15s Channel %s - from %sChannelUpdateSIPURISIPCALLID(Critical)(Non-critical)XmitErrSIP/2.0 %30uReliably TxReqRelTxReq%-15s %s / %s - %smessage-summaryapplication/call-completionSIP-If-MatchReplacesMin-ExpiresPUBLISH expiry overflowedAuth attempt %d on %s (0/0)Messages-Waiting: %s Message-Account: sip:%s@%s Voice-Message: %d/%d%s Subscription-Stateterminated;reason=timeoutcc-URI: %s agent_pvt->subscribe_pvtX-asterisk-InfoReInv%-15s Re-invite sentExtInvNew channel is zombie Old channel is zombie Masq%-15s Old channel: %s Masq (cont)%-15s ...new owner: %s Reasonterminated;reason=noresourcerefer;id=%dSubscription-statemessage/sipfrag;version=2.0Xfer%-15s Refer failed%-15s Refer accepted503 Service Unavailabletargetcall_pvtTransfer200 OK%-15s Refer succeededcurrent->chan1target.chan1transferer486 Busy HereSIP transfer of %s to %s application/media_control+xmltype=active;type=terminated;free-of-charge;charging;charging-info=currency;amount=%u;multiplier=%s;charging-info=pulse;recorded-units=%u;not-available;AOCcurrency=%s;text/plain;charset=UTF-8Sending text %s on %s application/dtmfSignal=%c Duration=%u application/dtmf-relayterminated;reason=probationRetry-After60Q.850;cause=%iX-Asterisk-HangupCauseX-Asterisk-HangupCauseCodeTxRespRelTxRespUnsupported%30d SIP answering channel: %s 181 Call is being forwardedCallingCalledConnectedLine%-15s %s party is now %s <%s>X-Asterisk-rpid-update180 Ringing183 Session ProgressSIP-ETag, stale=true401 UnauthorizedAuthChalResponseCriticalNon-criticalpkt->ownerReTx%-15s %d %sMaxRetriespkt->owner->ownerDialogKillByeFailureno response to BYEdrop ref in iterator loopsip show history * Subscription %d. %s Call '%s' has no history sip show channeladding session timer refremoving session timer refast_sched_add failed. Unknown session refresher %d Session-Timer expired - %s VXML_URLSIP_URI_OPTIONSSIPFROMDOMAINSIP_MAX_FORWARDSSRTP audio setup failed SRTP video setup failed SRTP text setup failed Call for %s transfered by %s -> %s (via %s)-> %sOutgoing Call for %s dialog->ownerDetaching from channel %s delete ->relatedpeer->mwipvt-1unref dialog peer->callDestroying SIP peer %s peer->call is being unsetunreffing peer->mwipvtunref reg->callCancelDestroy%-15s SchedDestroy%-15s %d msCong%-15s Auto-congesting (timer)deactivatedremovedHintRemovedDeactivated(queued)SubscribestatusGot 200 accepted on NOTIFY received 200 responseunable to authenticate NOTIFYfailed to authenticate NOTIFYresponse=uri=username=AuthOKAcked pending invite %d %-15s timeoutReliableXmitTx: %30sRx: %30sReferBYEAutoDestroy;transport=SIP/%s::::%s@%sSIP/::::%s@%sTOGot redirecting from name %s Got redirecting to number %s Got redirecting to name %s received 403 responseHangupreceived 487 responsereceived 488 responsereceived 491 responseDetaching from %s %-3.3d. %s Destroying SIP dialog %s SIPDtmfModeSIPAddHeaderSIPRemoveHeaderSIPpeersSIPshowpeerSIPqualifypeerSIPshowregistrySIPnotify&(p->mwi)->_lockreceived 404 responsereceived 481 responsereceived 500/501 response180183%256[^<>; ]Transfer 302 Moved TemporarilyCan't find the host address 488 Not acceptable here500 Internal Server Error500 Internal ErrorCouldn't find tuple node? basicCouldn't find basic node? NOthing in basic node? 400 Bad Request403 Forbidden (Bad auth)Masquerade failed. 503 Internal errorSIPpark%-15s Parked call on %d%-15s Parking failed SIP Call parked failed 487 Request TerminatedbridgeRTCPaudio%-15s Quality:%sRTCPaudioJitterRTCPaudioLossRTCPaudioRTTRTCPvideoRTPVIDEOQOSRTCPtextRTPTEXTQOSAlsoLooking for %s in %s SignalX-ClientCodeRecord403 Forbidden* DTMF-relay event faked: %c 415 Unsupported media typeautomon100 Trying<%s>;mode=activeSend URL %s, state = %d! Failed to get temporary pvt 404 Not Found408 Request Timeout480 Temporarily unavailable410 Gone484 Address incomplete486 Busy here500 Server internal failure501 Not Implemented502 Bad Gateway488 Not Acceptable HereCancel%-15s Call answered elsewhereunref p->owner->tech_pvt%-15s Cause %sunref ast->tech_pvtDELAY603 DeclinedoldownerRTPAUDIOQOShangupWith RTPNo RTPCseqUDPTL creation failed z9hG4bK482 (Loop Detected)603 Declined (no dialog)500 Server internal error501 Method Not Implemented;expires=* -- Unregistered SIP '%s' Invalid domain '%s' %s:%d:%s:%stransportremotesecretmd5secretmwi_fromfullnametrunknamecid_numbercid_tagsubscribecontextfromdomainusereqphonefromuseroutboundproxyforcedefaultipcontactpermitcontactdenydirectmediapermitdirectmediadenydefaultuserlanguageregextencallbackextensionmaxforwardsaccountcodemohinterpretmohsuggestparkinglotrtp_enginehasvoicemailsubscribemwivmextencallgrouppickupgroupdisallowpreferred_codec_onlyregistertryingautoframingrtptimeoutrtpholdtimeoutrtpkeepalivetimert1timerbsetvar__SIPADDHEADERpre%2d=%squalifyfreqmaxcallbitratesession-timerssession-expiressession-minsesession-refresherdisallowed_methodsunsolicited_mailboxuse_q850_reasonencryptionsnom_aoc_enabledcallcountercall-limitbusylevel_%s._%s%s?%s:%s@%s/%sasprintf() failed: %s _%s._%s.%sNo such host: %s re-SIP Debugging %senabled SIP Debugging Disabled No such peer '%s' Peer '%s' not found Peer not foundsip qualify peerPeer: missing. sip show user * Name : %s Secret : %s MD5Secret : %s Context : %s Language : %s AMA flags : %s Transfer mode: %s MaxCallBR : %d kbps CallingPres : %s Call limit : %d Callgroup : Pickupgroup : Callerid : %s ACL : %s Sess-Timers : %s Sess-Refresh : %s Sess-Expires : %d secs Sess-Min-SE : %d secs RTP Engine : %s Codec Order : ( Auto-Framing: %s Variables : %s = %s User %s not found. Accountcode : %s Yes, cachedResponse: Success Peer %s not found. Realtime peer: %s Remote Secret: %s Subscr.Cont. : %s FromDomain : %s Port %d MOH Suggest : %s Mailbox : %s VM Extension : %s LastMsgsSent : %d/%d Max forwards : %d Busy level : %d Dynamic : %s Expire : %ld Insecure : %s Force rport : %s DirectMedACL : %s T.38 support : %s T.38 EC mode : %s T.38 MaxDtgrm: %d DirectMedia : %s PromiscRedir : %s User=Phone : %s Video Support: %s Text Support : %s Ign SDP ver : %s Trust RPID : %s Send RPID : %s Subscriptions: %s Overlap dial : %s Outb. proxy : %s %s DTMFmode : %s Timer T1 : %d Timer B : %d ToHost : %s Addr->IP : %s Defaddr->IP : %s Prim.Transp. : %s Allowed.Trsp : %s Reg. exten : %s Def. Username: %s SIP Options : (none) Codecs : Auto-Framing : %s 100 on REG : %s Status : Useragent : %s Reg. Contact : %s Qualify Freq : %d ms Min-Sess : %d secs Parkinglot : %s Use Reason : %s Encryption : %s Channeltype: SIP ObjectName: %s ChanObjectType: peer RemoteSecretExist: %s MD5SecretExist: %s Context: %s Language: %s AMAflags: %s CID-CallingPres: %s Callgroup: Pickupgroup: MOHSuggest: %s VoiceMailbox: %s TransferMode: %s Maxforwards: %d LastMsgsSent: %d Call-limit: %d Busy-level: %d MaxCallBR: %d kbps Dynamic: %s Callerid: %s RegExpire: %ld seconds SIP-AuthInsecure: %s SIP-Forcerport: %s ACL: %s SIP-CanReinvite: %s SIP-DirectMedia: %s SIP-PromiscRedir: %s SIP-UserPhone: %s SIP-VideoSupport: %s SIP-TextSupport: %s SIP-T.38Support: %s SIP-T.38EC: %s SIP-T.38MaxDtgrm: %d SIP-Sess-Timers: %s SIP-Sess-Refresh: %s SIP-Sess-Expires: %d SIP-Sess-Min: %d SIP-RTP-Engine: %s SIP-Encryption: %s SIP-DTMFmode: %s ToHost: %s Default-Username: %s RegExtension: %s Codecs: CodecOrder: Status: SIP-Useragent: %s Reg-Contact: %s QualifyFreq: %d ms Parkinglot: %s ChanVariable: %s=%s SIP-Use-Reason-Header : %s Peer %s not found. FromUser : %s Accountcode: %s SIP-FromUser: %s sip show peersip unregisterUnregistered peer '%s' Peer %s not registered curcallscallerid_namecallerid_numchanvar[codec[username="489 Bad Event503 Internal Server Failure503 Unavailable482 Loop Detected491 Request Pending400 Bad request500 Server Internal Errorpickup-Trying to pick up %s@%s subscription->owner603 Declined (Replaces)%-15s INVITE/Replace Failed.p->refer->refer_callp->refer->refer_call->ownerInvite%-15s New call: %sContent-Encoding%-15s Re-invite receivedIgnoring this INVITE request 416 Unsupported URI scheme484 Address Incomplete400 Min-SE Invalid Syntax420 Option DisabledInternal Error %d at %s:%d Removing session timer ref%-15s INVITE/Replace receivedreplacecallunref dialog c->tech_pvtFailed to start PBX :( 480 Temporarily UnavailableNothing to pick up for %s %s: This call is UP.... 415 Unsupported Media typeAUTH_PEER_NOT_DYNAMICURI_NOT_FOUNDAUTH_USERNAME_MISMATCH603 DeniedFailed to parse contact info 403 Forbidden (ACL)404 Not foundWrong passwordUsername/auth name mismatchNo matching peer foundNot a local domainDevice does not match ACLUnknown failureRegRequest%-15s Succeeded : Account %sasteriskUnable to load config %s users.confasterisk.pem0.0.0.0:0Asterisk PBX%s %srootgeneralallowguestdomainsasrealmsdpsessionsdpownerrtcachefriendsrtsavesysnamertupdateignoreregexpiret1mintcpenabletcpbindaddrdynamic_exclude_staticdynamic_excludes_staticrtautoclearprematuremediarelaxdtmfcompactheadersnotifymimetypedirectrtpsetupnotifyringingnotifyholdnotifycidignore-contextalwaysauthrejectauth_options_requestsregcontextregextenonqualifyautocreatepeermatch_auth_usernamesrvlookuppedanticmaxexpireymaxexpiryminexpireyminexpirydefaultexpirydefaultexpireymwiexpirymwiexpireytcpauthtimeouttcpauthlimitsipdebugdumphistoryrecordhistoryregistertimeoutregisterattemptsudpbindaddrInvalid address: %s localnetInvalid localnet value: %s media_addressexternipexternrefreshexterntcpportexterntlsportallowexternaldomainsautodomain&(mwi)->_locktos_siptos_audiotos_videotos_textcos_sipcos_audiocos_videocos_textbindport%5dcalleventsauthfailureeventsmatchexternaddrlocallymatchexterniplocallyqualifygapqualifypeersshrinkcalleridauthentication&netlockFailed to bind to %s: %s == SIP Listening on %s SIP TCP server started hassipregistersipauthuser%s?%s@%s/%sSection '%s' lacks type sip.confChannelReload%s?%s:%s:%s@%s/%s%s?%s::%s@%s/%s Reloading SIP SIP channel loading... Unable to create I/O context 403 Forbidden (within dialog)403 Forbidden (policy)forbiddensubscription does not existCreating new subscription authentication failedsubscription not allowedsubscription target not foundPolycomapplication/dialog-info+xmlapplication/cpim-pidf+xmlapplication/xpidf+xmlno Accept headerunrecognized format406 Not Acceptableunknown format404 Not found (no mailbox)unref dialog authpeer->mwipvtsetting peers' mwipvt to pCC is being canceled by %sunknown event package423 Interval too smallp->relatedpeerno extension for SUBSCRIBEforcing expiration489 Bad Event (format %s)Got NOTIFY Event: %s refermessage/sipfragVoice-MessageSIP_Remote489 Bad eventkeep-alivecc-statecc-URIunref dialog after unlink_allunref dialog inside for loopContentsip notifyChannelCould not create addressNotify Sentsip/unref dialog p from mem failunref dialog p UNREGISTEREDRegistryInit%-15s Account: %s@%ssip:%s:%dsip:%sREGISTER%u %sREGISTER attempt %d to %s@%s RegistryRenewregistration timeoutunrefing r->callRegistryAuth%-15s Try: %dreceived 423 responsereceived 479 responseRegistration successful Cancelling timeout %d %30d;ReachableLaggedQ.850cause=Ignoregot OPTIONS responseGot 202 accepted on transfer unable to authenticate REFERfailed to authenticate REFERreceived 405 responsereceived 603 responsereceived failure responseSip-ETagunable to authenticate BYEfailed to authenticate BYEreceived 407 responsereceived 408 responseCANCELtransaction completedGot 200 OK on CANCEL calleeattendedblindAttendedBlind%30d%nno headersInvalid response: '%s' viaSIP %s%u500 Server errorRx: %s603 Declined (No dialog)outside of dialog603 Declined (policy)491 Request pending603 Declined (Non sip: uri)202 Acceptedcurrent.chan1%-15s REFER to call parking.Parking/%sSIPPeer/%schan2Masquerade failed :( sip_park_threadchan1->name: %s BLINDTRANSFER_SIPTRANSFER_SIPTRANSFER_REFERER_SIPTRANSFER_REPLACES183 Ringing200 Ok%-15s Refer succeeded.%-15s Refer failed.481 Call Leg Does Not ExistReceiving message! text/plain415 Unsupported Media Type405 Method Not AllowedReceiving INFO! unmatched ACKunimplemented method%30d %n;from-tag=;to-tag=%s%s%s%s%s Nat keepalive- no channel name ??? - Rx%-15s %s / %s / %sSIP transaction failed: %s 503 Server errorLockFailSSLSIP %s server timed out SIP TCP server timed out read() failed: %s Recv error: %s SubjectAllow-EventsAccept-ContactReject-ContactjRequest-DispositionIdentity-Info-UNKNOWN-INVITEPRACKMESSAGEUPDATEPUBLISHPINGSIP TCP serverSIP TLS serverUnregisteredRequest SentAuth. SentRegisteredRejectedNo AuthenticationOriginateRefuseres_crypto,chan_localSIPCHANINFOSIPPEERSIP_HEADERCHECKSIPDOMAINList our local SIP domainsList all inuse/limitsList defined SIP peersList SIP registration statusShow SIP global settingsShow MWI subscriptionsShow SIP dialog historyList defined SIP usersEnable/Disable SIP debuggingEnable/Disable SIP historyReload SIP configurationList TCP Connectionsport,inviteNone100relearly-sessioneventlistfrom-changegruuhistinfojoinnorefersuboutboundpathprefpreconditionprivacyrecipient-list-inviterecipient-list-subscribereplaceresource-prioritysec_agreesdp-anattdialogCalling (Trying)Proceeding Early mediaCompleted (done)Confirmed (up)DoneCancelledRequest sentRequest receivedConfirmedTarget ringingFailed - auth failurecc-state: queuedcc-state: readyasterisk/channel/sip/peerstohostcid_numcid_nameis_realtimehost_dynamicinUseinRingingonHoldcall_limitt38_maxdatagrammaxmstimer_t1timer_bNLCan't add more headers when lines have been added Memory Allocation Failure in function %s at line %d of %s /build/buildd/asterisk-1.8.4.4~dfsg/include/asterisk/utils.h/build/buildd/asterisk-1.8.4.4~dfsg/include/asterisk/strings.hToo many lines, skipping <%s> Skipping packet - Bad request protocol %s Parsing of Session-Expires failed Parsing of Min-SE header failed %s SDP syntax error. SDP without an o= line SDP syntax error in o= line username SDP syntax error in o= line session-id SDP syntax error in o= line version Call %s responded to our T.38 reinvite without changing SDP version; 'ignoresdpversion' should be set for this peer. Call %s responded to our reinvite without changing SDP version; ignoring SDP. Setting SIP_ALREADYGONE on dialog %s Invalid datalen for AST_OPTION_T38_STATE option. Expected %d, got %d Reporting digit detection %sabled on %s finalize_content() called on a message that has already been finalized Unable to cancel schedule ID %d. Initializing already initialized SIP dialog %s (presumably reinvite) Initializing initreq for method %s - callid %s Initreq: %d headers, %d lines Could not create sip alert pipe in tcptls thread, error %s Looking for callid %s (fromtag %s totag %s) Matched %s call for callid=%s - no from tag specified, pedantic check fails Matched %s call for callid=%s - no to tag specified, pedantic check fails Matched %s call for callid=%s - pedantic from tag check fails; their tag is %s our tag is %s Matched %s call for callid=%s - pedantic to tag check fails; their tag is %s our tag is %s Matched %s call - their tag is %s Our tag is %s Context %s must exist in regcontext= in sip.conf! Changing codec to '%s' for this call because of ${SIP_CODEC} variable Ignoring ${SIP_CODEC} variable because it is not shared by both ends. Ignoring ${SIP_CODEC} variable because of unrecognized/not configured codec (check allow/disallow in sip.conf): %s Invalid maxdatagram '%s' at line %d of %s This function requires a header name. This function can only be used on SIP channels. SIP agent %s's offer timer expiredname: %s type: dialog objflags: %d refcount: %d name: %s type: peer objflags: %d refcount: %d Usage: sip show channelstats Lists all currently active SIP channel's RTCP statistics. Note that calls in the much optimized RTP P2P bridge mode will not show any packets here.%-15.15s %-11.11s %-8.8s %-10.10s %-10.10s ( %%) %-6.6s %-10.10s %-10.10s ( %%) %-6.6s sip show {channels|subscriptions}Usage: sip show channels Lists all currently active SIP calls (dialogs). Usage: sip show subscriptions Lists active SIP subscriptions. %-15.15s %-15.15s %-15.15s %-15.15s %-7.7s %-15.15s %-10.10s %-10.10s %-15.15s %-15.15s %-15.15s %-15.15s %-13.13s %-15.15s %-10.10s %-6.6s Usage: sip show sched Shows stats on what's in the sched queue at the moment No content length. Can't determine bounds of PIDF document Invalid content length provided Content length of PIDF document truncated to %d bytes Unable to open XML PIDF document. Is it malformed? Unable to retrieve root node of the XML document Root node of PIDF document is not 'presence'. Invalid Presence element of PIDF document has no 'entity' attribute Couldn't find default namespace... PIDF document has invalid namespace value %s PIDF document has no elements as children of 'presence'. Invalid Tuple XML element has no attribute 'id' Tuple XML element has no child elements Multiple status elements found in tuple. Only one allowed Event: RegistryEntry %sHost: %s Port: %d Username: %s Domain: %s DomainPort: %d Refresh: %d State: %s RegistrationTime: %ld Event: RegistrationsComplete EventList: Complete ListItems: %d %s removing SIP Header "%s" as %s This application requires the argument: Header Too many SIP headers added, max 50 sip:anonymous@anonymous.invalidT38 state changed to %d on channel %s Unable to perform pickup: Application 'Pickup' not loaded (app_directed_pickup.so). Overriding T38FaxMaxDatagram '%d' with '%d' Session-Timer struct already allocated Can't add more content when the content has been finalized No field '%s' present to copy %-15s Setting needdestroy because %sOBPROXY: Applying peer OBproxy to this call OBPROXY: Applying global OBproxy to this call OBPROXY: Not applying OBproxy to this call ChannelType: SIP Peer: SIP/%s PeerStatus: Unregistered Cause: Expired -REALTIME- peer expired registration. Name: %s. Realtime peer objects now %d Usage: sip prune realtime [peer [|all|like ]|all] Prunes object(s) from the cache. Optional regular expression pattern is used to filter the objects. Peer '%s' is not a Realtime peer, cannot be pruned. SIP Registry %s: refcount now %d Unable to start monitor thread. Usage: sip reload Reloads SIP configuration from sip.conf Previous SIP reload not yet done CHECKSIPDOMAIN requires an argument - A domain name SIP, got a network change event, renewing all SIP registrations. Updating call counter for %s call %s is not a local device, no call limit Call %s %s '%s' removed from call limit %d Call %s %s '%s' rejected due to usage limit of %d Call %s %s '%s' is %d out of %d update_call_counter(%s, %d) called with no event! Status: %s Channel: %s Uniqueid: %s No SRTP key management enabled Adding codec 0x%llx (%s) to SDP Unknown insecure mode '%s' on line %d Unknown dtmf mode '%s' on line %d, using rfc2833 Unknown directmedia mode '%s' on line %d Unknown faxdetect mode '%s' on line %d. Format for authentication entry is user[:secret]@realm at line %d -- Added authentication for realm %s Unable to cancel schedule ID %d. This is probably a bug (%s: %s, line %d). Usage: sip set history {on|off} Enables/Disables recording of SIP dialog history for debugging purposes. Use 'sip show history' to view the history of a call number. SIP History Recording Enabled (use 'sip show history') SIP History Recording Disabled Usage: sip show mwi Provides a list of MWI subscriptions and status. %-30.30s %-12.12s %-10.10s %-10.10s Usage: sip show objects Lists status of known SIP objects -= Peer objects: %d static, %d realtime, %d autocreate =- name: %s objflags: %d refcount: %d Usage: sip show inuse [all] List all SIP devices usage counters and limits. Add option "all" to show all devices, not only those with a limit. Usage: sip show domains Lists all configured SIP local domains. Asterisk only responds to SIP messages to local domains. SIP Domain support not enabled. Usage: sip show users [like ] Lists all known SIP users. Optional regular expression pattern is used to filter the user list. %-25.25s %-15.15s %-15.15s %-15.15s %-5.5s%-10.10s %-39.39s %-6.6s %-12.12s %8.8s %-20.20s %-25.25s %-39.39s %-6.6s %-12.12s %8d %-20.20s %-25.25s Usage: sip show registry Lists all registration requests and status. %sabling digit detection on %s This application requires the argument: info, inband, rfc2833 Call this application only on SIP incoming calls I don't know about this dtmf mode: %s No SRTP module loaded, can't setup SRTP session. Ignoring unexpected crypto attribute in SDP answer We've already processed a crypto attribute, skipping '%s' Ignoring DTMF (%c) RTP frame because dtmfmode is not RFC2833 Bogus frame of format '%s' received from '%s'! == Redirecting '%s' to fax extension due to CNG detection Failed to async goto '%s' into fax of '%s' FAX CNG detected but no fax extension %s
%s open %s %s use realm [%s] from peer [%s][%s] Using realm %s authentication for call %s Digest username="%s", realm="%s", algorithm=MD5, uri="%s", nonce="%s", response="%s"%s%-15s Auth response sent for %s in realm %s - nc %dDigest username="%s", realm="%s", algorithm=MD5, uri="%s", nonce="%s", response="%s"%s, qop=auth, cnonce="%s", nc=%08x"Anonymous" %-15.15s %-15.15s %-15.15s %-15.15s %-3.3s %-3.3s %-15.15s %-10.10s %-10.10s %-15.15s %-15.15s %-15.15s %-15.15s %-13.13s %-15.15s %-10.10s %-6.6d This function requires a parameter name. SIPCHANINFO() is deprecated. Please transition to using CHANNEL(). %-25.25s %-39.39s %-3.3s %-10.10s %-3.3s %-8s %-10s %s %-25.25s %-39.39s %-3.3s %-3.3s %-3.3s %-8d %-10s %s Event: PeerEntry %sChanneltype: SIP ObjectName: %s ChanObjectType: peer IPaddress: %s IPport: %d Dynamic: %s Forcerport: %s VideoSupport: %s TextSupport: %s ACL: %s Status: %s RealtimeDevice: %s %d sip peers [Monitored: %d online, %d offline Unmonitored: %d online, %d offline] Usage: sip show peers [like ] Lists all known SIP peers. Optional regular expression pattern is used to filter the peer list. Event: PeerlistComplete EventList: Complete ListItems: %d %s %-15.15s %-11.11s (inv state: %s) -- %s %-15.15s %-11.11s %-8.8s %-10.10u%-1.1s %-10.10u (%5.2f%%) %-6.4lf %-10.10u%-1.1s %-10.10u (%5.2f%%) %-6.4lf Usage: sip show tcp Lists all active TCP/TLS sessions. Curr. trans. direction: %s Non-Codec Capability (DTMF): %d Their Codec Capability: %s Joint Codec Capability: %s MaxCallBR: %d kbps Audio IP: %s (local) Session-Timer: Uninitiallized No such SIP Call ID starting with '%s' Audio IP: %s (Outside bridge) SIP/2.0/%s %s;branch=z9hG4bK%08x%sCan't find SIP CC agent for call '%s' even though OFFER_CC flag was set? <%s>;purpose=call-completion;m=%sReinvite %s to %s denied by directmedia ACL on %s Usage: sip show settings Provides detailed list of the configuration of the SIP channel. [::] may include IPv4 in addition to IPv6, if such a feature is enabled in the OS. From: Domain: %s:%d SIP realtime: Disabled SIP realtime: Enabled Qualify Freq : %d ms Jitterbuffer max size: %ld Jitterbuffer resync: %ld externaddr: %s RTP Keepalive: %d %s RTP Timeout: %d %s RTP Hold Timeout: %d %s Reg. min duration %d secs Reg. max duration: %d secs Reg. default duration: %d secs Outbound reg. timeout: %d secs Include CID: %s%s Max Call Bitrate: %d kbps Outb. proxy: %s %s Session Expires: %d secs Session Min-SE: %d secs Auto Clear: %d (%s) '%s' is not a valid transport for '%s'. we only use '%s'! ending call. peer '%s' HAS NOT USED (OR SWITCHED TO) TLS in favor of '%s' (but this was allowed in sip.conf)! peer '%s' has contacted us over %s even though we prefer %s. UDPTL creation failed on dialog. Multiple addresses, using the first one only No header field '%s' present to copy INVITE, ACK, CANCEL, OPTIONS, BYE, REFER, SUBSCRIBE, NOTIFY, INFO, PUBLISHCan't find address for maddr '%s' error processing via header, will send response to originating address Invalid contact uri %s (missing sip: or sips:), attempting to use anyway Invalid host name in Contact: (can't resolve in DNS) : '%s' Invalid host in c= line, '%s' Failed to read an alternate host or port in SDP. Expect %s problems Could not look up IP address of alternate hostname. Expect %s problems Unable to lookup RTP Audio host in c= line, '%s' Trying to put '%.11s' onto %s socket destined for %s write() to alert pipe failed: %s Socket type is TCP but no tcptls_session is present to write to sip_xmit of %p (len %d) to %s returned %d: %s Address remapping activated in sip.conf but we're using IPv6, which doesn't need it. Please remove "localnet" and/or "externaddr" settings. Warning: Re-lookup of '%s' failed! Target address %s is not local, substituting externaddr Setting SIP_TRANSPORT_%s with address %s No way to add SDP without an RTP structure This call needs video offers! This call needs video offers, but there's no video support enabled! And we have a text rtp object This call needs text offers! This call needs text offers, but there's no text support enabled ! ** Our capability: %s Video flag: %s Text flag: %s ** Our native-bridge filtered capablity: %s Adding video codec 0x%llx (%s) to SDP Adding text codec 0x%x (%s) to SDP Adding non-codec 0x%x (%s) to SDP -- Done with adding codecs to SDP SIP SDP may be truncated due to undersized buffer!! a=T38FaxRateManagement:transferredTCF a=T38FaxRateManagement:localTCF a=T38FaxUdpEC:t38UDPRedundancy Done building SDP. Settling with this capability: %s Strict routing enforced for session %s set_destination: Parsing <%s> for address/port to send to Can't find address for host '%s' abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789-.:[]set_destination: set destination to %s Can't read framing from SDP: %s Setting framing for %s to %ld Found audio description format %s for ID %d Found unknown media description format %s for ID %d Discarded description format %s for ID %d Got Siren7 offer at %d bps, but only 32000 bps supported; ignoring. Got Siren14 offer at %d bps, but only 48000 bps supported; ignoring. Got G.719 offer at %d bps, but only 64000 bps supported; ignoring. RED submimetype has payload type: %d Found video description format %s for ID %d Got SDP but have no RTP session allocated. Insufficient information for SDP (m= not found) Processing session-level SDP %c=%s... %s unknown SDP media protocol in offer: %s Got T.38 offer in SDP in dialog %s Unsupported SDP media type in offer: %s SDP offered %d ports for media, not supported by Asterisk. Will try anyway... Processing media-level (%s) SDP %c=%s... %s Insufficient information in SDP (c=)... Failing due to no acceptable offer found Faling due to too many media streams Can't provide secure audio requested in SDP offer We are requesting SRTP, but they responded without it! Can't provide secure video requested in SDP offer Matched device setup to use SRTP, but request was not! Capabilities: us - %s, peer - audio=%s/video=%s/text=%s, combined - %s Non-codec capabilities (dtmf): us - %s, peer - %s, combined - %s No compatible codecs, not accepting this offer! Got T.38 Re-invite without audio. Keeping RTP active during T.38 session. Peer T.38 UDPTL is set behind NAT and with destination, destination address now %s Peer T.38 UDPTL is at port %s == Redirecting '%s' to fax extension due to peer T.38 re-INVITE T.38 re-INVITE detected but no fax extension Peer doesn't provide T.38 UDPTL Have T.38 but no audio, accepting offer anyway We're settling with these formats: %s We have an owner, now see if we need to change this call Oooh, we need to change our audio formats since our peer supports only %s and not %s Huh? Not an RDNIS SIP header (%s)? RDNIS for this call is %s (reason %s) Got SIP %s to non-local domain '%s'; refusing request. Looking for %s in %s (domain %s) SIP caller %s is attempting recallDon't know how to respond via '%s' Refer-To Header missing. Skipping transfer. Can't transfer to non-sip: URI. (Refer-to: %s)? Huh? Not a sip: header (Referred-by: %s). Skipping. Got an attempt to replace own Call-ID on %s Attended transfer: Will use Replace-Call-ID : %s (No check of from/to tags) Attended transfer: Will use Replace-Call-ID : %s F-tag: %s T-tag: %s SIP transfer to extension %s@%s by %s Failed SIP Transfer to non-existing extension %s in context %s nbuild_route: Retaining previous route: <%s> build_route: Record-Route hop: <%s> Attempt to Ref a null pointer Unable to allocate AST channel structure for SIP channel *** Our native formats are %s *** Joint capabilities are %s *** AST_CODEC_CHOOSE formats are %s *** Our preferred formats from the incoming channel are %s This channel can handle video! HOLLYWOOD next! This channel will not be able to handle video. sip_new: set chan->tech_pvt to iChannel: %s Uniqueid: %s Channeltype: %s SIPcallid: %s SIPfullcontact: %s __sip_reliable_xmit: setting pkt->owner*** SIP TIMER: Initializing retransmit timer on packet: Id #%d Serious Network Trouble; __sip_xmit returns error for pkt data pkt is being freed, its dialog ref is dead now%sTransmitting (NAT) to %s: %s --- %sTransmitting (no NAT) to %s: %s --- application/simple-message-summaryAdding SIP Header "%s" with content :%s: T38 is in state %d on channel %s Can't find monitor_instance corresponding to epa_entry %p. Received error response to our PUBLISHMin-Expires has non-numeric valueMessage-Account: sip:%s@%s:%d Message-Account: sip:%s@%s:%d;transport=%s Message-Account: sip:%s@%s;transport=%s Invalid state provided for transmit_cc_notify (%d) Caller %s is busy, reporting to the coreSIP re-invite (Session-Timers)SIP re-invite (External RTP bridge)%-15s Initial invite sent with remote bridge proposal.Early remote bridge setting SIP '%s' - Sending media to %s Sending reinvite on SIP '%s' - It's audio soon redirected to IP %s Deferring reinvite on SIP '%s' - It's audio will be redirected to IP %s No new channel! Fixup of %s failed. No SIP tech_pvt! Fixup of %s failed. old channel wasn't %p but was %p SIP Fixup: New owner for dialogue %s: %s (Old parent: %s) Sending reinvite on SIP '%s' - It's UDPTL soon redirected to IP %s Deferring reinvite on SIP '%s' - It's UDPTL will be redirected to IP %s SIP;cause=200;text="Call completed elsewhere"481 Call leg/transaction does not existSIP attended transfer: Not our call - generating INVITE with replaces SIP attended transfer: Error: No owner of target call SIP attended transfer: Error: Wrong state of target call: %s SIP attended transfer: Error: No target channel SIP attended transfer: Attempting transfer in ringing state SIP attended transfer: trying to bridge %s and %s SIP attended transfer: trying to make %s take over (masq) %s TransferMethod: SIP TransferType: Attended Channel: %s Uniqueid: %s SIP-Callid: %s TargetChannel: %s TargetUniqueid: %s Sip transfer:-------------------- -- Transferer to PBX channel: %s State %s -- No transferer first channel - odd??? -- Transferer to PBX second channel (target): %s State %s -- Bridged call to transferee: %s State %s -- No bridged call to transferee -- Bridged call to transfer target: %s State %s -- No target second channel --- -- END Sip transfer:-------------------- SIP transfer: Four channels to handle SIP transfer: Three channels to handle SIP transfer: trying to masquerade %s into %s Failed to masquerade %s into %s SIP transfer: Succeeded to masquerade channels. SIP Transfer attempted with no appropriate bridged calls to transfer ATTENDED_TRANSFER_COMPLETE_SOUNDFrom address missing 'sip(s):', assuming sip: Trying to send MESSAGE to device that does not support it. No authentication available for call %s <--- %sTransmitting (%s) to %s ---> %s <------------> when you delete the provisional_keepalive_sched_id, you should dec the refcount for the stored dialog ptrUnable to get seqno from '%s' Setting framing from config on incoming call Can't add SDP to response, since we have no RTP session allocated. Call-ID %s Unable able to send update to '%s' in state '%s' Unable to determine sequence number from '%s' Digest algorithm=MD5, realm="%s", nonce="%s"%s%-15s Auth challenge sent for %s - nc %dCan't add SDP to response, since we have no UDPTL session allocated. Call-ID %s SIP TIMER: Not rescheduling id #%d:%s (Method %d) (No timer T1) SIP TIMER: Rescheduling retransmission #%d (%d) %s - %d ** SIP timers: Rescheduling retransmission %d to %d ms (t1 %d ms (Retrans id #%d)) Retransmitting #%d (%s) to %s: %s --- Retransmission timeout reached on transmission %s for seqno %d (%s %s) -- See https://wiki.asterisk.org/wiki/display/AST/SIP+Retransmissions Packet timed out after %dms with no response Cancelling retransmit of OPTIONs (call id %s) -- See https://wiki.asterisk.org/wiki/display/AST/SIP+Retransmissions Transmit error :: Cancelling transmission on Call ID %s Hanging up call %s - no reply to our critical packet (see https://wiki.asterisk.org/wiki/display/AST/SIP+Retransmissions). no response to critical packet%-15s Killing this failed dialog immediately%-15s Remote peer doesn't respond to bye. Destroying call anyway.Weird, couldn't find packet owner! drop ref in iterator loop breakUsage: sip show history Provides detailed dialog history on a given SIP call (specified by call-id). ***Note: History recording is currently DISABLED. Use 'sip set history on' to ENABLE. Usage: sip show channel Provides detailed status on a given SIP dialog (identified by SIP call-id). Null stimer in start_session_timer - %s Session timer started: %d - %s Null stimer in stop_session_timer - %s Session timer stopped: %d - %s Null stimer in proc_session_timer - %s Session timer expired: %d - %s sip_call called on %s, neither down nor reserved The SIP_MAX_FORWARDS channel variable is not a valid integer.Encrypted signaling is required Direct media not possible when using SRTP, ignoring canreinvite setting No audio format found to offer. Cancelling call to %s dialog ptr dec when SCHED_REPLACE del op succeededdialog ptr inc when SCHED_REPLACE add succeededdialog ptr dec when SCHED_REPLACE add failedLet's bump the count in the unlink so it doesn't accidentally become dead before we are doneresetting channel dialog ptr in unlink_allnulling out the registry's call dialog field in unlink_allremoving extension_state, should unref the associated dialog ptr that was stored there.unset the relatedpeer->call field in tandem with relatedpeer field itselfremove all current packets in this dialog, and the pointer to the dialog too as part of __sip_destroywhen you delete the waitid sched, you should dec the refcount for the stored dialog ptrwhen you delete the initid sched, you should dec the refcount for the stored dialog ptrwhen you delete the autokillid sched, you should dec the refcount for the stored dialog ptrwhen you delete the request_queue_sched_id sched, you should dec the refcount for the stored dialog ptrwhen you delete the t38id sched, you should dec the refcount for the stored dialog ptrLet's unbump the count in the unlink so the poor pvt can disappear if it is timePeer '%s' is now UNREACHABLE! Last qualify: %d ChannelType: SIP Peer: SIP/%s PeerStatus: Unreachable Time: %d -REALTIME- peer Destroyed. Name: %s. Realtime Peer objects: %d Destroying registry entry for %s@%s Destroying active SIP dialog for registry %s@%s Unreferencing unreferenced (object)! Out of memory. Can't allocate SIP registry entry Bridge still active. Delaying destroy of SIP dialog '%s' Method: %s Disconnecting call '%s' for lack of RTP activity in %ld seconds Bridge still active. Delaying destruction of SIP dialog '%s' Method: %s dialog unrefd because autokillid is de-sched'dScheduling destruction of SIP dialog '%s' in %d ms (Method: %s) Unable to cancel SIP destruction. Expect bad things. setting ref as passing into ast_sched_add for __sip_autodestructunreffing arg passed into auto_congest callback (p->initid) == Extension state: Watcher for hint %s %s. Notify User %s == Extension Changed %s[%s] new state %s for Notify User %s %s Notify answer on an owned channel? - %s Got OK on REFER Notify message Asked to authenticate NOTIFY to %s but we have no matching peer or realm auth! Failed to authenticate on NOTIFY to '%s' /build/buildd/asterisk-1.8.4.4~dfsg/include/asterisk/threadstorage.husername mismatch, have <%s>, digest has <%s> Correct auth, but based on stale nonce received from '%s' Bad authentication received from '%s' Duplicate authentication received from '%s' %-15s Auth challenge successful for %sNOT Sending pending reinvite (yet) on '%s' Sending pending reinvite on '%s' unref the dialog ptr from sip_reinvite_retry, because it held a dialog ptr** SIP TIMER: Cancelling retransmit of packet (reply received) Retransid #%d unref pkt cur->owner dialog from sip ack before freeing pktStopping retransmission on '%s' of %s %d: Match %s Have a packet that doesn't want to give up! %s Re-scheduled destruction of SIP subscription %s Re-scheduled destruction of SIP call %s Autodestruct on dialog '%s' with owner in place (Method: %s) Finally hanging up channel after transfer: %s %-15s Sending BYE on transferer call leg %sAuto destroying SIP dialog '%s' The ref to a dialog passed to this sched callback is going out of scope; unref it.*** SIP TIMER: Cancelling retransmission #%d - %s (got response) (Provisional) Stopping retransmission (but retaining packet) on '%s' %s %d: %s received contact with an invalid transport, '%s' Found promiscuous redirection to 'SIP/%s::::%s@%s' Found promiscuous redirection to 'SIP/::::%s@%s' Received 302 Redirect to extension '%s' (domain %s) No closing quote on name in Contact header? %s Got redirecting from number %s SIP response %d to RE-invite on %s call %s SIP response %d to standard invite Got response on call that is already terminated: %s (ignoring) Channel: %s Channeltype: %s Uniqueid: %s SIPcallid: %s SIPfullcontact: %s Peername: %s Failed to authenticate on INVITE to '%s' failed to authenticate on INVITEReceived response: "Forbidden" from '%s' Re-invite to non-existing call leg on other UA. SIP dialog '%s'. Giving up. 422 response without a Min-SE header %s %-15s SIP identity is required. Not supported by Asterisk.SIP identity required by proxy. SIP dialog '%s'. Giving up. %-15s Got 487 on CANCEL request from us. Queued AST hangup request%-15s Got 487 on CANCEL request from us on call without owner. Killing this dialog.passing dialog ptr into sched structure based on waitid for sip_reinvite_retry.just did sched_add waitid(%d) for sip_reinvite_retry for dialog %s in handle_response_invite Reinvite race. Waiting %d secs before retry Could not transmit message in dialog %s Really destroying SIP dialog '%s' Method: %s This call did not properly clean up call limits. Call ID %s You must have debugging enabled (SIP or Asterisk) in order to dump SIP history. ---------- SIP HISTORY for '%s' ---------- END SIP HISTORY for '%s' Got 200 OK on subscription for MWI Failed to authenticate on SUBSCRIBE to '%s' failed to authenticate SUBSCRIBEAuthentication failed while trying to subscribe for MWI. Subscription failed for MWI. The remote side said that a mailbox may not have been configured. Subscription failed for MWI. The remote side said that our dialog did not exist. Subscription failed for MWI. The remote side may have suffered a heart attack. Missing mandatory argument: extension Cannot retrieve the 'To' header from the original SIP request! unref the dialog ptr from sip_t38_abort, because it held a dialog ptrSIP CC agent destructor: Remove ref to subscriptionCould not find agent using uri '%s' 412 Conditional Request FailedNo tuples within presence element. No basic elements within status element. Received PUBLISH stating SIP caller %s is availableReceived PUBLISH stating SIP caller %s is busyInvalid content in basic element: %s Increment refcount to pass dialog pointer to sched callbackAsked to transmit frame type %s, while native formats is %s read/write = %s/%s Can't send %d type frames with SIP write Missing channels for parking! Transferer %s Transferee %s SIP Park: Transferer channel %s, Transferee %s SIP Call parked on extension '%d' Huh? Not a SIP header in Also: transfer (%s)? SIP Bye-also transfer to Extension %s@%s unreffing referdata->refer_callInvalid transfer information from '%s' Received bye, issuing owner hangup Received bye, no owner, selfdestruct soon. 420 Bad extension (unsupported)Received SIP BYE with unsupported required extension: required:%s unsupported:%s Client '%s' using deprecated BYE/Also transfer method. Ask vendor to support REFER instead application/vnd.nortelnetworks.digitsUnable to retrieve DTMF signal from INFO message from %s * DTMF-relay event received: FLASH * DTMF-relay event received: %c Recording requested, but no One Touch Monitor registered. (See features.conf) Got a Request to Record the channel, state %s Unable to parse INFO message from %s. Content %s Invalid datalen for AST_CONTROL_T38_PARAMETERS. Expected %d, got %d Error decoding indicated AOC data AOC-E termination request received on %s. This is not yet supported on sip. Continue with hangup Don't know how to indicate condition %d Don't know how to send URI when state is %d! AST hangup cause %d (no match found in SIP) Asked to hangup channel that was not connected This call was answered elsewhere####### It's the cause code, buddy. The cause code!!! update_call_counter(%s) - decrement call limit counter on hangup SIP Transfer: Not hanging up right now... Rescheduling hangup for %s. SIP Transfer: Hanging up Zombie channel %s after transfer ... Call-ID: %s Hanging up zombie call. Be scared. Hangup call %s, SIP callid %s Huh? We aren't the owner? Can't hangup call. Hanging up channel in state %s (not UP) %-15s Not sending cancel, waiting for timeoutAllocating new SIP dialog for %s - %s (%s) = Looking for Call ID: %s (Checking %s) --From tag %s --To-tag %s %s request has no from tag, dropping callid: %s from: %s %s must have a to tag. dropping callid: %s from: %s pvt did not match incoming SIP msg, unref from searchpvt did not match incoming SIP msg, unref from search.Failed allocating SIP dialog, sending 500 Server internal error and giving up Got a request with unsupported SIP method. That's odd... Got a request in unknown dialog. Callid %s That's odd... Got a response on a call we don't know about. Callid %s Still have a QUALIFY dialog active, deleting copy sip alloc from p to peer->callunref dialog at end of sip_poke_peer, obtained from sip_alloc, just before it goes out of scopeSIP Seeding peer from astdb: '%s' at %s@%s for %d ChannelType: SIP Peer: SIP/%s PeerStatus: Unregistered Not a valid SIP contact (missing sip:/sips:) trying to use anyway Store REGISTER's Contact header for call routing. Store REGISTER's src-IP:port for call routing. Domain '%s' disallowed by contact ACL (violating IP %s) ChannelType: SIP Peer: SIP/%s PeerStatus: Registered Address: %s -- Registered SIP '%s' at %s > Saved useragent "%s" for peer %s sip_send_mwi_to_peer: Setting dialog ptr p from peer->mwipvt-- should this be done?unref dialog p just created via sip_allocunref dialog ptr p just before it goes out of scope at the end of sip_send_mwi_to_peer.-REALTIME- peer built. Name: %s. Peer objects: %d '%s' is not a valid transport type. if no other is specified, udp will be used. '%s' is not a valid port number for fromdomain. no value given for outbound proxy on line %d of sip.conf.you must specify a name for the outboundproxy on line %d of sip.conf.Bad ACL entry in configuration line %d : %s Bad directmedia ACL entry in configuration line %d : %s Invalid peer port configuration at line %d : %s The 'username' field for sip peers has been deprecated in favor of the term 'defaultuser' Invalid AMA Flags for peer: %s at line %d '%s' is not a valid maxforwards value at line %d. Using default. Codec configuration errors found in line %d : %s = %s '%s' is not a valid RTP hold time at line %d. Using default. '%s' is not a valid RTP keepalive time at line %d. Using default. '%s' is not a valid T1 time at line %d. Using default. '%s' is not a valid Timer B time at line %d. Using default. Invalid qualifyfreq number '%s' at line %d of %s Invalid session-timers '%s' at line %d of %s Invalid session-expires '%s' at line %d of %s Invalid session-minse '%s' at line %d of %s session-minse '%s' at line %d of %s is not allowed to be < 90 secs Invalid session-refresher '%s' at line %d of %s Qualification of peer '%s' should be 'yes', 'no', or a number of milliseconds at line %d of sip.conf Qualify is incompatible with dynamic uncached realtime. Please either turn rtcachefriends on or turn qualify off on peer '%s' Peer %s has a cc_agent_policy of 'native' but required libxml2 dependency is not installed. Changing policy to 'never' Timer B has been set lower than recommended for peer %s (%d < 64 * Timer-T1=%d) Timer B has been set lower than recommended (%d < 64 * timert1=%d). (RFC 3261, 17.1.1.2) srvlookup failed for host: %s, on peer %s, removing peer Bah, we're expired (%d/%d/%d)! Cannot Determine peer name ip=%s -REALTIME- loading peer from database to memory. Name: %s. Peer objects: %d sip set debug {on|off|ip|peer}Usage: sip set debug {off|on|ip addr[:port]|peer peername} Globally disables dumping of SIP packets, or enables it either globally or for a (single) IP address or registered peer. SIP Debugging Enabled for IP: %s Unable to get IP address of peer '%s' Usage: sip qualify peer [load] Requests a response from one SIP peer and the current status. Option "load" forces lookup of peer in realtime storage. Usage: sip show user [load] Shows all details on one SIP user and the current status. Option "load" forces lookup of peer in realtime storage. Realm-auth : Realm %-15.15s User %-10.20s SIP-FromDomain: %s Sip-FromDomain-Port: %d Address-IP: %s Address-Port: %d Default-addr-IP: %s Default-addr-port: %d Usage: sip show peer [load] Shows all details on one SIP peer and the current status. Option "load" forces lookup of peer in realtime storage. Usage: sip unregister Unregister (force expiration) a SIP peer from the registry Peer unknown: '%s'. Not unregistered. SIPPEER(): usage of ':' to separate arguments is deprecated. Please use ',' instead. No matching peer for '%s' from '%s' Found peer '%s' for '%s', but fails host access Found peer '%s' for '%s' from %s FROM header can not be parsed From address missing 'sip:', using it anyway Sending fake auth rejection for device %s Failed to authenticate device %s 488 Not Acceptable Here (codec error)Received SIP INVITE with unsupported required extension: required:%s unsupported:%s Potential spiral detected. Original RURI was %s, new RURI is %s Failed to set an alternate media source on glared reinvite. Audio may not work properly on this call. Failed to set an alternate media source on glared reinvite. Video may not work properly on this call. Got INVITE on call where we already have pending INVITE, deferring that - %s INVITE w Replaces on existing call? Refusing action. [%s] INVITE part of call transfer. Replaces [%s] %-15s INVITE/Replace Failed. Out of memory.Invite/replaces: Will use Replace-Call-ID : %s Fromtag: %s Totag: %s Unable to find subscription with call-id: %s 481 Call Leg Does Not Exist (Replaces)Supervised transfer attempted to replace non-existent call id (%s)! INVITE with replaces into it's own call id (%s == %s)! unref dialog p->refer->refer_callSupervised transfer attempted to replace non-existing call id (%s)! 481 Call Leg Does Not Exist (Replace)Supervised transfer attempted to replace non-ringing or active call id (%s)! Using INVITE request as basis request - %s Hm.... No sdp for the moment No compatible codecs for this SIP call. No SDP in Invite, third party call control Checking SIP call limits for device %s Failed to place call for device %s, too many calls 480 Temporarily Unavailable (Call limit) Call from '%s' to extension '%s' rejected because extension not found in context '%s'. Got a SIP re-invite for call %s Got a SIP re-transmit of INVITE for call %s Incoming INVITE with 'timer' option supported and "Session-Expires" header. 400 Session-Expires Invalid Syntax422 Session Interval Too SmallReceived SIP INVITE with supported but disabled option: %s Restarting session-timers on a refresh - %s Null stimer in restart_session_timer - %s Sending this call to the invite/replcaes handler %s Attended transfer attempted to replace call with no bridge (maybe ringing). Channel %s! SIP transfer: Target channel is in ringing state SIP transfer: Invite Replace incoming channel should bridge to channel %s while hanging up channel %s SIP transfer: Invite Replace incoming channel should replace and hang up channel %s (one call leg) Ignoring this INVITE with replaces in a stupid way. Unable to create new channel. Invite/replace failed. %-15s INVITE/Replace Failed. No new channel.Invite/Replaces: preparing to masquerade %s into %s Failed to masquerade C into Replacecall Invite/Replaces: Going to masquerade %s into %s Failed to perform masquerade with INVITE replaces %s: New call is still down.... Trying... Failed to start PBX (call limit reached) passing dialog ptr into sched structure based on t38id for sip_t38_abort.Target does not support required crypto 488 Not Acceptable Here (crypto)Don't know how to handle INVITE in state %d Unable to create/find SIP channel for this INVITE Invalid to address: '%s' from %s (missing sip:) trying to use anyway... 404 Not found (unknown domain)Peer '%s' is trying to register, but not configured as host=dynamic Registration denied because of contact ACL ChannelType: SIP Peer: SIP/%s PeerStatus: Rejected Cause: AUTH_SECRET_FAILED Address: %s Port: %s ChannelType: SIP Peer: SIP/%s PeerStatus: Rejected Cause: %s Address: %s Port: %s ChannelType: SIP Peer: SIP/%s PeerStatus: Rejected Cause: AUTH_PEER_NOT_DYNAMIC Address: %s Port: %s Peer is not supposed to registerDevice not configured to use this transport typeIgnoring spurious REGISTER with Call-ID: %s Registration from '%s' failed for '%s' - %s %-15s Failed : Account %s : %sChecking device state for peer %s Contents of users.conf are invalid and cannot be parsed Contents of %s are invalid and cannot be parsed --------------- SIP reload started remove iterator->call from registry traversal--------------- Done destroying registry list Setting SIP channel User-Agent Name to %s '%s' must not contain spaces at line %d. Using default. Invalid value for timerb ('%s'). Setting to default ('%d'). Enabling TCP socket for listening Invalid %s '%s' at line %d of %s Setting TCP socket address to %s Bad localnet configuration value line %d : %s Invalid address for media_address keyword: %s Invalid address for externaddr keyword: %s Invalid address for externhost keyword: %s Invalid externrefresh value '%s', must be an integer >0 at line %d Invalid externtcpport value, must be a positive integer between 1 and 65535 at line %d Invalid externtlsport value, must be a positive integer between 1 and 65535 at line %d No context specified at line %d for domain '%s' Empty domain specified at line %d Format for MWI subscription is user[:secret[:authuser]]@host[:port]/mailbox at line %d %s is not a valid port number at line %d Invalid tos_sip value at line %d, refer to QoS documentation Invalid tos_audio value at line %d, refer to QoS documentation Invalid tos_video value at line %d, refer to QoS documentation Invalid tos_text value at line %d, refer to QoS documentation Invalid cos_sip value at line %d, refer to QoS documentation Invalid cos_audio value at line %d, refer to QoS documentation Invalid cos_video value at line %d, refer to QoS documentation Invalid cos_text value at line %d, refer to QoS documentation Invalid port number '%s' at line %d of %s Qualification default should be 'yes', 'no', or a number of milliseconds at line %d of sip.conf Invalid qualifygap '%s' at line %d of %s Invalid pokepeers '%s' at line %d of %s shrinkcallerid value %s is not valid at line %d. subscribe_network_change_eventsubscribe_network_change_event value %s is not valid at line %d. 't1min' (%d) cannot be greater than 't1timer' (%d). Resetting 't1timer' to the value of 't1min' To disallow external domains, you need to configure local SIP domains. bindport is also specified in bindaddr. Using %d. Unable to get own IP address, SIP disabled Unable to create SIP socket: %s SIP TCP Server start failed. Not listening on TCP socket. TLS Server start failed. Not listening on TLS socket. SIP TLS server did not load because of errors. Unknown type '%s' for '%s' in %s Can't add wildcard IP address to domain list, please add IP address to domain manually. Contents of %s are invalid and cannot be parsed. ChannelType: SIP ReloadReason: %s Registry_Count: %d Peer_Count: %d SIP reload_config done...Runtime= %d sec --------------- Done destroying pruned peers do_reload finished. peer poke/prune reg contact time = %d sec. --------------- SIP reload done chan_sip: ast_io_wait ran %d all at once chan_sip: ast_sched_runq ran %d all at once Unable to create scheduler context Unable to register channel type 'SIP' &(&epa_static_data_list)->lockUnable to initialize the SIP request and response parser Got a subscription within the context of another call, can't handle that - %s (Method %s) Got a re-subscribe on existing subscription %s Got a new subscription %s (possibly with auth) or retransmission Received resubscription for a dialog we no longer know about. Telling remote side to subscribe again. 481 Subscription does not existIgnoring this SUBSCRIBE request Received SIP subscribe for unknown event package: unknown event package in subscribeFailed to authenticate device %s for SUBSCRIBE SUBSCRIBE failure: no Accept header: pvt: stateid: %d, laststate: %d, dialogver: %d, subscribecont: '%s', subscribeuri: '%s' SUBSCRIBE failure: unrecognized format:'%s' pvt: subscribed: %d, stateid: %d, laststate: %d,dialogver: %d, subscribecont: '%s', subscribeuri: '%s' Received SIP mailbox subscription for unknown format: %s Received SIP subscribe for peer without mailbox: %s Unref previously stored mwipvt dialog pointerInvalid URI '%s' in CC subscribe SIP CC agent gains reference to subscription dialogSIP caller %s has requested CC via SUBSCRIBEReceived SIP subscribe for unknown event package: %s the extensionstate containing this dialog ptr was deletedcopying dialog ptr into extension state structReceived subscription for extension "%s" context "%s" with Expire header less that 'minexpire' limit. Received "Expire: %d" min is %d Expires is less that the min expires allowed. Adding subscription for mailbox notification - peer %s Adding CC subscription for peer %s Adding subscription for extension %s context %s for peer %s Got SUBSCRIBE for extension %s@%s from %s, but there is no hint for that extension. create_addr failed in transmit_publish. Unref dialogDone with the sip_pvt allocated for transmitting PUBLISHUnable to allocate sip EPA entry for call-completion Unable to allocate space for instance data of EPA entry for call-completion monitor_instance->subscription_pvtUnref monitor instance ref of subscription pvtUnable to retrieve attachment from NOTIFY %s * SIP Transfer NOTIFY Attachment: ---%s --- Error parsing sipfrag in NOTIFY in response to REFER. Got unknown code '%d' in NOTIFY in response to REFER. SIP endpoint %s accepted requestSIP monitored callee has become availableTransfer failed. Sorry. Nothing further to do with this call Unable to find notify type '%s' Unable to build sip pvt data for notify (memory/socket error) Could not create address for '%s' it is not necessary to specify Content-Length in sip_notify.conf, ignoringSending NOTIFY of type '%s' to '%s' bump the count of p, which transmit_sip_request will decrement.Usage: sip notify [...] Send a NOTIFY message to a SIP peer or peers Message types are defined in sip_notify.conf No %s file found, or no types listed there SIPNotify requires a channel nameUnable to build sip pvt data for notify (memory/socket error)it is not necessary to specify Content-Length, ignoringAsked to get a channel of unsupported format %s while capability is %s Asked to create a SIP channel with formats: %s Unable to create channel with empty destination. Unable to build sip pvt data for '%s' (Out of memory or socket error) Unable to build option SIP data structure - Out of memory '%s' is not a valid transport option to Dial() for SIP calls, using udp by default. Unable to find IP address for host %s. We will not use this remote IP address Cant create SIP call - target device not registered Channel: %s Channeltype: %s SIPcallid: %s SIPfullcontact: %s Peername: %s toss pvt ptr at end of sip_request_callConflicting extension values given. Using '%s' and not '%s' Strange, trying to register %s@%s when registration already pending Already have a REGISTER going on to %s@%s?? getting a copy of the r->call dialog in transmit_registerUnable to allocate registration transaction (memory or socket error) Still have a registration timeout for %s@%s (create_addr() error), %d Probably a DNS error for registration to %s@%s, trying REGISTER again (after %d seconds) copying dialog into registry r->callStill have a registration timeout, #%d - deleting it Scheduled a registration timeout for %s id #%d >>> Re-using Auth data for %s@%s No authorization available for authentication of registration to %s@%s REGISTER %d headers, %d lines p is finished here at the end of transmit_register -- Re-registration for %s@%s -- Last Registration Attempt #%d failed, Giving up forever trying to register '%s@%s' -- Registration for '%s@%s' timed out, trying again (Attempt #%d) ChannelType: SIP Username: %s Domain: %s Status: %s No authentication challenge, sending blank registration to domain/host name %s Responding to challenge, registration to domain/host name %s Failed to authenticate on REGISTER to '%s@%s' (Tries %d) failed to authenticate REGISTERForbidden - wrong password on authentication for REGISTER for '%s' to '%s' Got 404 Not found on SIP register to service %s@%s, giving up unsetting registry->call pointer-- case 404Failed to authenticate on REGISTER to '%s' (tries '%d') Got a 408 response to our REGISTER on call %s after we had destroyed the registry object Got 423 Interval too brief for service %s@%s, minimum is %d seconds unsetting registry->call pointer-- case 423Required expiration time from %s@%s is too high, giving up Got error 479 on register to %s@%s, giving up (check config) unsetting registry->call pointer-- case 479Got 200 OK on REGISTER, but there isn't a registry entry for '%s' (we probably already got the OK) received erroneous 200 responseChannelType: SIP Domain: %s Status: %s unsetting registry->call pointer-- case 200Outbound Registration: Expiry for %s is %d sec (Scheduling reregistration in %d s) Using Reason header for cause code: %d %-15s Ignoring this retransmit received 4XX response to a BYEPeer '%s' is now %s. (%dms / %dms) ChannelType: SIP Peer: SIP/%s PeerStatus: %s Time: %d Asked to authenticate REFER to %s but we have no matching peer or realm auth! Failed to authenticate on REFER to '%s' SIP transfer to %s failed, REFER not allowed. Remote host can't match REFER request to call '%s'. Giving up. SIP transfer to %s failed, call miserably fails. SIP transfer to %s declined, call miserably fails. SIP transfer to %s had unxpected 2xx response (%d), confusion is possible. SIP transfer to %s with response (%d). Failed to authenticate on PUBLISH to '%s' Failed to authenticate on PUBLISHFailed to authenticate on UPDATE to '%s' Asked to authenticate %s, to %s but we have no matching peer! Failed to authenticate on %s to '%s' Got authentication request (%d) on %s to '%s' Forbidden - maybe wrong password on authentication for %s Got timeout on bye. Thanks for the answer. Now, kill this call Remote host can't match request %s to call '%s'. Giving up. Got 491 on %s, unsupported. Call ID %s Host '%s' does not implement '%s' -- Got SIP response %d "%s" back from %s Don't know how to handle a %d %s response from %s SIP Response message for INCOMING dialog %s arrived Received error response to our SUBSCRIBEGot 200 OK on NOTIFY for transfer Notify answer on an owned channel? Remote host can't match request %s to call '%s'. Giving up -- Incoming call: Got SIP response %d "%s" back from %s Dropping this SIP message with Call-ID '%s', it's incomplete. No seqno in '%s'. Dropping incomplete message. Invalid SIP response code: '%d' Ignoring out of order response %d (expecting %d) MASTER_CHANNEL(HASH(SIP_CAUSE,%s))**** Received %s (%d) - Command in SIP %s Got CANCEL or ACK on INVITE with transactions in between. Ignoring too old SIP packet packet %d (expecting >= %d) Ignoring SIP message because of retransmit (%s Seqno %d, ours %d) 481 Call/Transaction Does Not ExistGot ACK for unknown dialog... strange. Call %s got a SIP call transfer from %s: (REFER)! Call %s: Declined REFER, outside of dialog... %-15s Refer failed. Outside of dialog.%-15s Refer failed. Allowtransfer == closed.%-15s Refer failed. Request pending.%-15s Refer failed. Memory allocation error.400 Bad Request (Refer-to missing)%-15s Refer failed. Refer-to missing.SIP transfer to black hole can't be handled (no refer-to: ) %-15s Refer failed. Non SIP uriSIP transfer to non-SIP uri denied %-15s Refer failed. Bad extension.SIP transfer to bad extension: %s This SIP transfer is local : %s This SIP transfer is to a remote SIP extension (remote domain %s) SIP %s transfer: Transferer channel %s, transferee channel %s Refused SIP transfer on non-bridged channel. %-15s Refer failed. Non-bridged channel.Got SIP transfer, applying to bridged peer '%s' SIP attended transfer: Still not our call - generating INVITE with replaces TransferMethod: SIP TransferType: Blind Channel: %s Uniqueid: %s SIP-Callid: %s TargetChannel: %s TargetUniqueid: %s TransferExten: %s Transfer2Parking: Yes SIP transfer to parking: trying to park %s. Parked by %s 503 Service Unavailable (can't handle one-legged xfers)%-15s Refer failed (only bridged calls).TransferMethod: SIP TransferType: Blind Channel: %s Uniqueid: %s SIP-Callid: %s TargetChannel: %s TargetUniqueid: %s TransferExten: %s TransferContext: %s %s transfer succeeded. Telling transferer. %s transfer failed. Resuming original call. Got CANCEL on an answered call. Ignoring... Unable to retrieve text from %s SIP Text message received: '%s' Received message to %s from %s, dropped it... Content-Type:%s Message: %s Unknown SIP command '%s' from '%s' Misrouted SIP response '%s' with Call-ID '%s', too many vias SIP message could not be handled, bad request: %-70.70s <--- SIP read from %s:%s ---> %s <-------------> --- (%d headers %d lines)%s --- Invalid SIP message - rejected , no callid, len %d Decrement refcount due to sched_add failureChannel lock for %s could not be obtained, and request was unable to be queued. %-15s Owner lock failed, transaction failed.error setting socket to non blocking mode, fcntl() failed: %s Starting thread for %s server SIP %s server :: ast_wait_for_input returned %d SIP TCP server :: ast_wait_for_input returned %d TCPTLS thread alert_pipe indicated packet should be sent, but frame_q is emptyFailure to write to tcp/tls socket Unknown tcptls thread alert '%d' SIP: Received packet with bad UDP checksum Session Initiation Protocol (SIP)This paragraph is copyright (c) 2006 by Digium, Inc. In order for your module to load, it must return this key via a function called "key". Any code which includes this paragraph must be licensed under the GNU General Public License version 2 or later (at your option). In addition to Digium's general reservations of rights, Digium expressly reserves the right to allow other parties to license this paragraph under different terms. Any use of Digium, Inc. trademarks or logos (including "Asterisk" or "Digium") without express written permission of Digium, Inc. is prohibited. List active SIP channels or subscriptionsList statistics for active SIP channelsList all SIP object allocationsUnregister (force expiration) a SIP peer from the registrySend a notify packet to a SIP peerShow detailed SIP channel infoShow details on specific SIP peerShow details on specific SIP userSend an OPTIONS packet to a peerPresent a report on the status of the scheduler queuePrune cached Realtime users/peershعЂ555hؓ(PЪ := !!!!t!i!'?C4C)CCCCHHNNNNHNN^NNNNHHN@ON@ONNN@OON8ONNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN ONNNNNNNNNNNNNNNOO(O0ONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN@ONNNeefgeeegheee999 99999999@P99؋Ј99(Ȝ؜М QF;0%a{p!x!h!X!L H!8!(!~a~akijSjjk~ai`g1ghiffdfsip_transfersip_sipredirect__transmit_responserespprep_ast_callocast_str_createcopy_via_headerscopy_headersip_st_allocprocess_viaast_sockaddr_resolve_first_afadd_cc_call_info_to_responseadd_headersend_responsefinalize_contentsip_debug_test_addr_ast_reallocast_str_make_spaceparse_requestdetermine_firstline_partsappend_history_va__sip_reliable_xmitretrans_pkt__sip_xmitSIP socket_ast_strdupsip_prepare_socketsip_prepare_socket_sip_tcp_helper_threadsip_check_authtimeouthandle_request_dofind_callast_threadstorage_gettransmit_response_using_temptemp_pvt_inittemp_pvt_cleanupdo_setnatast_sip_ouraddrforqueue_requestscheduler_process_request_queueprocess_request_queuehandle_incominghandle_request_messagehandle_responsehandle_response_updatehandle_response_peerpokesip_poke_peertransmit_inviteinitreqprepreqprepset_destinationtry_suggested_sip_codecadd_sdp`  %.@8get_our_media_addressget_crypto_attribadd_codec_to_sdpadd_vcodec_to_sdpadd_tcodec_to_sdpadd_noncodec_to_sdpadd_contentinitialize_initreqsend_requestsip_poke_noanswerregister_peer_extenhandle_response_referhandle_response_publishhandle_response_notifyhandle_response_registersip_reregisterdo_register_authauth_headersreply_digestbuild_reply_digesttransmit_registersip_reg_timeoutcreate_addrcreate_addr_from_peerobproxy_getrealtime_peerexpire_registerset_insecure_flagsbuild_peersip.confsip_destroy_peerhandle_common_optionshandle_t38_optionsadd_realm_authenticationproxy_updateadd_peer_mailboxes__set_address_from_contactreg_source_dbmwi_event_cbsip_send_mwi_to_peertransmit_notify_with_mwisip_registerregistry_addrefregistry_unrefsip_registry_destroychange_redirecting_informationget_rdnisparse_moved_contactunload_modulesip_cc_agent_destructorsip_cc_agent_recallsip_cc_monitor_cancel_available_timercc_esc_publish_handlersip_pidf_validatesip_set_udptl_peerfunc_header_readfunc_check_sipdomaincheck_sip_domainsip_reloadrestart_monitorrestart_monitordo_monitordialog_needdestroycheck_rtp_timeoutfunction_sippeerfunction_sipchaninfo_readsipsock_readsip_do_reloadreload_configsip_notify.confsip_subscribe_mwinetwork_change_event_cbadd_sip_domainpeer_is_markedsip_poke_all_peerssip_send_all_registerssip_send_all_mwi_subscriptionssip_subscribe_mwi_do__sip_subscribe_mwi_docomplete_sip_peersip_prune_realtimesip_reinvite_retryauto_congest__sip_autodestructtransmit_state_notifystate_notify_build_xmlfind_calling_channeltransmit_request_with_authcomplete_sip_usersip_show_usersip_show_users_sip_show_peercomplete_sipchsip_show_historysip_show_channelcomplete_sipnotifysip_cli_notifysip_notify_allocatesip_show_mwicomplete_sip_registered_peersip_unregistersip_show_registry_sip_show_peerssip_show_objectssip_show_inusesip_show_domainssip_get_udptl_peerapply_directmedia_hasip_set_rtp_peersip_get_trtp_peersip_get_vrtp_peersip_get_rtp_peerpidf_validate_presencepidf_validate_tupletransmit_publishsip_cc_monitor_suspendfind_static_datasip_cc_monitor_request_cctransmit_cc_notifysip_cc_agent_respondsip_cc_agent_stop_offer_timersip_cc_agent_initsip_subscribe_mwi_destroyclear_sip_domainsload_modulecc_handle_publish_errorpeers_data_provider_getmanager_sipnotifymanager_show_registrysip_removeheadersip_addheadersip_dtmfmodepeer_ipcmp_cbpeer_iphash_cbsip_epa_registerpurpose=call-completionsip_monitor_instance_initsip_monitor_instance_destructorhandle_response_subscribecb_extensionstatedo_proxy_authhandle_response_invitebuild_route_ast_malloclist_routeparse_session_expiresstart_session_timerproc_session_timerstop_session_timerproc_422_rspparse_minseupdate_call_counterchange_t38_statehandle_request_optionscheck_user_fullcheck_peer_okcheck_authtransmit_response_with_authget_domainget_destinationhandle_request_invitesip_t38_abortget_ip_and_port_from_sdpsip_refer_allocateget_sip_pvt_byid_lockedcheck_viachange_hold_statesip_newsip_newrestart_session_timerdo_magic_pickuphandle_invite_replacesupdate_provisional_keepalivetransmit_response_with_t38_sdptransmit_response_with_sdphandle_request_referget_refer_infolocal_attended_transferattempt_transfersip_parksip_parksip_park_threadhandle_request_cancelhandle_request_byeget_also_inforeceive_messagehandle_request_publishesc_entry_destructorhandle_sip_publish_refreshhandle_sip_publish_modifyhandle_sip_publish_removehandle_request_subscribehandle_cc_subscribehandle_request_registerregister_verifytemp_peerparse_register_contacthandle_request_infohandle_request_notifyfind_sdpprocess_sdpprocess_sdp_oprocess_sdp_cprocess_sdp_a_audioprocess_sdp_a_videoprocess_sdp_a_textprocess_cryptosetup_srtpprocess_sdp_a_imagecheck_pendingssip_threadinfo_createsip_tcptls_writesip_alreadygonetransmit_refersip_queryoptionsip_setoptionsip_fixupsip_indicateinterpret_t38_parametersupdate_connectedlinesip_sendhtmlsip_sendtextsip_writesip_readsip_rtp_readsip_answersip_hangupsip_callsip_senddigit_endsip_senddigit_beginsip_devicestatesip_request_calldialog_ref_debugdialog_unlink_allsip_scheddestroysip_cancel_destroy__sip_ack__sip_pretend_ack__sip_semi_ack__sip_destroysip_dump_historysip_destroyhangup_cause2sipsip_allocBC?$Revision: 281687 $sip/config_parser.c%5u://Format for registration is [peer?][transport://]user[@domain][:secret[:authuser]]@host[:port][/extension][~expiry] at line %d '%s' is not a valid port number on line %d of sip.conf. using default. '%s' is not a valid domain port number on line %d of sip.conf. using default. '%.3s' is not a valid transport type on line %d of sip.conf. defaulting to udp. Cannot parse host '%s' on line %d of sip.conf. sip_parse_register_linesip_parse_host$Revision: 275105 $sip/dialplan_functions.ctxcountrtpdestrtpqosrxcounttxjitterrxjitterremote_maxjitterremote_minjitterremote_normdevjitterremote_stdevjitterlocal_maxjitterlocal_minjitterlocal_normdevjitterlocal_stdevjittertxplossremote_maxrxplossremote_minrxplossremote_normdevrxplossremote_stdevrxplosslocal_maxrxplosslocal_minrxplosslocal_normdevrxplosslocal_stdevrxplossmaxrttminrttnormdevrttstdevrttlocal_ssrcremote_ssrc%fsecure_signalingsecure_mediaCannot call %s on a non-SIP channel Unrecognized argument '%s' to %s sip_acf_channel_readmaddrttl$Revision: 324704 $sip/reqresp_parser.cFound SIP option: -%s- Matched SIP option: %s x-; branch=ttl=No supported scheme found in '%s' using the scheme[s] %s No ending quote for display-name was found No closing quote found in '%s' No closing bracket found in '%s' can not parse name and number from sip header. Begin: parsing SIP "Supported: %s" Found private SIP option, not supported: %s Found no match for SIP option: %s (Please file bug report!) received request without a Via header missing sent-protocol in Via header missing sent-by in Via header parse_uri_fullget_calleridnameget_name_and_number_ast_strdupget_in_brackets_fullget_commaparse_sip_options_ast_callocparse_viaCould not set remote SRTP suite base64 encode/decode bad len %d != %d Unsupported crypto parameters: %sSRTP crypto offer not acceptable SRTP sdescriptions key %d != %d Could not set local SRTP policy Could not set remote SRTP policy Could not allocate memory for a_crypto Crypto life time unsupported: %s sip/sdp_crypto.c$Revision: 268894 $base64 encode/decode bad key local_key64 %s len %zu Unrecognized a=%sAES_CM_128_HMAC_SHA1_80AES_CM_128_HMAC_SHA1_32Unsupported crypto suite: %s inlineSRTP policy activated a=crypto:%s %s inline:%s a=crypto:1 %s inline:%s _ast_callocsdp_crypto_allocsdp_crypto_setupsdp_crypto_processsdp_crypto_activateset_crypto_policy_ast_strdupsdp_crypto_offersip/srtp.c_ast_callocsip_srtp_alloc;Hd0s S*l4@\cc dPehidj?:D>=p>m>w>Ї?PX??8@p`@@г@й A LA`|AA A0 B0LB xB0Bp,CCCC04DdD@DDD`E@HExE E`EFDFhFPFF`G$GLGxGG#G%Hp0H2H5 I 6PI7|I9I=I@JJSXJVJYJ\K^DK`KcKjKkLkDLn|LoLrL0vMDMpMM@MNPPN0NNN@4OtOOPp4PtPPP@Q PQ@pQ0R0RPR`R@R R@R`S`HS`tS@Sp T@8T dT0xT@TT@ T@UP!lU$U(U)VP9DVGVRV[$W \LWpbWvW0|W$XdXXXX@,YTY YYpY@ ZLZ!|ZAC FAF AA AAF <CAA CAN` AA ACC <@pDAA AANP AA AAA E8AC oD E8AC oD @EWAC0QA|EgC0DSLE,AN [A$E,AN [A<DEAA ACN@ AA AAA <CPLHXF` C (#UCPHSP G <#{AA CCF AA AAB ,<$TRAC [ AH [ AD l$yC0DQ` H ($CPDSFN C <$d AA AACp CA AAH $$TC DUZ B [8$%)AA ACN@AA AA0`%AB DFu AAA A ,%<AB C AAA E (% FGTeD F %WC0DQ~@&AA FCFr AA AAA ,T&@ AB X9 AAA A <&AA AAC0 CA AAA &,FNTl A @&AA ACH AA AAA @,'DAA AFQ AA AAE 0p'DAB D_ AAA G (' FI\a C ,'cAB C AAA G <(AA AACP_ AA AAF <@(@#U AF AAF AA AAC $(`/~C NS{ A ]((/FGYZN G ,( 1FNN_X B ()5FTYSo C @0)@7a AA CAF AA AAH (t)lAC`DQY H ,)`B<AD C+ AAA A 0)pCAB CB AAA A $*,EC`FGPl D ,,*EAB Dd AAA C (\*dGCPLf G (*XHCPLf G (*LIVCPN^ B (*JCPLb| C ( +DKFGT{ C 08+LAB DA AAA B @l+ZAA AAQ CA AAA ,+P_AB O_ES AF (+@uFPuz C , ,xAAB ZH AAA H $<,4C@FHf G d, 4C FFd@,, AA AAF } AA AAE @,AA AFFc AA AAB @ -DAA AAF2 AA AAH (P-FGTIa H @|-d AC AAQ AA AAE @-[AA CCQ AA AAG ,.'AG Ut AAA D @4.| AA ACF& AA AAB @x.AC ACQ AA AAH <.1AA ACQ AA AAG (.FINTom C ,(/X/AG LD AAA E @X/(/ AA FAF( AA AAE ,/8AG X AAA B @/HAA FAQ AA AAD ,0KM AB L AAA B l@0XEAA AACpV AA AAG , AA AAH  AA AAH 0,AN [A0p"AN QA$0]C0HDl E 01^!AB CK4 AAA H L1s.AC fCTl1sAC AACpF CA AAC  CA AAD <1xIAC AAF  CA AAA ,2{= AB L* AAA D (42܆CPHYdd D @`2PAA ACF@ AA AAH 02,AB Dc AAA E (2FNKfM D (3܏CPSD F @03AC ACH X AA AAD lt3l;AA AAC` AA AAA a AA AAC K CA AAA T3<}AA AANP| CA AAD = CA AAE <<4dAA AACP# AA AAB (|4ğF G\IPn H @4AA CCS b AA AAA ,4IAB R AAA F ,5AG hj AAA C (L5AC S i AA0x5AB CCAg AAA D $5F GTI|(5<CPFSL] C ,6F GTI\  A (06|CPIb G ,\6AG u AAA B ,6+FGTc^ H <6AC CCQ  AA AAE 64MAH BA( 7`sAC F f AA<L7AA CCQ  AA AAE (7~CPHR\ E 7XF IMq C $7F IMY~ E (8lF NTKNw(08iAC F \ AA@\8DAC ACF* AA AAD (8F GTIP B l8V AA AAC AA ACH  CC AAB y CC AAG @<92AA ACQb CA AAA T9AA AAF{ AA AAG X CA AAB ,9hAm B U C N J A(:CPFJ[ A (4:lCPFJ[X B (`:@CPHDa C @: AF AAFx AA AAE <: ] AA AAN` CA AAF <;@ AA AAC` CA AAD <P; AA AANP AA AAA <;5AA ACNP AA AAB (;CPDQW C <;T/AC AAN` AA AAA @<<DAA AAN AA AAD (<C`DS_ D <qC0LDe H (<C0HDC F a4<CPHLD F  H (4=!]CPDS_ G (`=0#C`DS_ E (=%AC C@n  AAA @=()AF AAF  AA AAD (=1C0FJk B  G <(>3AA AAN`CA AA$h>(5\C HD_ B k@>`5FAA AAC AA AAA 0>l9AA AC0A AA<?9AA AAC AA AAH <H??yAA AAC` CA AAA ?AIA} B @?B: AA AFF: AA AAC <?KAC CCNp- AA AAG X,@OAC ACF AA AAB U AA AAG <@f< AA AAC`? AA AAF @qC0DS G <@4rAA CAC@ AA AAC @,As AA AAQ CA AAB <pA{VAA AANpm AA AAE A*ANWC4A  CPFN[9 E  I Bȉ AN OAÐ(BȉAq F V B F B F B F B F B F B F B F B F B F B F B F B F B F B F B F B c(B$JF I]YZ C BH"AC \A0CXAB CCA AAA G (C HDn(`Z ~CDQT$ H ,Z$#AB C AAA E (Z*>FNV_ C Z,Z,AN [A[D"AN QA(<[+AN@[ AE YAh[(,DC HDt$[X,fC0HTV C [-A` P@pЈ0GWUPje 7Zgk9/g{1 _e1HY1k7gcTIDgSgbgdga*~2 1xgV+%g{Caw:<gfg4c b _ g g Phdcgg<00B0 11$1/1 91 o <- ggggh{Bh"h,hq`E<<0dc^o^ ^^  ^ ^^?3T[ii* k%iiiiiii@ii j@ jjj#j9j RjZjljvj  jijjjjjjj jjjdkj- k,k=kMk [33DЌDDYD E0hk@EPE`Dp(okwkF}EEЍEEDE G0k@k`LFkkkkkЎFXF cF rF  k 0F @k Pk `SkRRiiiiiii@ii j@ jjj#j9j RjZjljvj  jY,@  Ps @`\oЌG@zN\\0{%% f x` | o8P & @ tW Jh ooLIooEoH ffvfffffffffgg&g6gFgVgfgvggggggggghh&h6hFhVhfhvhhhhhhhhhii&i6iFiVifiviiiiiiiiijj&j6jFjVjfjvjjjjjjjjjkk&k6kFkVkfkvkkkkkkkkkll&l6lFlVlflvlllllllllmm&m6mFmVmfmvmmmmmmmmmnn&n6nFnVnfnvnnnnnnnnnoo&o6oFoVofovooooooooopp&p6pFpVpfpvpppppppppqq&q6qFqVqfqvqqqqqqqqqrr&r6rFrVrfrvrrrrrrrrrss&s6sFsVsfsvssssssssstt&t6tFtVtftvtttttttttuu&u6uFuVufuvuuuuuuuuuvv&v6vFvVvfvvvvvvvvvvvww&w6wFwVwfwvwwwwwwwwwxx&x6xFxVxfxvxxxxxxxxxyy&y6yFyVyfyvyyyyyyyyyzz&z6zFzVzfzvzzzzzzzzz{{&{6{F{V{f{v{{{{{{{{{||&|6|F|V|f|v|||||||||}}&}6}F}V}f}v}}}}}}}}}~~&~6~F~V~f~v~~~~~~~~~&6FVfv&6FVfvƀր&6FVfvƁց&6FVfvƂւ&6FVfv" ,$ `# # ($ d x<p3/_,@ P@ 684d53d6a415e7be63daac3997faa601<3hIhUh0]hhhp6B B wh phmB jhhx C hh@hHC lC 0 i0C @$iqC WC VC 0D P%;iQXi0gsip2i`0pKYY@p[3 Y`Y Q=Pi} l @g @gchan_sip.soPFd.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.ctors.dtors.jcr.data.rel.ro.dynamic.got.data.bss.gnu_debuglink $o88( PP00&8oEEEoLILIT  J Jh ] tWtW fff.aPfPf`lȀrxxxf k k Lz z [` ` | |     H H @ @