ELFd4d]4 (444  TTT8L8LO   /O  hhhDDPtd1  D(D(QtdRtdO  /lib/ld-linux.so.2GNUGNU햣jݜ2!]Ax^A")8KgUa!c@Y;/fwC6;&Xm(C"!+><NE.C{I#~^hPwt /^t>B|D/!J|IaihUK'Kbp  ]T4lR !ver-i  N X y  libz.so.1__gmon_start___Jv_RegisterClassesdeflatedeflateBoundinflateinflateInit_crc32inflateEnddeflateEnddeflateInit_libpthread.so.0pthread_selfwaitpidforkpthread_createpthread_joinpthread_setspecificpthread_key_createraiselseek64pthread_getspecific__errno_locationfcntlpthread_exitsigactionfsynclibc.so.6_IO_stdin_usedstrcasestr__xpg_basenamefflushstrcpy__rawmemchrgmtime_r__printf_chkfnmatch_IO_putcstrncmpstrrchrregexecpipe__strdup__open64_2ftruncate64getpwuidmmap64closedirftellsignalstrncpyregfree__stack_chk_failunlinkselectmkdirreallocstdingetpidstrspnchmod__assert_faillocaltime_rgmtimestrtolisattyfeofstrchrnulsymlinkfgetcfgetsgetpwnamgetppidcallocstrlenungetcsetitimersigemptysetmemsetstrstrstrcspnrmdirfseekchdirmemcmpgetpagesizedup2unsetenv__fxstat64__fprintf_chkputenvstdoutfputcfputsregerrormemcpyfclose__vsnprintf_chkstrtoulmallocstrcatstrcasecmp__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfregcompstderrmunmapgethostbyname__snprintf_chkgetuidreadlinkexecvpstrncasecmpfilenogethostnamegetcwdfwritefreadiconv_closegettimeofdayrenamemkstemp64__memcpy_chklocaltimestrchrutime__vfprintf_chkmktimeiconvfdopenreaddir64qsorticonv_open__strcpy_chkgetrlimit64__sprintf_chkmemmovefopen64accessmemmem__strcat_chkstrcmp__strtoull_internalstrerror__libc_start_mainferrorsnprintf__cxa_atexitZLIB_1.2.0GLIBC_2.1GLIBC_2.2GLIBC_2.0GLIBC_2.3GLIBC_2.1.1GLIBC_2.7GLIBC_2.1.3GLIBC_2.2.3GLIBC_2.4GLIBC_2.3.4       '@ii ii ii  Dii qi ii si si ii ii ii ti $ii  C             $  (  ,  0  4 8 < @ D H L P T X \ ` d h l p t x |  ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I$ J( K, L0 M4 N8 O< P@ QD RH SL TP UT VX W\ X` Yd Zh [l \p ]t ^x _| ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p US[8Ft>.t`X[5 % % h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h D$ y D$&D$y $ .tT$D$$| D$$7 D$ y' D$&D$y $ AD$ 3 D$&D$y $ D$ S D$&D$y $ D$ T D$&D$y $ D$ W D$&D$y $ D$ le D$&D$y $ ~D$ z D$&D$y $ WUWVS1,*L$}-uD}8u8}t L$]%Bu|$$z 'L$,[^_]ÃD$ D$&D$y $ WVS D$@D$-7ZT$-D$A~ $D$u)PT$P=D$BDD$~ $ǐD$u"P T$P tU =D$CDMD$~ $荐u9D$P T$P t" =D$MDB CMCt MtBuIt$4$U1҃Bu!\$ t/u"C\$4$U‹L$9u [^_ÃD$ D$&D$y $ GD$ 8 D$&D$y $  D$ D$&D$y $ D$ ¨ D$&D$y $ D$ ` D$&D$y $ UWVSE ]e$1҉D$L$ D$$@苬 u =+!D$$ D$$cD$$ D$$d q b6 \$L c  P R uǀt$xB-#$/ع#D$|D$x $"DŽ$D$t$$ $xT$lt&e  u]ej 1 d t5  t*Y"Ct&)1넍t&D$8 $u l륐t& D$< $ی D$ $NX$!D$Xdi D$D $艌D$PB D$L $d$h  D$/ $;( D$ $ø D$`C T$`BPD$`P,d D$x $Nj D$ $:Xlj T|$lpSDŽ$c 1D$R $a811ɸd $T`=$ , ( D$`x$$N2$x$m|$t$ D$Z $$ D$}t\$D$t $$ aD$$$ m( ,  P( , Dh $$ D$5h $$ D$l D$W$_D$`1ɺ$ D$D$ $N2 , T$`B D$ $ $ \$Hu# 5"p  D$ $衉 D$_ $脉L = J\$$\ :$xT$$$$D$$xD$ L$$D$-$PT$LB8-xhx$   P3D$@`|$@ 11ɸ $w]`D$X fD$`D$hI&HS@SCACAC A CACD$hL$`R`\$` D$W $ D$ $\$xÉ"j~:ttst$<$ex $t$ L$4$D$D$-$_D$h0\$h-t&4$D$ D$ D$}׉P$eKHKHK H K@CfD$X@ t=  ҉T$\ 9ʉL$Tv5 211D$`D$dfÉЋPD;T$dH@wr;L$`s ߉L$`T$dPuׅwFGF fPFt F l$\\$\ۉ t T$T9at$X >L$XAPu"AP   A  \$XD$`SLCH t1ɍ& uL$`T$XT$HT$<5 > D$^ $G Aq< FPЀwZ1PЀwH\< ut3f(ff@ fL$$a X D$ $裄[ 5 l  $D$t$$ iu$8o5 \$X1ɉ iw\L$X1ۋQLAH tt& uD$X8\$`p t;$ۍ$PD$\$ D$$qL$XAHQLV|$X\$X,Q;1t ft=$ , , ( $D$ $$ D$貌\$XD$D$S$ |$ht?t$hF>$9D$  $$ D$Q4$u͋T$@D$P|$PDD$@T$ D$ D$$$  $$ D$" $$ D$ D$DD$P$HD$@$< 1ɋ $D$T$$ FuL$X, AP% ЉAP  \$XC@SD}f>:D$r 4$证D$\> z4 "< 8 $D$t$$4 fu$8h5< ۉ\$T@efL@;5< t(1t$$4 уL$ӆ5< Y11ɍ$PHX>v@D$X$PP,$TP0$XP4$\P8$`P<@ tD$X@ %F v D$ $+u=D$Xjt&f=f2f'" D$ $D$X1j1ҁ@ƒ|$\ L$\A$9׋5 $&<$&t$ \$$ D$D$$4  =4 \$X$PD$TL$DD$ $f$ 4$D$ D$ D$TD$\$Pt$\󥋴$ 1"$PD$D$  $Z>wFf |$\T$\B$< $%$ \$D$׿ (D$PqVD$$ ~= s$P|$4$ '(A1D$\/ D$ $} $ \$\$XC 1|$H|$<  tft|$X1,  tft\$X 5D$X@H@LD$`@= >833vk! t$ = 111t&  u110t&4@ =(  \$$ l$(GdWhGt$ |$$,$X Y' $u Í& t $T$Ðt&L D\$@t$D|$HX$ۋ;@t7T$T$@1$V|$D$ D$ D$D$D$$@D$E$S@1$T|$D$ D$ D$D$D$$D$4$4$0 !%tDJDD$T$$D, 44$ E1t$ D$ D$$1& 4u I6tBFP;, uFS$D$m D$D$ $6uu5 uJ&6t= , 9NuF $TD$m D$D$ $#6uá $ D$h $[, C,$CE$<$$ H`D$Le3   u9\[^_]Ðt&ЃD$$ 谟$ 褟/$ 蓟$p 觟$X 蛟$ o , D$0\$T$4t$ |$$ l$(Ƌl$88ƿ 8ƿ; 8ƿf 8l$8\$T$4t$ D$0|$$l$(,-t&T$$ r= BЉ 1\$t$ |$$l$(,ÍvT$$qt wZ  T$$q vD$$M fT$$q  wD$$ UWVS1҃Ll$`D$<1uw11ɉ|$4ߋ\$t61ɍ)уuM i)ω}$tu\hJƉ $\$<Ét$@|$Dl$H軿x h)ލFT$$!t$\$lj$0 T$t\$1CD$C@SDt$ D$ D$T$D$,$t[uʼnl$$ 轸l$ D$D$$ 轳l$ D$D$$ 蝳D$,t& T$,x&s t l$ D$D$$ IC,D$(ƹl$$ CS$D$ D$,$D$ wC$|D$% D$,$D$ PT$($TD$9 D$,$D$ (SDC@D$M D$T$D$ ,$l$ D$D$$c bCPt!D$ D$ D$,$讷l$$ l$$ CD$ D$,$D$ el$ D$D$$ űCPKl$ D$D$$ 蛱&l$ D$D$$ p=vD$,|$,<= l$$ l$ D$D$$t l$ D$D$$  tRC $ml$$l$$ 衵l$C$l$$ 肵ul$$ ll$ D$D$$ ll$ D$D$$ L D$ D$ D$,$裵l$$ l$ D$D$$ l$ D$D$$ ӯ,$kV~ 11ɉ${蹲$蟰t$$ D$+뮉'UWVSLeD$<1T$(D$T$t& T$uv  kStٍD$(D$C$VT$(T$D$C$Xut$D$8 l$$v^C$D D$+  ۣ JD$|$<D$u-C rud{ au^{wuX{uR0 )t&D$ $8>u\C 1ɉ\$t$ |$$l$(,Í&k nl$$ xD$ $=t\D$ $= ޸8h TECI,&0 t&{ o>{w4{*0 C $ uT uX~q j1;l_{sU1{Gv'WVS  Z;-!v 9vt ;-;-u {-u{tQ{u1҉JuD$ <$;uzS xU  9w9u4\ t[^_}t&[^_þf$ |D$$ |\$$# |&UWVS|D$<$$T$@$e$l1D$1& $ L$@<\$DL$(\$,9v0U $ D$@T$Dr;L$@9fwT$LD$HTC$fc&C$, C$% ЉC$D$@T$DC( S$i   CT$8 oOT$(L$,$X T$L$ovUWVSÃ<҉T$,D$ C1D$D$C ${t,kL$,1&T f| t RRt"9uEEEt$,$..KtwkL$,1l$,9sv`T <*GftD$RD$D$, D$N T$ $6D$,D$|$$29sw<[^_]D$ `vD$,$-}6x&UWVSLL$<@ D$$D$(D$,D$0D$4D$8D$Kt1t&D t9swE  l$L$$ D$D$,$1D$8CCtd11l$5fh H0fPh h$Hhh(hh,hD C9v!D PfuCD$9wߋl$)CL[^_]ÍvE%=@-F$;, 1҉ع ) VD$$ T$4D$( D$,FD$0CD$8t&UWVSÃ,CC D$V $* D$\ $* $_x= D$$ ,Tt$$ + $D$ D$20D$$*CS PSSD D$ $ D$=9D5 9u ,$D$9i,$ɍ$,[^_]Í& D$ D$ D$$9׉s tD$@0P,1[^_]Ív1ut&녍9u)D$ $D$D$D$4uϡ $:tD$$ D$jfD$$)3聕9fA$ Gj&l$$ 0j $ D$jt&',t$$֋ \$ ÍD$|$(1ɉ$ RuV$ *D$ًT$4$|$   ni\$ t$$|$(,Ð  t$|$$\$ t$$|$(,É'UWVSl eD$\1LtM LD$p $f' 8#t1T$\e3l[^_]ÐD$$ ( D$ $ D$W6j  'C p  p  CKZ:5 ~ :F \$H\$$譱E~1D$0D$4D$8D$DtP$T$@D$DD$ T$D$$ƋD$DD$0|$0D$8D$4T$@D$DT$,$ $/T$,l$ D$ <$T$D$?/T$4D$8<$j'T$@- p4$xvP$T$DT$@,t& D$_ $+%6 D$h $%v^ D$&wD$lD$ D$ D$4$ X|$l9 D$xCD$|C$C $C$Of   D$D$ $ #S|$p.vD$xD$F$ $a D$y^|$p,vD$xD$F$ާ $y D$A^D$pD$D$tD$D$xD$ $Lut&{P SƉP$SP(S P,SP0'? |"_t&T$(D$$  T$(fD$8?|$V%D$xD$$ƅD$x ÉS$CC ˆS$K$t&D$$ , &t&D$$  ] $ D$\ $ D$\|$$& \D$x$W$L D$w\ $ D$b\ $ D$M\$$ D$5\ $ D$ \ $z D$ \t&'UWVS<$D$/D$(L$,ρ)D$$D$((}1tbt$ 19}vX\ CP9uT$ t$D$$}u΋t$$ S@t?<[^_]Í<1[^_]É4$F`T$fD$(T$(V  T$$؋L$,1tpt P fzuN1 L fyu?9ut豪fCC C$C(C,C0D$(@ @$@(@,@0 T$,tT$,CBCBC B CBCBCBCBC B C$B$C(B(C,B,C0B0C=&UWVSt9tV<>u19T$v:: J\$t9t4< u19L$vD$ D$$lE 1k14jt&<\$0\$@t$4|$81t\$0t$4|$8<ÍD$,D${D$(D$ D$<$ut|$(t0$h<$$x D$G\$0t$4|$8<ËD$,t$$D$4u| ts,`D$4$FF_$D$uG&[t9PtPuL$DT$T$$u2[u͍Gunt$u,[^_]Ív뙍D$$5YUWVS?D$\D$ x D$D$(D$D$,$<$'<[^_]Ðt& D$ <$D$D$<$D$(T$, PT$(T$,DD$P$^<$D$D$PD$X D$D$$ D$ \($ru,\$$Ӌ4$t$(T$Y1҅uD 4t954D$D$ D$\$$f_19‰Ћ\$$t$(,É',<\$\$0l$(l$4t$ |$$sML<D$.1$R`);4t&\$t$ |$$l$(,ft1u܉1t͋5<*.$]<41듍vD$.$_ 4)9t<1cv=49uۡ.5<$L]4D$4$D$K`.<<$]4f.1<$\<<44\$$Q 65<\$$h 6n&'t$5.\$ t(4$>] t' tBu. ؋t$\$É4$] tt$$7\אt& t$؋\$.Í\$Ét$f18D$t f$f[tjD$ $R[tVD$: $>[tBD$ f1$'[t+D$1 $[tD$ $Z։\$t$Ív'\$Ét$|$׀8tKD$ $ZtOD$ $ZtCD$ | 1$Zu 'f\$t$|$Í' v'ۍvVSӃ$T$T$D$$^T$D$ƋD$:1҅t t$3$[^ÍvUWVSÃ<54D$.$D$$t$D$(D$,Z)t$$l$|$ D$ 4$;-4|Lv"tHT$D$4$D$(T$L$,PT$(T$,D9-4~</\uD$4$D$(T$,\PT$(T$,D/놐D$D$ 4$D$($1ۉD$D$,D$B4$;D$(w<[^_]Ðt&t$t$$|$ D$ 4$ 몍v'UWVSÃL4|<$WD$4D$8D$< D$, t41f#t;uD$, u|  ET$,T$,T$,|$ |$4D$D$ T$<$\nMt&< < t|6D$<$ID$8T$< PT$8T$tT$ tӋt$ 1ۅt$É؋\$Ív' $\$t$t$|$|$ox$t$|$ Ít$\$$|$|$ ,D$D$D$4D$D$0$q,Ðt&UWVS,\$DD$f1 $OD$N. ...D$D$t&tt80 1ۃ l$u u;#[toD$߃ \$ƈ.{.1 É1ۃ-É t߃ .v.$ D$.D$)t&D$v.t'D$$cL1.,[^_]Í&D$v \$Ɔ.t& t t =Lr11D$1CfT$ uCtC#t;u9D$+ tۍvu?ft/./ 9u\"/1땅t D$D$1\$_t&] 1É1ۃ-É u .0$t .9=.t+T$T$1L$Ɔ//T$HD$$.T$T$@f&b f"\ t뀅\$fƆ..t$Ɔ.w \$u> 4Z u"Ɔ... "tm\u ufv1 @Jvntt  ]k3t$ Dl3Ít&'\$\$ t$t$$$Jt\$ t$D$$\$\$t$Ív'D$$ Í'<.\$,\$@t$0t$Dl$8l$H|$4t t$H\$,D$Dt$0|$4l$8<81D$$) Jt@D$$. 聜$91D$$D$%MT$$AGtD$,$Lt$$It,D$\$,t$0l$8E|$|$4<Ðt&l$Ӑ;D$$L|$.ft$$D$6D$ t&t$l$$D$Wt&T$t$$T$D$&\$t$$z> ÉD$D$$D$D$ $/ۉt$F\$t$ÍvUWVS,T$@D$.\$Dt$H$mL;D$@WOx*+D$@D$tt$@4$GI$/1ɉt$1D$Ӄt$Kf1 É1ۃ- 9D$tsus]t$@ t.t@t$t;D$ uϋT$@$L T$w#$D,[^_]D$뾍t 눍t$@$< t$*#뱋E,1[^_]Ë\$@$ \$#딋L$@$ L$"v&'.$$$$$$-Ë$D$4D$4$t3$C$$$$ļÍ$D$$4/D$\$D$$$0wD$,D$$tG>!4$ S-D$t$ 4$I4<<D$\$$Al\$$ ?!4$B 4t$D 4$Bt&l$$D$$$(yv4$z> 5t&t$$u   4$B댍t&4$ B 4t$ D 4$A$<uu?&$uߍD$@D$l$$CD$l|$pD$0$  v4$kAVFt6$2D\$$f D$ 4$A$4‹D$,#D$$$T  D$_JE$C\$$ D$24$@D$0D$D$l$D$ D$D$$b,$H=<<1\$8D$4D$(|$<,D$04Džu.49<D$(<4tʃ=<tq|> DD$4;|$(D$4vD$(+|$(D$D$,|$$-9w-D$4tD$,D$D$- $j-j\$8}O|$0&ɉ~7 u$t&]Dt t =u琀|\t9Hv OD$4\$8|$<$t@<u$D$,$$D$,TD$(9D$0v$l$0)D$D$,l$$v,9D$04$D$DD$$$s\$$4 D$(f4$$D$,!뜍v'D$$D$ D$D$D$ $Ðt&UWVS\$p$te$L1D$L$(|$0$)D$8.n$T'D$,D$,D$D$D$8$qD$$D$,D$ $?.T1D$4t$LD$D$4$d=LD$Lt*1 u+v tutE.릍<[u|L[t/<$S@|$ÉD$D$$$}*921뼐TM ]D$ \$ ŽD$,D$,$4 D$uD$4ML$D$4#L$|$ \$<QD$ :D$ $ D$ Ðt&\$\$(t$D$$t$ t$ݓt#1\$t$ÐD$ \$t$\$$ t&SD$(\$ T$$t$"1[ÍvT$ [Kt&'<\$,\$@l$8l$Dt$0|$4D$ $D$1 $tiD$L $yR }޿f 18/&\$,t$0|$4l$8D$ $-aD$ $-1D$ $-D$ ,$-D$̩ ,$v-ud<1l$H\$DD$@$ l$H\$DD$@ ,$1{l$H\$DD$@ l$$ . D$$  l$Ht$0\$D|$4D$@\$,l$8<<1 D$ 1$,l$$l$1$w<l$1$_,\$Ét$ Ήl$(Չ|$$t$l$$~F‹ClSdKh$SdKhT$L$趚)u\$t$ |$$l$(,ÍCpD$u$t  v$  t&\$\$ |$t${t(Cs|$|$t$`F%C\$t$|$Í&',\$\$0l$(l$4t$ t$8|$$${|vCD$<$FtC|EGEGEG E GEu%3$+\$t$ |$$l$(,Ðt&ju${3u1븍vCpD$$!؋Cp$ D$v'UWVS,\$Ht$@F|NVD$T$G T$Dt"D$T$L$|$ȉ$*T$L$)|$D9tFۉNtwFt )9FtD$D|$D$FxL$$*L$Fx농D$L$T$T$$L$DL$T$E1ɅۉNut&,1[^_]Í&'S$| ËD$ CCdChD$(CtClD$$CpC$C[ÍD$$D$D$D$ $Í'S\$ D$D$$|)CtCx[Í'D$@t@xÐH‰|$$Xt$p yl$ wV wQ~au\jx]BxVxPik|$~|$~|$ ~ |$~|$~|$~|$~|$ ~ |$$~$|$(~(|$,|$DWO NvbSwz_t6T$H/ 19GFG F tWV\$0t$4|$8l$<@Ít&G랐t&tҋEGf%ÍCdGyll$hōD$pD$D$pt$`։|$d\$\L$D$ $+D$NjD$p86<- <[^_]ø/D$<1[^_]D$,D$ D$($ 1D$ " D$$D$ $ :v' t&'T$1tfUWVS\\$xt$tME$D$K$ w |$KZD$0 L$0 $ D$4|$p1ɸWv|$4t&ЃȀwAl$4T vуɀ wL$4|$pl$p\$@D$|$D}9މ|$<r11ҋl$4 &w,߃D  3 9t$@w9t$@L$T$8$$D$D$(#L$L&|$JF|$p# 1\$,D$, É3 #G |D9T$@ʼnt$$)T$ 9}9_ut$^8\ euً\$L$(|$L$(|$(l$(L$ L$(|$$l$L$,l$4B)ȉLD$4$jD$4D$4\[^_]À|$KOD$8T$9$"D$KbL$8T$D$,D$$D$ D$iL$8T$ T$(l$ρT$$T$(T$,T$-L$(\$|$D$,D$$D$ D$L$(l$(|$NjD$(\$l$l$(%D$ D$(l$$%D$,D$4D$4\[^_]ÐSÃD$' $<[Ít&'D$D$D$D$7&\$ÍBt$|$׉$8ƍ@|$\$$D>\$t$|$Ít&UW1VSt=y1t2A t&8pt$9։NΉ98u1[^_]f[^_]ÍT$$D$  T$L$ $T$ $É$։$$D$ T$D$$@AtJ@*t\@%=$$$$ĜÍ&t$\$$@輒xPD$ D$\$$@ 1uT$0t@t EpfǡD׍D$9|$v@,t$\$T$ED$,T$hD5DtD$$t [^Ív$D$[^Ðt$$fWVSt$ 4$tU¸:uVD$/4$1t>4$)Í8D$/$t$t݉$1[^_ÍUWVS,l$@EEEE E\$Dt0T$D fu+D$DT$DUEu ,1[^_]Í@$U҉T$D$E~H1t&T$D<;<$CCƒ ШCtM ;t$uD$T$D$ D$ $T$4,1[^_]ËT$DEUM&S\$ C$C[Ð,$' !=|$\=tk$' =$'  =$' =$' t  ,f$і |=t$=k=і \&=$k $=D$ ' D$D$T$$=1"t&=$$=D$ ' D$D$T$$ =t&$' 4=f 1t =1Ðt&=1f =t += f =\$D$ t$t/$=\$$u:\$t$Ív$=$>\$t$=Ét$\$$<( ټ'=Ív' =t k= f,\$ \$0t$$t$4|$(|$8D$' D$ |$D$t$D$$D$$$tx\$ t$$|$(,k|$t$$D$' D$ D$D$$t$$\$0|$(D$4$\$ ,'&,D$8\$ \$0t$$t$4|$($}|$D$ D$ D$t$D$$*D$D$$x\$ t$$|$(,Í$t$$\$0|$(D$8\$ D$4,& =t = f =t = fS\$ D$$' \$u g1[É\$$' 耻[Ít&' tÐt& ( Dá ( DVSÃ$:/$tQ,$Bt$$D$~$D$2yCS:PSSD$[^Ít&T$T$$T$D$3~믐S(D$0D$D$D$8/t0\$D$ D$( D$' $苁D$${y([ÍVSt$ tB>tF4$ds-9ލvw;/u)4$sD$=[^Ð1t&D$ D$$( D$=Ð&=t$( t8u$( ٍ'VS$$( t${D$D$D$t8u[=t:u\tc$X\$4$D$|D$D$$( D$L4$Tx$[^͉뚐t&uD$ D$ ) 4$5|뛍vVS\$ t0fu$/Җ  t10fL օu[^Ít&SD$ $D$) É$.\$$Җ $o$() D$$w[Í'S$$\$ t3JLu tDD$$AĨ[Ð\$$@) xĨ[V1SL$ t$t&Q\Q`) `)  ةuu1[^Ðt&[^á =1VSt$  =k2@= ˃`* `* LPPu@([^<.t4< v0<:t,<,ft&<t<'<\ ffÍv'$\$Ét$|$4w`>D$|$$Ћ\$t$|$Ít&'WVSÃut&t &u4$ u MftFD>ut41&t tw`>9uՃ[^_Ít&[^_Ív'UWV1S|eD$l1$= $$Q= T= >uD$2$ > D۸ D؀?uL$$$D$ $ D$t$:D$2D$ >4$$um}1B* 1‚  =:T$le3ƀ`>`>|[^_]Á |\$|$$h+ $$ D$$D$(FT$(D$ D$ T$,Pƒ&t>,D$$|$$D$ D$ Pƒ&u‹T$$T$(T$w׋ƒ E‹T$, $L$T$D$T$L$L$,T$$돍&D$$= ƀ $*+ t 8'k$T$T$=T$D$ D$$ VT$$Ɔ @D$f1 $* D$ )t$ t$$D$D$ T$ D$4$T$$1L$* qL$ SD$2t$,$Al$$* 謰t&D$D$$  (Ht&D$$ T$T$t$$D+ D$ZT$t$T$ 4$T$D$.4$ 4$Z$  ƀ .@D$ D$.T$$T$D$D$ )щL$ $^f w $T$ Vf$+ \$O~$q* 9)ЉD$D$ D$*  $5$+ $* vD$$D$ D$D$D$ $IÐt&\$t$$* $* $* }T$ t$\$T$ $\$t$É'VS$ + ?t ($+ (t ($0+ $+ $ + T$ t$\$T$ $m[^Í&(ÐSáHBuJfHBt=9Xux tPx $3HB $HBHBuƍv[Ít&'S\$ $j\$ [&'VSÃ$D$D$D$tD$T$\$t$ D$- $D$t$D$l$[^$ $\$t$ D$, $D$t붍t&UWVSÁ,e$1l$D$l$$Hx3=D|$/uC=l$$u$e3,[^_]ÍD$$1ɉ9t P9sx/t0:/u*9u)΁wl$$J넃9s݀z/uՉ\$$- 虬e ,$\$Ét$ ։l$(͉|$$_¸w{ t$<$<$0.locf@kD$D$<$zCxsHB{ Ct0D$<$*uLC\$t$ |$$l$(,Ðt&HBC HB뽐t&\t&C f|$$- X륍$@Th$+]vST$$D$ $ ÉD$ $[Ít&'T$$D$ $ D$\$\$(t$t$$D$ ىPx \$t$Ãt4$D$&\$\$$t$t$(D$ |$ډD$$x6|$$,tuq<$\$t$|$fs8tuM<$t$\$$|$D$ - \$ѩt6$D$$<\$$- 謨D$P@T$)',$ $0e$1$$$(Sx$umt${ D$|$4$l !%tDJD)Dt$<$uC 1҉Ћ$e3u$ $$$(,'&xL$$1҅‰D$D$ T$$Ðt&D$LBÍSLB\$ tGSx$u#LBD$C $uC 1҃[Ðt&\$ [kt&'S\$ { tCx$cC $ؽC [ÐUWVSÃ,D$<$T$exD$><$HT$@9 u 9v uN9v)^ u &9v ut$19FӉP}AxEƒ,[^_]f9l1t&돍t&S\$ $CD$ [&'S\$ $C$K\$ D$$[w&UWVS\D$e$L1҉L$(D$f1 $"D$\$LfD$D$$D$|$L#D$<D$@D$DD$Hڋ !%tDJDD$()څw҉t |K $. RT$($,$謰T$(KT$Z tt& uT$$L$@؍T$<$*D$DtL$HT$D$t$@T$D|$HT$ T$e$,1T$$\4$T$zJ)Gl$,=1~!t& t߃ 9uT$\$$_qt@P 9t$1ۅtI$XuY$`t!t$`D$T$T$$$,e3<[^_]Í&Gt$XD$4$T$$`t뇉$T$$T$upE v$X1D$4$T$N$XGt]1+vUWVS,B(B@ B(%=uC$WD#ƉЉT$fkeʃ@!9u(l$l$|$$$tW@8 u,[^_]Ë\$tt  :u)L$|$ u/t>;tSC:uÀ;uv$,e3D$<[^_]ËL$D$4$L$膹t$4$x4$^~|*/t4l$t$<$!nD$ D$/ <$D$}@tu11?fD$D$<$t7T$(D$L$,BD$(D$,D9t0< tP^vD$D$/ <$@9uЉ<$D$ 7D$(T$, PT$(T$,D|$$0 /Z<$7<[^_]Í&D$/ $5t$CD$/ $5D$D$/ <$;$0 蜘L&S(T$D$D$ D$D$$=w[X/ 00 ڃ0 ¸([$0 vfD$ $т Ð&,l$(l$8t$ t$4|$$|$0\$t\$t$<$~)u\$t$ |$$l$(,fu$/ vf$ ,v/  D$ D$D$/ $MÉ'/ D$ D$D$/ $9É'D$$T$(0D$D$D$ $Ít&D$$T$(D$D$D$ $9Ít&,|$(|$0T$eD$1\$ \$4t$$D$d|]tC;t$8sfډ1ɉ3T$e3u$\$ t$$|$(,Ð1ɺ/ T$T$$<0 ltt$$l0 \t,D$D$D$D$D$D$D$$D$$, \\$LË@l$XՉt$P|$TtZ1t6Cu,CD$CC\$Lt$P|$Tl$X\fST$D$$$KSL$(L$D$(0 KKDtD$t$0$耎t;D$$l$KSL$(L$D$(0 KKDtT$t$0$'L$$L$$g&D$ 8D$(ptD$ |$$D$%)tD$ t$ D$<$D$19|$,tS|$Tl$ l$$uCt(D$$#CS"PSSDtt$$"m<[^_]UWVS,\$@t$DD$9sED$$0#CS'PSSDt^1<'t)"o1ɉt(<"t$<\t Ff"t\t ÄuL$t$<$/ S<"tM<\t)t[97Go(,[^_]Ít&CsPȀTw$1 t&L$H1tʋL$H,[^_]D$<$p둍t&D$ t&D$<$H_WD$CGGDD$C/37*S/70ŀ B sL$D$vD$lD$ bD$ XD$ ND$ D&WVS|$ t$$$'|$rtC$'tۉ$|$Lt\u݉|$$\-Ѝv|$$D$ '[^_WVS|$ t$$$'|$t( tS\t6't1ۉ$|$ʂu؉|$$D$ '[^_驂|$$\蘂뽍|$$\耂|$$npyt&'WVS|$ t$$$"|$BftG"tiW   t|t&ۉ$|$u|$$D$ "[^_؁]#[}$u|$$\踁뮍{t}u|$$\薁댍t&|$ D$D$$ |+v|$ D$D$$ h|v|$ D$D$$h1 @|v t3 |$ D$D$$e1  |t&|$ D$D$$b1 {{WV4eD$,1t$GDt$D$= $>1҅x,(҉ЋT$,e3u4^_z'||$teD$\1B\$lt$pl$x%==t]=@@t)T$\e3\$lt$p|$tl$x|fG@%=uÉՃ 밐z0B,|~ $ qVD$\$4 GDD$4D$8D$<D$$<"[D$@,D$D$DD$ D$<$AtL$8;L$@$ex$-_D T$,D$$L|T$,t$HD$\$D$D$ T$D$4$,(Ճ |$<9$(w$Ճ Wxt&'UWVS,|$@D$1T$) )9Gt$l$$Dw uċD$ D$ D$$FD$D$ D$$d= t,[^_]Íf1)et&,1[^_]Í&',ɉ\$$ËD$4t$(t$0tu#\$T$$o|\$$t$(,Ívt׉T$$yT$fHt$Ɖ\$|$%= ==tL$$3 SB@ǁDߋ= ؋JH= 9NE؅t ؋JP9E؋B9F؋JX9NE؋F$ك ;B,Eمu,6 ƒ 8E؉؋\$t$|$Í&R@@uӉ#Ѓ &B1%=/ @=D 1@EJ9N  VSӃ$ɋD$0L$L$ȉD$0$¸xL$0ډ$$[^Í'T$D$JPJHHJTHJLH HJXHJHJH J,H$  tH(RtÁH(Ð&\$ \$,t$t$$|$|$ l$l$(V(u @u ƀ ht\$ t$|$l$fuuӋVt8W1t;Vw u\$ t$|$l$zf1농t&D$,t$t$$|$|$(\$D$ D$ t$|$$t3Hu/ tF%=tF$u1 …Eډ؋t$\$|$f$ËB($։$ω$T$u ĀFDl$ l$D$$2z|$ l$t$$&D$t  u}F%=tN(&$$$$ĜÍv@L F(Ív$1t^v$롐F)y|$ l$t$$Bt&$1m$[v^(uC$tL$[\$t$lj$pl$<$D$u' tF(Āg(t&D$T$$$\$l$ l$ t$9OЉމ|$9҉(u> TuD$%=@/DȄu6D$(%=@t!18$t$|$l$ Í&/8Ѹrϐ&$\$l$ l$$t$t$|$|$ 9NՉ9(uB9t>\$ u\$@/Dˋ\$ t&/tF)А$t$|$l$ Ðt&\$(@t/tƍ&/u뽍'l$ l$$\$ t$t$|$|$9ӉN9(u/9ڸ|&T$ 01ɸ09M$t$|$l$ Ít&UWV1SD$$x s9~ID$$(>DP(DD$D$,T$ D$D$($ t}9~ ߍvÍӃ[^_]Ív',\$\$0t$ t$4|$$l$(,<$|$-lS1O( C 9։Ss")T$ōTT$,$m\$t$ |$$l$(,Ív'UWVSl$1ۋ}ut/1 9J(tJ(u9uE ][^_]Í&'UWVS|$4\$0<$p|$$D$i|$1ƋC$;ss7,t&t$$9sv(|$D$kt׃1[^_]Í't$t$ \$|$|$$^(uC$oW(uC$o19t\$t$|$ÐDD9ۋ\$t$|$ÍS(\$0C(%=uC$[oD$D$4D\$D$D$ $n([Ív'L$A.t/tu*1Ðt&Q/t~-guyit>ft/u빐t&ft.u։Q/tu1Àytuv⍴&'@tQ>f' ‰V(Q@%=u$T$$RWT$$NDT$ $D$ST$04t$$胓V(@uC$T$$VT$$Fl$($T$Jl$,*ˉ$ J J =CUERul$,\$,$RT$(B;T$0v\$(l$;Gw9T$$D$$T$*Wo(xg&@uC$hRHl$$:ËȉGȉCGȉCG ȉC GȉCGȉCGȉCGȉCG ȉC G$ȉC$O,K(O0K,O4K0O8K4Wt`ffS>S@%=uC<$T$QT$D$D$$D$M$ٍ$,$0$M9t$1$B$TD$DŽ$TDŽ$XDŽ$\$۔$XEERT$$$A$X$\$$$}$$B$TD$DŽ$TDŽ$XDŽ$\$K$XCUER$$$$X$\$$$q$)5$D$,$9g$|$D$$990l[^_]ÐuC$|OFDŽ$HDIRC1l[^_]Í$Bu$tG$o(mt&$~t$l$$te $t$D$$89$l[^_]ÍD$,D$$$D$LD$t1ۋ$BD$xBl[^_]Ct&UWVSt$0\$4~ u0n~<>1ҍ& A%=t6Ft/;Aw*C4$D$t/\$0[^_]ǀ&9u\$0[^_]驀\$0[^_](&UW1VS,\$@$kk11f;C 4F(0tND $L$-M$Ǎ@LD$5L$|$L$PDʼn$T$hI GE(FED$l$$T$u.|$T$$;CQ,[^_]ÐL$$R5 L$\',[^lj_]Ã\$\$(t$t$ |$|$$t 1|/)É\$|$4$1҅xЋ\$t$|$Ðt&в;Fs4F(%=uC$K9úuD9럐Su ؋$Hu[Ít&' =tt=tt É'UWVS<…D$,D$$T$11D$ D$&D$L$$؋9L$$ЅډÉL$~qt?t$t7B-D$(D$L$(T$-D$ $=FT$|\trfD$L$L$tL$D؅D$؉ӃD$ ۉ\$6Ћl$몐t&<|$rL$(T$$: L$$T$l$2$FD$L$GfD$؉ӃD$ ۉbD$ d$$9D$,t&D$ ҉D$,dD$ D$ d$$9D$,uڃ|$,uӉЃ<[^_]ËD$($6 D$ #\$Ӊt$pR)\$4$D$ jJ4$)Eډ\$50\$t$É'-$Ӊ뢍l$$7 #T$f,\$\$ D$$L$$(D$D$$D$Q D$@'t$Ɖ\$|$D$: $ǡVu{tC\$t$|$ÐD$f1 <$AC1tS/4$?CC\$t$|$$: 녍t&'UWVSe$1  fC-D$4$>u$: l$8D$$D$)rD$,yt&to{-|$4$=tC$e|$D$; D$ dD$D$dD$,$T==dw{D$D$,l$$4u$rt&1$e3uLĬ[^_]B$: 0\$$pt$$X7 봉|$$: >'UWVSÁ $$e$1T$@=$T$D$t$ډ$T$=D$$ AT$t$,D$t$$T<<$D$DT$Ku&tD+ uD,1l$4$ct[`/ 8u@D$0L$0 t u$T$,$D$Nj$e3ļ[^_]fpackBed-rBefs$D$f1 =tnT$($8t|/t |7/uu[^_]ÉŐ$$l$|$݉$:E/.gifEt$Et2$p:<$>ƍ$x$t$|$É$V:D$8VL$43/D3$D$$:[^_]ÍUWVS$$$e $1ɅD$(T$,tE$D$$$D$ D$(D$ D$$D$ T$$9ƍ$C t$\$D$$6Gt$t$&,$ =~.t^$u9=ԃvt< tD$T$\$$5D$$< D$ T$(T$$D$2=rD$8%=@D$$D$ D$\$$/T$D$D$\$T$ $T$ƍD$$4,$$=$e3uqĬ[^_]Í&|3/D$0/t&1;t90묋L$T$D$rD$$; D$Y|5UWVSӁD$e$1D$L$D$T$D$ $y$a<$7ƍ$t$\$D$$3t$t$v,$:V~.t^$57=ԃvt< tD$T$\$$n3D$D$D$ D$D$$覉T$$T$D$$:^D$4%=@D$D$$DŽ$DŽ$DŽ$D$D$DŽ$DŽ$DŽ$\$$$D$D$$D$,$D$9D$$D2,$|:D$$e3Ĭ[^_]Ít&|3/BD$0/2$D$ D$$D$\$$6$DŽ$DŽ$DŽ$DŽ$DŽ$$T$$ RvD$$ D$Ć &L$T$D$D$f92'SÃt&1ɺ: [Ít&=u1ɺ: 1t[ÍvUWVS,T$l$HL$É}=1҅ \$t$@\$DD$vT$D$|$l$$?u\$Njt$t!tC-V-T$$~/uau߅ۉ|$@t$D &tT$D$\$l$4$t܉,[^_]Í~66D$D$DL$@T$l$$D$RP벍t&؋ȅg뜉/&L\$@eT$<1҅|$Hωt$Dtdt$t$D$= $$1҅t&ЋT$~4$)v.T< ǹָDv@uv[^_f@,$`9<ty= uOT$,$3AT$$X8 T$D$;$3T$ $tT$@$|$$T$D$tZ$< fk\$$< Tkt$$(t,$\$$8 D$!fD$|$$d$$D$ D$t$,$VvD$t$,$Z8l$9$Y< 1f11҉$h @$ D$$|$$t$ D$\$$< j$< i|$$P$6\$$9 D$t&\$$8 \$$; \$$; xh\$1$)< ^D$S11҉$z:$1@$H $H$H$H$HT$|$$T$l$$t9 t$2fD$ > $8 \$$< hl$$< ht$$Ra$l$\$$9 D$ C5\$$t9 .D$ > $; \$$9 l$$< g$1l$$< g$< gt$$ZPw`l$$< gtl$1$v< l$ [gl$1$A< <$1l$$09 D$l$1$7 ml$$< t$O UWVS\$p$xe$L1$t$ t$et$$D$4$)$)01$ \$,$uSt#$8L$L$ ,$L$ $1$Le3\[^_]Ív D$*D$$,: D$ T$D9r$D$ D$$6;$~v1)9s)Gl$(|$$< uW9s>G< t6s<>t>< ft8؋L$0>t* t%9uD$,$G= D$1;\$0t؀8 tݍ$T$D$ ${D$ D$D$ $$Xt$8$t$D$$2ut$8|$HtT$0T$Ht$4$t$t$$ ix _$D$BT$$D$ $M T$$D$,-$8 H-t +H H H @ B$D$ D$$)$z :$D$D$,T$$|$T$D$ $4$RD$T$(B1$>,$薤$e3[^_]Ðt&$ T$4T$$D$`uv9T$d$|J9t$`rBD$t$$uB$D$ \$,$蝰xt&$,$ۣ@$ݾ-$ D$(D$D$ D$$D$D$ $iÐt&L$ T$&'VSD$0\$$t$4D$D$,$D$;tJT$ $T$T$(T$1҅x [^Ít&uT\$$= ِt&ttG[^f\$$s= `[^Ívủ\$$= Kv\$$s= 8&VS\$ t$$u t&tC@t$$u[^Í&UWVSl$e$\1T$4 1҅t.1t&$ډƋ u$ T$8D$01T$ <$PD$r> $T$,)l$|$${+$f%s@T$,$T$4 $D$(;t$8TT$4$5T$,|$HD$(l$,D$(T$,D$T$4D$$n uɋD$($;D$0$E-1ۍt&9ދ t?T$(D$D$<$T$T$0T$ 9V$HD$<$fN9ul$($\e3uil[^_]Íl$(,$T$4$tfv&v'뗍|$$: 8,t$ t$4\$|$$|$0l$(^(0 tOGt^VDT$$Nj@tfn, $D$ϥuf1u0uL$4QL$49Y[^_]ÐDD D$D$$ԡfUWVS<\$Pt$TD$$D$H $Eh9D$\$$読x)1D$,D$D$$D$,tf9tb8u])9sT)Ãu1t1v:+ Q i KJKJK J KJu PD$D$<[^_]Ít&D$H$D$T$ljBf\$\$ t$st&D$4$躭4$bCC \$t$Ð&UWVS<|$PGT$TL$TT$,B(0uxt&DT$(T$$赬twptpD$T<$D$ӏ1ɋDuauuE4$GEt/L$, B(0twzD9t$Tl$Tl$Tt&D$T<[^_]Ít&T$(L$$D$\$ T$TT T$$LD$<$D$蘓L$$SL$($> L$59s|$D$?tl$Tl$TU'UWVS,|$@l$D_~Otw11 ;_sf4F(%=uC$ DD$D$ D$t$,$t\$<$Ã;_r,[^_]VSÁ$$e$1ƍ@=\$\$D$$$' K$' 5D$$u1҅u"/reffFsD$$S1҅tЋ$e3uZ$[^f/HEAfFD$T1҅ƍv/objFectsFD$$1҅t딐+\$D$<$c> vVS4\$+e$,1҉D$D$w> D$ D$D$$\$D$$螲 ~MD$D$$t@ t? $> $,e3u4[^Ð1Ov'|\$tÍD$t$x։D$\$$uD$T$\$tt$x|ÅB1 t\$ D$t$$> p ߍ&/4$tU(D$un߉t$<$\$$|Y>/tg؋t$0\$,|$4l$8<Ð$D$=l$É$?륐t&D$@|$$D$y&tR$u,$ljD$\$D$[|$l$$D$'T$u;|$ ;vt%  v9/u vW D$L$$)ЉD$At$t$$\$\$(t<;/t7D$ t$ D$ $ D$\$ 4$؋t$\$ VSt$$ۉt$Ot$$D$_T$T$D$$tnut1[^Í&t[^Ãtt$$> &L\$D\$Tt$Ht$PeD$<1;-\$t%4$@t*D$&'UWVSD$4|$00tc1t <$Ņ\$4tvt$l$<$3uD$4ED$4D$4D$4[^_]Ðt&D$4t= $D$4 f x$ Ív'$ x{$$ Ív'S\$$u[fu;-tD$ \$$t։\$$ 4$ǏtD< t< tF~/ʼnD$tuD$/<$taP) AL$T$$T$|$T$ʼn$tT$D$\$$D$ZL$D 4$'t1,$4$D$D$Č[^_]ÐČ1[^_]Él$$:? k|$$#? [|$$? K|$$> ;|$$> Kt&'L$<É$D$HՉL$e$,1$@$.( $=$t $ƉÉuYl$T$4$1$,e3$<$@$D$HLfT$<$P$@D$|$$@V<$@/u}$ $<$%8ƅ@/ƅA4$<$At&= ~> $4$1$4$1tt8/tb$$}|$,D$<$$@M$? $p$P _ED$' $S? \$$a? $A |$$|? $? D$$|? D$k\$$|? [t&'UWVS<$?  ËD$Pt D$PD$$@D$(@@!%tDQET$(\$(l$(@$' D$ t?L$PT$(c t \$PtL$P ɉ B<[^_]É\$$@OD$$(B D$,)1Ʌ11t$ \$(t$,|$$ύt&$і $"Ņ,$@P c9}a@/ut@/ 3T$$3D$ e$/ qƃ@D$@$? v|$P$@|$P1&і ^.D$ і T$PD$ q$.( 9\$(tD$ 8/t$ $D$ $@L$PT$(D$ mD$,$D$1ҸP L$L$ƉET$PP $.( )9\$(P t\$$@f$@huiL$PT$(m1\f 9\$(tD$ $D$ D$ $$@t$? &-I9\$( $ tq$@$@O$@9Lƀ@X1t$P$@hD$P1l$P 1Y$P p t$ і t D$ $ 19\$( $ L$(AƁ@/ƁAƃ@D$@$B X$A lD$ ED$і $HB /$? CvuD$$$('UWVSÃ<1L$$t>21׃P P TF FuՋL$$<[^_]ÉT$,6$ƍ@< $lL$$l$Pl$|$D$ C D$D$$L$$T$,12^'$$T$L$$É$։$$<$D$ 5 D$D$DED$$$E|$D$D$$$D$$t$\$$D$$D$$$`$$$$ĜÍ'UWVSÃHH҉T$~?1ҽ$  ;T$t$<$Ɖ8u݃[^_]Ðt&$` ޹18Dƒ[^_]UWVSӃ,D$@D$D$@ D$tA1ҽ\$ ;T$t$t$8u܃,[^_]Ít&\$T$DD$D$$T$щB RSPSPS P SPA,[^_]Í&$$$$D$$ND$tD$xD$|Ƹu}D$D$\$$uD$$%=uoD$@|$t\$<$D$NJuWD$|8/uND$$u:<$~D$$>$$$Čf|$t<$~ɍ&UWVS|$<$Dt_l$D$/4$uCCsw09v,ڃցu܋T$<2[^_]Í$M \1[^_]øύt&'L\$<Ét$@ֺ8|$Dljl$H8D1tftD$P3kC D$TCN>xD$(D$ D$,D$l$4$¸tjL$,P t])Չ3k$D$,t$($)t$D$5 D$ D$D$D$TD$D$P$C1\$19^v~$t\$t$Ív[t$\$f4$`1uɋV뭍vSD$L$ Px$t0PR\ȅx1[ÐB[ʋ@Í&I1ҋ[ÍUWVSL- |$`T$d|$,T$8zhT$8B$0w|$0|$,t$D$Xt hD$X$\$\T$0$D$L$L$4$D$8HD$PT$Tl$$$T$D$D$\$l$ D$D$8T$$$$褳$L$\$D$0L$,5HT$<ׁǠ(GT$(t0$LL$(GG5H+w((Bt$,;5  5Hvl u!bf5H95 [sO {u݋Ct։$βCC+s95 5HB[r&$T$4L$t |$ D$D$(D$D$,$$21뀍t&D$4$D$t$D$l$ \$D$<$10t$$L $s&胙$it$$O D$rSv몍&;$!t$$O D$r&S\$$D$ D$ \$$萁 v$;PACKuC1=t1=TR[Ít&'\$\$ t$t$$D$$x9u$\$t$É$$O D$q4$$迺t$$O D$pVSD$A1 $/uE t`GtK X1t$蝖t$D$$=[^Í&D$@1 4$.t1$Q Lp$P @pD$$\$t$t$ $t<t5<t1\$t$ÍvD$,$D$0+1\$t$f4$$t$D$XJt륍v'UWVSÃl8!L$,D$T|$4D$\$<$踘\$,1t*l$Tfl$$Z%[uvD$,4D$,D$$0-Xʼn$stϋE,1D$, $貐D$D$ D$D$<$cu,$'CFCFC F CF<$D$,$)\$T1tD$$,[uD$T$c)l[^_]Í,$訐vD$\D$D$XD$ D$$@1cx!uZ\$$P mv'UWVST$De$1҃|$D(L$HT$D; DŽ$DŽ$DŽ$DŽ$DŽ$D$PxxxxD$TxxxxD$XxxxxD$\xxxxD$`xxxxD$dxxxxD$hxxxxD$lxxxxD$pxxxxD$txxxxD$<1ҋt$D,t&K\PDˉ9|$Pt(KЀ vύKvčKKɃ 볉T$<|$@X|L$xT$@T$D$ 9P D$(D$ $bXD$4ۉ\$8D$<D$0t&\$8T$@D$ >P D$D$T$C$ ؃$輖|$4ÅD$,txt&D$,$ltNk,$ˑ&uދL$0|$R9u΋t$4t$z&D$4륐t&|$4ËD$,$T$8ۋT$8t&|$4xT$,\$,1҅$D$LD$8L$(v\$,1$蚲S҉T$0u[t&k9sCL$,\T$$\$ $t$(T$$(Ƀt 9r9\$0T$,T$,toT$8u5L$L$A$A$A $A$\$4 $e3 [^_]ÐT$,\$$l$<$\$ D$0 &87zqw\$ tA2B\$\$,$q$u ,t&ȉ8 uZHwt:@2Bt/L$8t$L|$0uD$8\$4 CD$zED$~E$E $E$E$E$E$E $E$D$4f$D$0D$LS1D$4|$4~0$E\$@T$D$DP \$T$8i9T$4tDҍ$$DL$HPQPQP Q @A1$$k$L$H$A$A$A $A1z$1ۍL$xD$ $ É\$48\$P\$@詪$oƍ@3$st$|$ãX@$赉D3CD3/诊t&EƉ$#T$@@t{T$4$D$G@$褀T$ƋD$d8D$d)@@4$sL$dt$ $D$&4$跄L[^_]Ét$$LQ ckD$D$$2!L$dD$ vD$$!L$dT$ Vԍt& LD$dT$dD$$D$(pD$\$\$$$D$,)D$%L$d\$A$"x]L$dtxT$d)BBD$($D$M D$(L$dD$D$, $D$q%$I!L[^_]ËT$dtE9D$dp@0D$ $D$dj&D$$L$d룐&,|$(|$\$ É|$t$$D$D$D$$19uD$D$<$= ‹D$Ћ\$ t$$|$(,ÐUWVS$$D$0$T$4$D$}u+9w'}f<{u9s {^+9v|$,(D$TD$,D$81D$4L$0D$T1ۋT$4D$ ,$L$T$i.T$8T:-T$(HT$811Tאt&TJЀ L$(D$dt$ $ghÍD$d$D$o$;}\$d<D$`L$0D$D$\D$D$XD$D$TD$L$ \$|$$nt@D$\D$D$D$X$bT$4l$$pQ T$D$ J[D$T1$|Pf9t$,ƒ)9sW1ېt&<9\{ut;ɉL$huDL$|e3 Č[^_]Ít&1ۉ;T$(ÄɍL$htPu|$h<$ $G$u xv@tnuL$0BRPQPQP Q @AO|$h<$\ t+uf^G$vt8tG<$Otҍ 9\JC߻vWL$0WQW QWQ GAf9x {D$|$$Tu{}tb D$|$$1u {}t D$|$$ u {}C<}}T$,1T$4D$4U1T./'$D$4L$8D$HD$HD$LD$PD$ $%L$0D$TD$ D$$= L$=D$4;D$42L1T$,T$8&|@Tu|{u\$,D$8T$-tD$D$ D$ ; D$D$$Ct$(\$$D$0,}Lt&\$$t$(,Í&UWVS$$$$ ,$T$8L$0e$1҉D$Hw|$01tftL$0ډǁ0L$8JtDE<:tl1҄u2f<:t<{tBt<})uf$e3[^_]Í&뫍v~EGʼn)؃D$D$,$eD$\$^,$D$D$L$,L$@AQ 9scL$D)‰T$o$L$a9l$ld$D$D$D$$GD$HT$@rrDl$,[^_]Ív'VS\$ t$($t$CSt$D$$$D$+\st9v*Cs0[^ÍD$$\e <\$,\$@t$0t$D|$4|$Hl$8D$@$GS|$t$D$ D$)ЉD$S$`19vJL$$S|$t$D$ D$)ЉD$S$`1Ʌu]9sƅtT9sdCs0\$,t$0|$4l$8Wt9<>u19v4: Jt9tp< u19vD$ D$$GE D$t&\$$'U p"Et&D$$$E|1Dv<1\$0\$@t$4|$8t\$0t$4|$8<ÍD$,D${D$(D$ D$<$-to|$(t0$XC<$j$7U D$!\$0t$4|$8<ËD$,t$$D$L4$D$CD$\$0t$4|$8<Ít&<$Pj$f D$`!5t&'UWVS1ۃl$4uBZt&D$iU 4$tA)߉|$D$ 4$Gt)x9vt$0D$KU މ4$Wu[^_]Ðtpzu!8\tK t6t u\AruzÐt&\AnÍt&\A\1É'L\$<Ét$@l$HՉ|$D$1D1tAt:0tJD$ 4$L$,EL$,1t1u,~u&\$u9tt$<2/t|3/u$D$Xl$T$$$T$T$8T$T$4T$ $T$$ |[^_]Ðt&$l$\$$ >))9t$09t$0}D$0</|$<@D$0T$4\$D$$=%D$`%=@=[D$X+D$\XD$D$d$O$D$d$l$T$D$\T$d$\$D$D$d$D$XD$hT$l/PT$hT$lDD$X$p+$^?$D$hT$$D$D$lT$$D$T$$T$ C($/ÍD$d$XRt&T$X+T$\t~T$,<$l$Ë$$D$4T$,+$T$T$\T$43/D$X$$|$\$T$$$T$$T$$T$ r$X4D$X\$l$[\$$tW D$D$X\$l$w[\$$W D$vV`S1ۃ$5DL$4t@@11ҍt&@(%0 9t9u1۸`t&aD$D$8D$L$ D$D$D$0D$ $t$[^Äu$ToDD$ ^D$D$@$r:$1[^Ív'SD$ $zt@<u4<t'<t-<u1[uC$y<uك[Ív[(Սv1ۃ[Ð@@Ít&'WVSÃvc| u\< tUr1PЀvFPЀw8|< ut#>t4$5s{ DC[^_f$W t&l$ ͋L$9T$$Ét$Oʉ|$9ɉ(u +D$u$t$|$l$ Ðt&~ ݐt&;T$}9҉މu1|/D뱐L$ D$T$ɉHuÐvVS$\$4D$tKD$D$ D$ $D$jt*D$D$D$0t$$$[^Ít&11ډ$BX$W D$bfSD$ PH+9r )مɉHu [Í&[$W t&'UWVSÃD$ $T$T-VS4e$,1$H\$,$@D$ D$D$$DD$$D$H) \$t$ D$ D$$*$,e3u 4[^$t&D$$$W D$D$ D$AÍ'D$$$X D$D$ D$Í'D$$$R D$D$ D$$&t&D$$$X D$D$ D$$%t&D$ ÍD$$D$D$ $'D$ $ D$'D$$D$D$ $ &VS4e$,1$@'$%1 &t,w$%,ru݁t Ƅ4,%rƄ,$,\$\$,D$D$n D$ D$D$$ $DD$$ 'D$$D$D$ $ÃD$$D$D$ $ÐVSÃT$$۽CCt$D$ $%st9v(Cs0[^Ít&D$$落D$ \ D$&D$y $ ()& D$(T$$\$t$|$l$q3$T$$t)1KCF #%)#_*#Ovw ?0T+?`v} vrvdЃOvGt{vD$$1\$t$|$l$ ùz1&P9 ;4DX w;4@X Hؐt&3*IvST$€gS$€QST$€:hM|$? ? <$? kƀ? >&1ST$€cS$€MtHtSu |$|<$? ?  ƀuu|$ƀ4$o&VSt$ t.1ۀ>u /fÀ:t&D$ D$$T$ u݉4$Ã[^ÍvD$ tJwD$ uf tD$ D$$WD$ u1É'UWVSD$ $T$!lT$`] D$D$>D$ T$$jD$>D$ $Ɖ׉T$k`] C4$|$D$>D$ jD$>D$ $Ɖ׉T$k`] C4$|$D$>D$ XjD$>D$ $Ɖ׉T$Hk`] C4$D$>D$ |$jD$>D$ $Ɖ׉T$k`] CD$>D$ 4$|$iD$>D$ $T$jT$X`] CT$D$,$<[^_]ÍE<[^_]Í&K<[^_]Ð&D$$D$D$D$ $1Í'D$$D$D$D$ $Í'<\$,\$Dt$0t$@|$4|$Hl$8l$L$\ 1\ |$D$' D$ D$\$D‰D$4$ 9v'l$D\$,t$@|$4t$0l$8ډ݃;T$S< < 9TL$0xL$ t)l$$T$|$ D$,$L$l|$ $ |$ D$D$4$T$h|$$ Wt&ڃ;T$TD$,tD$,)?9\$)~wGd$ D$l $_  L$KD$t&,$ l$T$$] $^ S(D$D$D$D$0D$$5 u D$=Id t"=9d tkt $ƒ([Í?$_ 1 @ (_ uu  u뿍t&$^ 2[f?랍vVS$\$0D$D$D$%@=@E@t$t$D$OD$D$(^ 4$Àt$D$D$D$>^ 4$΢t$D$D$D$Y^ 4$襢t \$uPD$ D$K^ 4$耢4$D$$[^fD$D$^ 4$P+vD$D$ 4$0떍D$D$ 4$%vD$D$ 4$.vt$D$D$^ 4$̡&D$D$ 4$訡vt$t$$$\$L$D$ t$t$ T$\$ $t$t$t$t${t&'L$(T$$D$ D$ D$D$$=É'SL$ T$~.0 ut& t9u[Í1[Ít&UWVSLD$l@\$`t$d|$hzD>D$0< D$4 D$<T$l1\$81D$ T$$T$l\$$?T$(T$lT$,'v uSۉt+T$ 9T$(F9t4 uӅT$,D$ 9uӍ&\$8D$ D$lD$(t ;L$ L$(D$l11|$$|$(?D$ 9D$D$$$SD$KBCCD1҃9tG.< u;T$ uD$$ۙCS PSSD19ut&ҋ|$$t8jt&D$$蕙CS PSSDu+|$(t$(|$t$$蛞D$4D$0KtD$ptT$pL[^_]ÍD> uD$<1l$<덉D$ ,&D$<D$4D$0ǍT$ D$lxtD$ 1St$$|$(D$ D$l׃?At&D$D$$lSD$KBCCD9l$ T$$*< u&D$$ CS PSSDC1)u멐D$$CS PSSDvD$$踗CS PSSDLvt$$|$(+|$ t$ D$0D$<l$D$0< 1D$lD$4t!D>D$<D$0D$<1S\$ D$8D$< $0tCt7/ t_ DЋC_ T$$_ DD$f[Ív` ʐS\$ $tC:x $_ D‰D$[Ív't$D$$t$ \$D$4$!Í@v7_ F_ L$$` D‰D$؋t$\$Ív$$` _ 뿐$_ t&_ 말_ 럐UWVSd D$`@ɉL$bʉ|$(<$3|$3|$ ݋\$Dl$ |$\|$<3|$41ߋ\$1lj|$4t$4|$\3bʋ\$,4$3\$813t$$|$$t$ t$H11É\$8\$ t$8\$$3bʉt$$t$1t$$3\$\\$$\$\\$\\$@3\$<3\$X3\$(Íbʋt$$l$\13l$ l$b΋L$$3L$ 3L$<L$@L$T3L$Lt$<1ыT$@1ً\$  bӋT$$13T$,ڋ\$,T$ T$D3T$P1‹D$ 1l$$bʉl$$ʼn13D$@ŋD$@D$@D$H3D$T3D$(1bʋt$ NjD$@13D$ |$@D$,D$X3D$D3D$41ȋL$,bD$@11ȉl$D$(D$03D$H3D$8=bʋ\$(1Љ͋T$,13l$,ËD$`X\$`D$(t$ D$T$L$C SKsd[^_]É'D$@@#Eg@ @ܺ@vT2@Ít&'U1WVS,\$@l$HL$D3{L$?StG@)9FS2T$|$L$$z?T$t ,[^_]Ð)|$[?v/t$؃@@A?wL$E?L@L$tL$l$H\$@L$D,[^_]t&<\$,\$D|$4l$8t$0t$@;kD$`` $ȉD$ȉD$7)?D$D$D$D$$1Tʉu\$,t$0|$4l$8<Ð,|$$|$4\$t$ t$8l$(l$0<$tF9Ct$|$,$D5؋t$ \$|$$l$(,Ð|D$D$$$D$~1҅uD$ 1%=@‰Ѓ| UWVSe$1$$DŽ$󫡬 9; D$\$$=} D$$$ 1tC$u$$D$$] $ D$$+5 tI4$!<$D=t|/t/|$$x<$@D$,D$t$$HutD$<%=ud D$D$ $v= ) l$  $uf $e3Ĝ[^_]Í& D$/$tF$ ǡ O$$!t\$$a ;t&$ǡ V$(a 襾 $` D$p $` D${|$t$$` GD$$` W\$D$<$c> v'VS$;/D$$@$#a tD$@$@ !%tDJD' @\$D$@D$D$ D$D$$ = [^ÐD$ D$D$@$4$D$t$$/$$3T$$3D$ $$3T$|3D$x D$t$$@?/C Dt&D$\$$ x=\$D$<$c> 5t&$Pa DWVD S\$ C18D1c <$D$tu1[^_ÍD$$4c $D$聐1[^_Í D$ ҉D$t $a $b s,D$ L$D$T$D$0c D$$,Ð&VSDHuD$`DDPLHu<uG1҃9rtft[^Ðt&Htvf묍vVSPTuP$PPP XTu<uG1҃9rtft[^Ðt&Htvf묍vWS\`u\$6¡\ף\B00d`u4u<1tft[_Íz/tf뷍t&'WShluh$¡hףhB$$plu4u<1tft[_Íz#tf뷍t&'WStxut$¡tףtB00|xu4u<1tft[_Íz/tf뷍t&' L  R 4XYW  d  R pU   S8-t9&9t4QӀv_tQЀ vQvكAvѸ[f1[Ít&UWVS@$\UtW11U4Ft31ېTId tt9d tWd t$;^rЃ4$;}r,$[^_]Í&'U1WVS,҉D$T$D$t<Ӎ& 19uЉ)‰T$T$t@D$ft29ku|$s 98uڀ| uӃ,[^_]ÐT$1ۋD$iuD$ $6L$T$L$T$Í@ $ T$L$kD CD$$SЉ@Wd ,[^_]Í&UWVSӃlD$hd $D$E*JFdl$DL$$D$,$}\D$DD$\$t$ |$D$d $5eL$$T$DD$$L$yat& $L$$"L$$l$D,$,]L$$t$t $T$,t$ |$$0e T$D$謝& rT$4\[^_]ÍD$D$\`T$,\$t$$e T$ `t$t$$\$\$ 4$Ut$D$ ؋\$&UWVSLD$Zt$ l$4XZXZ X ZXJ1ۉHBD$B4$D$׌l$4$t#D$<%=@t'l$4$Ȏu݋D$L[^_]ÍD$4$tt5D$8T$D$D$$T$3sf$D$T$빍UWVS<D$ED$,T$ D$$u ]t&D$$T$ B:uT$ t$(D$$N|$ D$ t$<$ÉD$,\$(9D$ t$$;\$(D$$T$  tD$$T$  uދ\$,T$ D$$3x4 KJKJK J KRS\$,D$ l$$GCD$$lC ~U1"D$,T$t$$iT$9t/T$$t$ D$ ~uȍD$,$L<1[^_]fD$,9xuT$ L$T$$U<[^_]$d bfUWVS\$0|$4u.)$~D$/<$u<$ sk $xI<D$~C $0S CD$DD$$k[^_]VS1ۃt$ tGxAF$ t2F~)0&9^~ F $u1ۃ[^f[^ÍvUWVSt F9sL uF9r#|t([^_]Í&FfFf< uƒF [n^_]ÍYf'f&ƒ Id $t$|$t(09d tt`_ ְ8u$t$|$ Ít&ֿe $t$|$( ø볍&'VS=Id tBt>=9d t7u v[t4$D$3u[^Í&1ۃ[^Í4$1|$t>lu!~fu~u4$|$Ðt&n 4$|$Ít&'UWVS,D$@D$e D$D$DD$D$$MD$D$.$虷D$D$9D$l$|$)t(t&3|$l$4$Fu<>t<[uD$$豜|$,$sCfD$e tIe t,1[^_]Í&D$ \$@D$HD$D$D,[^_]wt&D$\$@D$HD$D$D,[^_]v'||$t$t$p1\$lÉl$x$D$TD$XD$\tg1D(rD$D1L$HL$T$DD$(D$,D$4|$L\$P$D$($dzL$t&\$lt$p|$tl$x|fD$4\$TfL$$D$WD$4$0ulD$($0uDt/t$TMUEut$XL$TT$Xut$\D$\u$Ldt&|$1$e ۍt&|$1$e 뀍t&|$f1$e TUWVS|$t$\D$hl$PD$lD$PC D$T4$D$XD$D$\D$`D$dD$@. D$DD$HD$L+'D$dD$AD$DD$@D$ C,$D$tS4$t$xKD$X D$h1D$hD$$D$8@D$$4$D$(=uYCD$D$D$$$0NjD$$$ruNxJ4$1u`,$J |[^_]fC$f D$}|[^_]Ðt&C$0f D$X4$耰tD$C$e D$3뇐UWVSӁD$($t$He$1҉L$D$D$(t$D$$~>D$lD$$@D$\|$T#ƋD$dxD$3D$,D$4tvt$,D$3Id T$NT$D$<;Z$L$ L$k+D$ $L$ D$t$$t$CHvL$D$$4$L$xh)D$D$t$)l$ $=Mt$|$v"e uC<$<:tJf댍t&D$3D$,D$4D$$1|$3Z$KfD$sD$$4$D$躯y)ЃD$D$ 4$T$8華gD$8D$ $D$it W9:D$ o)D$ vl$kL$D$D$e  $L$$sT$D$($D$KL$D$D$e  $KJfL$D$\$L$$KD$<$譩T$|$3JZL$D$$t|$4|$4ED$$D$$D$1tD$$t~ tT$JZL$D$,T$L$D$D$($1 $e3 Ĭ[^_]ËFHD$$&D$$mvT$؍L$p D$xgT$|9[|$$:l$tD&D$ $p>$뇐t&1v : t o  uԋ$Q) D$|$F$$\f D$v$$)ЉD$$$=D$ $=$ D҉t$4։|$$L$< \$8S@$ |$T$L$ CD$T$L$ u C(%0= Dy;t$Z9}=3L$ ‹l$RL$H|$3|$$1 t;L$~9|$,i o1<[^_]fjrT$Dm$={L$y$D$ C~dt$NItT$ 1|$, \$(vBB 9˅y݋qΉZ2Ӆ~'T$ 1BB 9uߋT$ Dmt$ FV AD$ QD$ PD$ l$$p[\$ s\$(|$,$i m&'WVS5t4=~fD$я9u<$ŏ[^_ÐUWVS&LD$P\$$kn {@@@ @$@(D$\t$D$4,T$(L$`D$t$Z/ D$hD$D$\D$LD$PD$T@D$ D$$Z,D$; $0 t$LD$ D$; 4$ L$ $i4$D$D$D$D$4$|'T$X[ƉD$`tC$j D$8DCvt$D$4D$dD$ D$hD$D$\D$@$u+D$t#D$dD$; $BD$\$j @D$Bvt$`t L$D$`$k L$Ct$`iNtkD$Z/ 4$ D$#; 4$t.D$; 4$tD$/; 4$_fZ/ ?C7u/ދuߋT$$tE‹uU<1[^_]Ívt͋C<$0l @D$<C<$-^$%^랐1ۅD$(t+D$(D$f^@D$^$uat6u\$(\$$/OT$,G$dtωyËD$,$CD$,$|$Ɖ$r9u֋D$D$;11獶UWVS,\$@u2t&ST$ֹC4S<BRkSPUPUP U @EC0 ȨC0D${T$ ЈC0T$Hu<wC4p,[^_]Í&t$tL$ $u&D$C0됍vL$DkLt&D$,$D$uD$C0SUWVS$e$1$$D$C@$D$ D$l$$o,$D$[D$ D$l$C$4,$T"9D$$T@l$0D$(D$,n D$4U D$8$蚀,$l$PD$TD$_D$DŽ$|...$hD$)D$$$^D$,$*D$(D$ l$D$$/,$E=,$PMt t],$:MuD$$D$D$$D$f$e3D$u[^_]ÐNY&'VS4\$@D$,D$D$(t$DD$$1҅u 4[^Ðt&C@D$$pST$,L$(tD|  EˉT$ D$4$L$D$l  4[^Ív  EӉT$D$4$L$ D$Tl 4[^Í&T$L$ D$D$l 4$%v',D$D$D$D$D$$&+D$,ÐUWVSG)ڍDT$t$$T>"t&D@0,D$($B?$(떐t& |$|$ \$t$te tr($D$ ET$4$D$\x,(4uΉ<$z$n D$0v\$t$|$Ít&D$$E) k1T$|$+ 00tÐt&JËD$0HÍv'WVSP$x$&t3t.R҉uP$1tt& !Ru[^_f Ή3zR뫍t&'ɉ\$Ét$t$ |$t x 9{ r5T$$tt J 9K s\$t$|$ÍvL$$ƍ&VSÃtaPt&C StA9D@09"BD$C$T$(PD$L$(PhD$@L$(P=AT$(B=J>@b<߃AB=D$(H uCL$(A>D$ D$$SOT$(Xa$@t $D$p $T$$FT$$T$(B>L$( A>D$(H>T$(B>B>D$(ǀ\D$ D$$NT$(\$|t $D$q $T$$ET$$u6T$(B>L$( I? I=@A>ǁ\?D$ q $T$$~ET$$D$q $T$$^ET$$uu$ u "D$1q $T$$DT$$tND$;q $T$$DT$$xD$Jq $T$$lDT$$u$D$(H=D$(H=T$$D$Uq $T$$ ƃ-u({rq{N{m{D$aq $T$$CT$$u{vu {HD$fq $T$$CT$$D$oq $T$$AD$yq $T$$%D$q $T$$NCT$$D$(HA0L$(A@IAȂA@$@u 8!D$(H=T$$D$(ǀwD$(`@$T$(D]D$(H@ D$$q xD$(HA3D$(D$(HA T$(BA BAD$( H@ HA@D$$wD$(H@ HA@D$$hwD$9ύD$,\$\$ t$t$$D$D$($ t$(t$\$ \$D$$m'WVS0|$@t t0[^_Í& Љ_$谙t։<$G\$t$$D$G$D$t$$tPD$,%=@t`=tًD$$$tɋu щt$$uG$5G0[^_Í&D$$$,$g$\$r D$&VSD$ p$tBu ‹C$t$C$|u vu[^Ð&UWVS&>Ѓ  ‰G$XW|$$D$vuɃ[^_]É'\$\$,t$t$ T$$ t$D$C$m1\$t$ UWVS^pD$0\$4D$D$ D$\$4$u7$@$ډ1T$0$‹D$ 1҉ЋT$\e3l[^_]Ðt&D$4D$$T$H$ D$,D$4$D$(T$,$$D$,  ‹D$,D$(Ѓ $ ‹D$(D$,T$$D$D$ T$$lD$(\$D$D$ $T1t&ft&T$ t$B$4$D$ 1҅^$D$ ^ T$ .t$B$J4t&D$(D$D$D$,$4‰NjD$ <$MD$, $* v r D‰\$t$$ S\$$CSD$C $D$ M~)C[Ë$s D$D$(D$D$,$PPUWVS$$$D$dD$8e$1ɉT$,L$HD$hD$lD$<tQT$<$n D$8:-.z-$zL$8T*t D$deD$| $D$DD$@D$LD$0vo o  Oo  <m "o  D$TT$,L$0D$D$@t& tD$,D T$,tD $e3 D$| Ĭ[^_]Í&;$D$|D$DT$,\$TL$0D$<\$T$\L$TD$@k$TT$,L$0D$<\$T$\L$TD$@k$W&D$TT$,L$0D$D$,o  5o t$0BD$dD$, T$0D$*; \$D$\D$TT$TD$ $@kT$H1tT$HL$,A %`x}p$@H-DT$,D$8$T$4v;o  tFEo  uXL$,a|$$ t&F= $at6<C=tЅűFt$$D$뷍&|$$g l$  |$ pL$, $C<C=@gC=b1tq ɉL$$tg\$ t&T$$*]$t;v;D$$2L$ (ƉD$|$ $ 5F[uȋT$$R҉T$$u1[^_]Ít&<|$$t]<t<< C= ‰C=tf4$4$c<#C?t ~? ‰\$4$pD$ t$$WC<DŽ$ ҉$ ׍t$$bu닔$ \$ tNDŽ$ J:$L$(D$ #D$$L$($ u\$ u&0x$1؉;0u+DŽ$${?MD$($D$ D$$tlP$$Pt;C v @$ډ$t@Tk tK9sG$uD$$C=4@4$K=@|$$辪xt$4$T$$l$ $`F<$t9L$ 9J w@HttI@uD$$l$$F<tC?0y$T$ S>0tNt$ tFD$ t  ։1@tS> 1uuӋ$L$ L$(MT$ 1DŽ$ t'|$ $ t$$肩u닄$ T$( Ru$ \$,T$$ft_1f1uQ$t:?uRu@uхt(D$$뿍& މ1@uԋD$ \$,t@D$ t&1u  ։1@uދD$ f"@uD$(t&"@u$ $zL$( $n$T$ C u9D$$vuC?t$ <.E u<9D$$t-T$@u 0ۅtF$1ۅth1ۅÍ؋t$ \$|$$l$(,fF$ruO<Őt&Bfnt&'L|$D|$Pl$Hl$T\$@u tˋu$E$D$\$}D$,(vC$tPuBu8t3t?G=@uՍD$,$ډy[t&FvD$덍t&vD$0{\$读(v'VSÃP0$@tt$$Jq&C=@u&Pt;F wى$xJt$$|tt [^Ív4$-5$pw D$Mt&1[^Ã4$5$Hw D$#vUWVSÃ<@><u&H~Hu⋓LtLtS>Ћ{C>t$蛥stN1 f ;ss=t@t(uރ  у \$$G;srfC<$D$ZC><$t<[^_]Ð1-P$tKՉL$(D$,\$$ut$H@ ‰D$$XH;XL$ ry1ɅtlD$ 1҉l$f0>u 9tl$ t u' ut!A>uDn t$t&Í*  DÍ&A?   DÍD$$D$D$ $i8uË $T$ D$ D$$e $Ét$$|$ljl$ Չ1tftЋ|$C+l$   ω t$ ȃƒ ЈC$Íxf#mff[&S<\$ $\$gCD$CD$C$[ÍSD$$$R D$D$ D$;8t9<$Ë@x$Cx$$Z$n &'UWVSà D$D$- $!$E t&UW1VS\\$pCu K1"u S 71u C^D$x $\$D$H$ tD$LD$H CD$L$ D$LD$D$HD$$D$H$ SqCFfC CgC1ۅt$B \[^_]ÅC$ *D$H$ T$LD$$T$ T$xD$D$$D$L$ cC.SC2S~$D$jC$o C C ~D$$+C $0 Ct$~CtR0uJf3 CPSpt3D$=4$34$uCPSpuԍ&{ t $  S C@S21t& uT$$KT$2D$Ax ʼn4$4$D$T$D$D$L$19L$tsE EXx \D$,t$$T$4$D$$D$D$(D$[x .4$D$T$D$E2 t!L$؍t4uDD$) ,$l$E$,$$8,$cx D$fD$0$^D$41CC"t&D$8$|KD$81C Ct&D$@$D5D$@C}vD$ t&t9s)Fl$L$$t V9r[^_]ÍUWVSÃyT$gD$ D$X9D$  11S 1ۅ~1 ufᐅuDT$1+l$  nR11ۅ~1 uf1뾍t&u4)Ńn [^_]ÍFF [^_]f1΍UWVSLD$4l$dT$ ‹L$8D$< tы $T$Ћ@D$R~:Ot a:LuZ9uD/ tED$ D$ L\$<Ét$@1|$D|$Pl$H8-t\$D$ D$D$4$> k1D$,tX.tO8ȉt$uCL$t&t#t8uD$C$DŽ$DŽ$DŽ$D$4$xSZ$1C$D$4$TGK6C$h <$$} D$$t&$-`$É$׉$t 5 $ ֆ1i8f4` G6t2D$$D$\$$ D$4%=9`G6$D$)D$F${G4D$ D$ D$D$F-$$$$$ĬÍvDž` fF.fF-.$$C<$9۬8t\$$!} 膅D$<$G4O|$D$G$$%D$P$DŽ$DŽ$DŽ$D$\$,$PxEG6tW4D$$$T$$,$D\$$*} 谄G$7} D$}'fz4\$Ét$u" @1\$t$Í&$D$X¸uҋFF$t$C1\$Ít&S\$ CB$9G$G4%=T$ D$<$T$ t$D$T$ XGRO$$T$L$7L$(uT$$4$(t&|$(ֹD$$f9D$B6L$(A6ֹB$ D$\C Xt&J0CRNƉJ0C \$\$ t$t$$CHD$CD${ D$C@u;C5t DD҉֩t\$t$Í&DDC5҉uʼn\$t$ÍVST$ \$$B\tR`D$$T$ل1u*$$t$$D$H [^Ð|t$p$\$l$|$tl$x/FD$ Ft C6'CD$Pl$ D$TD$X T$T$DD$LD$H1D$DD$<@D$ D$,,$CvCD$,|$PD$<$D$$1҅D$,T$$e,$T$贘D$\D$<$$Vt C6D$\\$lt$p|$tl$x|ff{4uI$1 ҍT$\T$\$$<‹$҉D$\uVT$t&D$$(uNC$C$rD$$ D$Yt&<$×$$T} XfL$\D$\$$L$ F$腎UWVSL$tT$T$lL$P$pD$h~ ME D$Lk D$L1ҹ D$X D$d 1E!Ћp DEL$XT$\L$Xt,$T$Ћ@D$dD$,!${F t&$d$D$pI1$d$(a$d$$h$D$`~UD$df$h|$L$LB4\$ L$D$ D$$$*D$lt4$&t$t$$D$_EuL$` T$dI $7 rD$LD$lmEhc$$dD$pD$D$`T$$$h$T$TT$L$$D$d$$ $dU$dr8~  DŽ$4$1r$ D$h|$h1󫍄$L$P$E $%$E|$m$tL$hT$TD$pB$ 1$DŽ$ED$H$Eh$4E$E $tFD$$D$T$LtBD$LD$E $ D$LD$ D$ $q$ExD$H$iZƉ$Exn8F@Et $ PXF&t$`t$8$Wh\$dt$<$@hE|t&D$D$ $ t&D$LD$P $|D$LD$ D$$Ek$QD$$$o$y$DŽ$ [$\$$[g$@ $Ig$@$7g$@$$%g$P$g bD$(TP3{&F4fW4f1fG$oL$LT$Ht$\$l$D$(D$|ċ$($uWD$pD$4@$pDŽ$ DŽ$DŽ$EP$E%$D$81dv@6t$0uv1$$9$ T$@ȃt$8p$;-WCP҉T$@% L$0L$0A6q$pBvL$0fy4fx4 L$0D$ $DŽ$LDŽ$H$蕰$Lp$+$HDt&%=@+vD$} $ vW$p7$pDžv1ۉt&G|`9Q4F tщPƃ|$0v L$011틴$(1L$8 v u-l$8t&;D$0 J uZRt֋\$0$pL$0D$t t,$T$Ћ$ @D$t$p$p@lrpD$PPED$PD$P2D|$PD$PD$`T$d D$X D$\~*D$P^;\$PD$XT$\} t$Xl$\$p P  D؉$ DE…ɉ\$x$$ 1D$hD$lD$8D$<G4VNFT$@VL$DNT$HL$L<$VÉ9\$F  D$CD@09|7A$D$$ $/:$$ t&$ʍ&fx4D$$MCDŽ$HH$$$LST$0RT$@D$8$D$ D$D$$ $ZUL$8$ $pD$$ m&o0l$0Ճ t'<$D$ҋT$@$UG4Cfkdټ$l$$$ۄ$5  f$٬$\$٬$C D$ D$D$ $qTC 9u|$PyuO&@< [^_]Ðt&|$U$fSP<<@, [^_]fPDf9})D$  D$D$ $Í&St@>u T$ $42[Ítԃ[ VS1ۃ@@@u#u[tFt[^Ív t$Ƌ\$X$tFPt؋t$\$ ÍS\$t$ sv,\$f;t$ ։|$$ωl$(rsD$$CS PSSDf9s$44$Et$$D$\$t$ |$$l$(,Í,,$TEl$$D$d UWVSӃ,H(1G|D$$CS PSSDN(9}wV49uع|1FTT$~D$$CS9l$ PSSDϋN(9|t&F >F,[^_] D$D$fÍVSt$ $H{*ásCCCCCC C(C,C0fCDC$$*C4C$$)C8C$$)C;D |$ Zt$~09}At$x49t$u|$w@> D$x09|t$\$,D$(O,|$$1T$ |$1T$39l$ ~ ftV8/PN09}YF@ 9;D$$u;l$t9tT$_V8nN09|F M^0FD$$CSoPSSDT$FT$NDf1D$|$f-V889؋|$.V8D$D$vD$n,D$8~-N81;9Au&;x9uD$ D$D$ $. W>&|$ Et$y9~t&9D$$D$L$ x0\-5L$ ~u 9~ |D$D$\ؽT$T$Qع|~D$&T$D$.~,D$(~"V81;*Bu;vƒ;ht.9uD$ D$D$ $. ЍP9rD$<vD$,T$,@<T$8D$+D$+JD$,ى<$^D$,@<D$+)9ЉT$$W9T$$t-L ɉL$01ɀ|_1 l$0u19T$$t&,1 1ɀ<_ 9tT9!B <_ u6t&9B <_ u9sVL$hD$+؋l$8)GD$h|$ D$D$t$,$-v1L$u$L$T$\$$t$(,f4$T$L$&t$$D$L$T$$L$T$$D$D$z \$$t$(,Ð$\$Ét$)&$5Kt $D$ɹ- DD$ҋ\$t$Ã,T$Ptu"t$T$,Í&D$D$ $,Ív\$Le$<1$Ps$T$XD$C4$D$q(u7$<e3$L$P$T$X\ËCCtw$<D$D$ D$D$,$)T$$D$ m)l$,9t$(D$0D$ D$$&{ wVT$0D$DL$(D$$T$61҅t(D$Dx L$Hxxljf T$$u9D$ t&ljͺ͐t&9M|$|$LD$S D$ D$D$ <$!%tDQDD$ )$D$ D$ >,$ T$ ¬$D$ D$ LD$4BD$44t&'UWVS,\$@T$9vN{9s{{ u&{ t9ul$DD$D;vu9r,[^_]ÍvD$DD$=D$D$$,[^_]ÉfUWVSD$0$e$1D$0T$PL$T;D$0t"'D$0t D$0ǀ@d /L$T|$ $跫D$X1DlrD$0t&pPuXHuT$0$ BL D$X D$0D$DHhuCP@u<D$Dt.h D$Dtt&p iuD$Dtl$TD$8D$<D$HD$@v\$DL$@tL$0D$@;D$8D$0#T=T$,)T$4S$ $L$,t%$x$x9O>C<uD$4$DŽ$D$T$ $CD$l$$z$ _D$0t L$T|$ $訩1uqD$XD$HD$@$1uGL$0iHu uD$؉|$,$aV;|$8rt$4|$Ll$\ ǀt T$8L$T,$T$T$PD$DT$Pc1\D$0T$,L$T$T$T$PaT$P$P @L$lT$ $D$fD$0T$lT$PZXTT$P$$hT$0¬$T$PD$0lD$0:^L$HD$!N D$ D$L$D$ $ڋ !%tDJDD$0)ډT$$\$$D$ D$ T$P$T$0¬$T$PD$0D$0D$ D$Ŋ $\$t$t$ |$|$(D$@$xÉ<$|$CN CC CD$$CF ^ t$\$Ít&'S\$ D$@$$T$$PT$(PT$,PT$0PT$4P SC[Í&'S(\$4$`T$@\$T$T$[uًl$D$$|$ËD$$?CP C&D$< u!D$t}D$$Ct&݌ t8  D$t8D$$C l$fD$tD$$|Cl$D\$,D$@͌ t$0|$4l$8<\\$L$t$Pt$d|$T|$xl$XDD$D$4$A61҅u;t,T$Wt'|$,$\nD$ $D$t$$xD$x%$FD$ $D$ {LD$$ D$ht.1CBtSDT$1҃{L$‰T$[{LpF,eD$PxCp$24D$PCDT$`D$LD$@D$lD$HT$t$D$XD$@D$ CL$ MSp҉T$,qT$,$qT$h\$1t$$Dt/$su# $ D$D$ D$$|[^_]Ðt&HH<-\$4D$`$D$蠐D$dT$h PT$dT$hDT$`$D$D$M 訕D$8T$,D$D$`$T$茕T$`$D$8D$dT$h PT$dT$hD|$d|$D$ $BD$|$dv  $T$wSAD$PD$D$lD$ D$DD$t$$&F$ |$D$D$ D$h$gf$ &D$dt&F$VcB&CBD$xt&D$4\$<4T$0T$d9T$0< t1111ɉ\$4v1<@;T$0< tvt<@1<:ÉEō\$<&룍t&t$$$ &t$$ 1\$4`+ \$\$ t$|$`4$?mku.CPtC@tQ4$葑\$t$|$Ít&ǃ4$`1t$\$|$É$ tC@ t{LttWt34$T$Ћ D$T$ PT$@$ $ D$/D$U $fUWVSKC  T$DD$ D$͐ D$4$ǃ;"SЃB@Cu1Ʌɺm  Dt$$ D$ D$4$HSDž=kt$$ C8D$ D$p4 D$4$_vt$$ @|$/t*D$(@t t$ D$D$$ /<[^_]fD$Ԑ D$4$D$ɐ D$4$hQD$(@t$ D$ D$$ t& ~ t& 8E׉D$T$ D$ D$4$CuˋEfɺ  DS\$ L$u7D$u$ [Ív$ [Í&D$$ [Ív$Xt$t$ t@1$t$Ðt&Xt(~,X$JB1t$Í&Bu"BZL$ ڋt$$z fB 돐,|$(ljȃ\$ Ӊt$$t2Ot%CS 4$\$ t$$|$(,fBu:u WtCu v$ܑ &$4 CR 4$u뙍v1҅K uS 1\$ t$$|$(,ÅC [ 1U3=5/7-'<$t$<$D$$1&Ct GC ډ$D$\$<$St&1ɅS u  1XCet GVD$ډ$¸[D$D$D$$S9vtC S 1#t&tC S !1 vCt GD$ډ$¸D${ D$D$D$ $T$1:CS/ 4$cCt GC ډ$TC 1>D$D$vD$D$v1~fC S 1C S uC S 1t&UWVS,D$L$IL$9j\$1ۍr$f$< 9l> DڋuD$ tyT$B t&2 uL$t$ $(NjD$p>DD$pD$|$$S<$ ,[^_]f\$1L${EL$AD$,[^_]`뽉'҉L$tT$$I %ÐD$$] ÍUWVST$0l$@|$D!19rtftD$4zBD$8D$8BD$$\$@t$D|$HL$t&D$$s -뱍t&'D$ D$* D$D$ $D$(D$D$$$t&SD$$\$ tHT$$T$D$ $(T$$:uGuS 1[Í& 9}fL$(D ΐ)(MvCS/ $q[ÍSD$ X D$$D$$a1[Ð&SD$$\$ T$(t,D$D$$ox S 1[Ít&Ҹ uˋC fCS D$ [t&L$ D$ɋP uxvt!~-1Ít&1Í&x1Ít&Ґɐ&<\$0\$DeD$,1|$8|$@t$4t{t$t$$Iju=4$MctIW $T$ i1T$,e3uD\$0t$4|$8<Ív\$$ 踳΍\$$ʑ 蠳붸2fD$|$ P 1Ív'WVS\$t$t#t!1 $8t9ىu[^_11ɐD$f$9ˉvދ8ҍ:xzxzx z xzxzxzxzx z 8u[1^_ÐD$T$Ít&L\${tf눍t&'S\$ $zu ؋$\u1[ÐT$D$&'T$1ɋD$S&1ۍt( uڍL tuɐu܍t&[ÍT$L$ <-t<+uB|$<;>tk9une$Le3J\[^_]Ít&9tx u,1|9wt&\$<\$<$)T$,T$LT$D$LD$ $D$ D$D$0D$L$!D$4t`T$,1|$T$D$~ D$ l$D$ 4$fV\[^_]ÍD$<<$8t9rt&9vC u)D$(D$D$ 4$]bD$(1L$( 9m";wҀ t݋D$(T$@1$D$@D$DD$D$H\D$@$D$\T$DD$Ht$D$$YKCS PSSDF>.u<.uF<.t1뗋C19D$$s=K|1L$,-|$,vLp-w ;D$$uT$D$$OD$$O G4L$,+T$,W8D$D$$+D$,OG<ԮD$$TJCS-PSSD[D$$1Pt&S(D$0D$D$D$t4T$4\$D$@ D$$T$ R$J([Í&u鍶'$$\$$$߉$$P1$$ҋ$l$$D$(FD$|E,D$0t+T$T$ܕ T$D$ӫT$us$\$ D$ 4$D$ R1ɉD$$D$0;E,t$!$$$$ĜÍT$,$LD$0xvUWVS,t$\$Hl$L|$PD$P4$IT$DD$ 4$D$T$DD$$D$4H,$l$$D$TMD$TL$T$$D$$GCS PSSDD$X~T$TD$ $T$Pt<$蚮|$$D$L|$@t4$H,[^_]Ív$D$pGCS PSSD4$pH,[^_]ËD$$D$8GD$$D$D$D$`Lt&'UWVS,l$D|$Ht&u1ۍv< uE&D tuu|$@T$L<$DD$FD$Lt=T$LD$ T$GG$DD$LGtm9WG\$t$<$KD$<$5FGW PWWD1ۉE2,[^_]ÉD$D$<$ED$tO \$\$t$t$tt$\$D$t$ Jv'UWVSl$$B,$D$XRT$@$D$\D$$xl$XD$,t D$,D$Xŋ$ET$0҃$T$(D$OuuT$@umȅD$@t^111t& Lօt3t1à LօuD$@T$\D$$T$8$R T$<$T$D$T$4t&1 t&D< uDD$X$\M u0E룍vt$$$B$t0ҍ&@uk2T$$$C$r$|$0ND$$$D$D$# $H|$Dl$H$\$$($vD$D$m ,$LXtЉ|$$u뾍D$$D <L  u |$4l$X$l$\$$Gl$X\$t$RD$X|$0D$Xr$\$XrT$(\$T$ $T$$$$$ID$D$$B$|$OBыR PQQDt$9rf$B!D$,$l[^_]f$CPD$$AT$8ED$ $* T$T$ t.}aD}l:}l0}&t$$D$\$4$2D$,$D$HB@$蓐4$[.,$SzC1\$dɇ'UWVS$$CD$ BdGD$$grm 1t&DD9u V  ԗ   D$8D$|$1D$ D\$8D$P( D$T 4t$,1T$(\$$t&;5D@D$dD$pD$|,tlD$ ֧ [^_]ÍvPJЀ gp1ɉ҃ LJZЀ v9?T$ /VB< %^1ލ&҃DBJЀ v9T$ Vt&UWVSLT$`L$dZD$0‹I\$4\$(ʼnD$8D$lL$|$u7D$C\$,t$0|$4l$8<Ðt&$ YCЉ,$i$ D$M'@T$$D$@F‰D$D$ $tÍ&UWVS,t$@\$DF " $Y$FD$t0ڹt$ t< uu$]YŋD$hD$1 h^D$ $T$~rT$l$1;!E t9tz1;!1Åt)؉$D$Y‰ËD$HT$\$,$D$ruT$u&$nD$D$$9d,[^_]É\$$t K\$$L Kt&UWVSl$0U tF}~11ېG$$-p9G$n<$nE E[^_]Ã,T$0\$D$4t$ |$$ l$(֋l$88uUtuF t1H ued 1\$t$ |$$l$(,Ðd ݍt&l$8\$D$4t$ T$0|$$l$(,\4T$$0 JT$D$$ JUWVSD$0=ZT$4|$8D$ uv Vutwj10HxnkU9tpPxMw]kU9rRD$ ˾N)ut$ u1[^_]Ít$4D$0Ш [^_]JD$4D$0 [^_]Jt&UWVSl$|$t$tXt&1 ÃtukU)É؉ uփu[^_]Ð<|$41:\$,Ét$0։l$8l$Du^D$@L$D$$D$ jǀ>uktl$ D$ D$${rlj\$,t$0|$4l$8<ÍvL$T$ D$ D$$@rL$wt&D$ z D$ D$$rn'UWVS\T$tD$ T$T$p$=p\$tT$pt$tD$4D$UM E$Pk] څU$t kE D$E$ICE kE @뛍&<\$,ál t$0։|$4|$Dl$8l$@t p ,$L$`l$$l D$$`\$$l D$L$t$D$ $l L$<$^`|$$l D$t \$,t$0|$4D$@l$8 $D$D$DD$D$lD$ D$DD$]RT$0\$4Ӎv D$.$M9u\$4T$P\$D$3 $T$ R'\$1Ҩ¨l\$0 kt$@؋$8 $$<΍t&$0D$TDŽ$D$ D$ T$T$,$TL$T $¿|$$T$(D$0T$DT$(D$ T$HT$ B1;T$$$uҡ,Ep4$FT$ ;Buz9uET$ L$H+L$D0\ S s XZXZX Z @BT$$L$ R4Q(@ A$t&T$ ҉T$ T$ Bۀ|$O$@ $I$@@@  $@D$$tC|$0tD$0؋$Au[^_]Ë\$0t"Ct$@؋$8}uދ$@ $@D$$Bq'UWVS,\$@$=1҉Ƌ@$tf@u$1F+v$t6t&>O:yzyzy z IJvuыT$Hl$$D$T$T$DT$ ,[^_]ÐUWVS$D$lD$pD$t%D$@0uED$@҉D$@E‰D$<1ҍ,]s4ftl}|$04ft\@tNtF@t8t0KD$0L$DHT$,L$L$D $F?T$,tvT$,$LE$AL$ll$ $T$,9F$?D$lD$pD$tČ[^_]Ív8uJC6t|$0G6t[T$,D$$ߐT$,u؋]0`L$D19D$T$,|$0T$,D$<$T$,C|$0G$9C$CC$=D$D&D$||$0D$D$0L$xT$,L$D$D$ CD$|$$T$,[$L$x9)Ήt$HD$Ll$H |$0G$|$|9s9)ȉD$|\$0D$4l$0|$RD$R fD$Pl$P\$Tl$RD$T9D$@|||$|D$4|$H|$0|$Dl$0 D$4|$0l$0D$@\$@D$4\$0l$0v|$H9s9s t&؋MIL$D\$x1 D$|vUWVS\D$D-D$HD$L҉T$D$(L$(LɉL$,,L$,A Q T$9rtP|$(u_|$,D&C9w܍&)L$$T$ T$ 륉=<$D$(3$9D$T$ D$D$$C6C\$0t$4|$8<Ít&+t\$0t$4|$8<Ít&'$0\$|É$$f~4L$,6T$(4$2t$ōD$TD$,$\sT$(f~4D$XT$(4$t$ǍD$\D$<$$t$TL$\T$(D$`<D$l1D4rT$dT$,D$hD$4$D$i D$8D$4D$D$lD$D$dD$ D$\D$D$T$t$ht D$T$/t T$\$/\$|$$$ČÐt&s1D$TD$Xf~4t$T11D$\D$`1tD$LD$ CD$D$@$D$(4:D$LD$ D$D$@$D$31҅‰UWVS\e$L1|$ D$BD$@T$D$DD$HD$<$.5T$?1B8BD$j 1ۅd<$80$.D$@D$DD$H$Le3\[^_]Ð4$Ȣ9~44$轣uًL$,$tōD$@t$$՞뻍v9~?$wt ލL$؉,$Pۍ 1ۡ$93.\$LD$ \$|$$1<$.\$$ o UWVSLD$(l$`T$,D$$k~D$(P$X<11;uI&;D$8tbD$D$8D$ ~D$\$,$g1u D$<À;uD$($蚆L[^_]ÃL1[^_]Ít&{t҃듐t&1u‰))ʍ0tD$,T$t$ $D$T$$l3T$$uD$ < D$D$ $ 3&'UW1VSӁ\,$e$L1.D$@D$DD$HD$؃D$19~&fx4uxCfx49څ~"1ېt&$ş;|D$$*D$@D$DD$HA&Sfz4t$~qvL$<$t$Le3c\[^_]Í&1&SCfx4un$;52fx4t΋Sfz4t<$ܟu‰<$L$L$D$C<$9D$u땍vL$<$tD$@\$$ƚs<$L$L$D$C<$9D$t&|$ D$l$<$0\$LD$ \$|$$-<$+\$$" t&D$ $*)v'D$P8u @$1҉$ټ$$߬$$ t$0f$٬$ۜ$٬$$fl$PD$jU )x\$pl$|$$׊D$tD$ `r D$ \$$gT$pD$t$|$8tfD$t$|$@D$l! D$ D$2$p D$p$T$pD$t$.\$ D$ $8ifD$PD$ \$ D$,$ iD$ &D$,$hfD$P|t&D$,$h[1Í'WVS1ۃt&r 4$t4uރf[^_É'\t$TƉ\$PeD$L1|$Xt t"T$Le3\$Pt$T|$X\Ð |$8|$ D$CD$C $yuSD$,$ʳ$^VT$D$D$ D$@D$d $JD$|$$薷D$,FFCUWV1SÃL$T$4L$<ۉD$0ttD$48CQD$8*,vE9D$0T$4|*/ f{T$4|$4lv*t&/ujKfx^$P$D$,D$H D$,@@SVSU9T$0wƋ\$0D$/)l$4\$,$f D$<D$l$\$ D$D$d 4$ùD$`D$4$D$ D$8L[^_]Í&D$4S8Px/S8Px/vi+T$49T$0Y8SM뻉ސD$ N D$D$ $ D$ N D$D$ $ D$ l D$D$ $  UWVSZu Dt&t$<$\/uېt&{uߍC K$EDtۃ[^_]É]1[^_]Ít&'\$\$,t$t$ $t$u t$$a1\$t$Ív\$\$ t$t$,$uu$eX1\$t$Í&'\$\$(t$t$,|$$|/tE;wMuD$$ډ$<1҅‰Ћ\$t$|$Ívf@D$ > D$D$ $  WVSӃ$8w]1Ʉۺ`t=`ct&YB/Z9uL?cȉD$$5[^_D$  D$"D$ $ Jv'VSD$ \$$04$Yt$$D$虲$D$ICS PSSD1[^É'\\$Lt$P։|$TD$l$XD$,D$0D$418u\$Lt$P|$Tl$X\Í&D$8D$D$D$,$s $le3uN|[^_]1D$ y D$D$ $٬ $1$ D$0 UWVSكLD$(|$dT$,D$`L$3\$4u 9\$,D$$D$8؃@D$ D$3D$D$  D$ D D$ T$$\$DT$$4$$D$Pl$<$D$ t D$dc<$D$D$|&D$ XT$D$ JHJHJ H RP1É'Ll$Hl$P\$<\$؉t$@t$$|$DL$ D$D$D$D$$D$(D$,t24$Ҝ$D$B\$D$$$r<[^_]fMt9s7GOD(맍T$L$D$<$L$T$ $O tÐ< DƒÐt&WVSp$eD$l1$$D؋K9 DD$$@CC1t4$`C {CCuD$le3p[^_$uލ|$X|$4$vuʍD$D$ D$DD$D$ <$D$DT$$ D$D$ D$0D$HD$$D$(D$,D$4D$LD$8D$PD$19rtft[tf뵍UWVSD$Hl$XD$Tl$D|$p$|$$l$$T$8L$$$D$ t$|$ L$$\$,$L$@T$8$$$T$ $L$$$|$$t$$l$\$<$t$T$L$ Ĭ[^_]Ë$\$<$T$H$:D$Ls$$t$0|$4$$t$@zl$D1ҋ|$p$$l$D1|$p$$$L$DP t9t$ 3DP t9넍t&|$ ;|$4}0IL$0t$ t$4v9DB &9ut$ 9 f3DB t9u19[^_]Í&3D$ :T$ L$4ߋt$09‰Ǹ8[^_]D$@7T$0t$49} 8 u9|vUWVS,l$HL$@|$D1u69r19t < uL$@؉1,[^_]Ív9s tވT$ T$ L$l$L$\$Őt&DE #HD]  ЍP9w܋\$\$L$t|9tBL$&19uL$&D$D$1T$9vQP @\$&\$ Ʌhƍ&L$L$t$ 뫋\$t&'L$v"09v ҃vDÍ&'UWVST$ō.$ L$$l$. h.1E‹T$ J`D$D$ $)L[^_]Ðt&`L$.D$|$L$蕾|$0l$. .L$ Q0D$ L$alloc:%llu %s max-pack-size=big-file-threshold=depth=--depth--depth cannot exceed %uactive-branches=--active-branchesexport-pack-edges=Cannot open '%s'statsMissing > in ident string: %sfatal: fast_import_crash_%llufast-import crash report: at %s * Active Branch LRU pos clock name %2lu) %6llu %s Inactive Branches %s: status : active loaded dirty tip commit : %s old tree : %s cur tree : %s commit clock: %llu last pack : Annotated Tags Marks exported to %s ------------------- END OF CRASH REPORT Unable to lock %sBranch %s is missing commits.Not a tree: %sCan't load tree %sCorrupt mode in %sNot a valid commit: %stree The commit %s is corruptcannot read '%s'corrupt mark line: %sobject not found: %sdate-format=rfc2822import-marks=import-marks-if-exists=export-marks=cat-blobno-relative-marksforcecat-blob-fd=--cat-blob-fdunknown option %s%s %lu1.2.3.4blob %llu%o %s%cdata <<feature option cat-blob Invalid mark: %sUnknown mark: %sGarbage after mark: %sInvalid SHA1: %sGarbage after SHA1: %s%s missing Can't read object %s%s %s %lu mark :Mark :%llu not a commitNot in a commit: %sNot a treeish: %sCan't load object %sInvalid SHA1 in tag: %sInvalid SHA1 in commit: %sInvalid path: %sGarbage after path in: %smissing %06o %s %s Missing dest: %sGarbage after dest in: %sPath %s not in branchFailed to remove path %sTreeBlobls commit author committer merge M Corrupt mode: %sinlineMissing space after SHA1: %sK]Bn`K֒I%s not found: %sNot a %s (actually a %s): %sD R C N Blob not found: %sdeletealltree %s parent %s author %s committer %s tag Expected from command, got %stagger object %s type %s tag %s tagger %s reset checkpointprogress option git Unsupported command: %s%s statistics: Alloc'd objects: %10llu atoms: %10u Memory total: %10llu KiB pools: %10lu KiB objects: %10llu KiB cannot truncate pack to skip duplicate%s: argument must be a non-negative integerinternal consistency error creating the indexUnable to write marks file %s: %sUnable to commit marks file %s: %smax-pack-size is now in bytes, assuming --max-pack-size=%lumminimum max-pack-size is 1 MiBInvalid attempt to create duplicate branch: %sBranch name doesn't conform to GIT standards: %sMissing space after > in ident string: %sInvalid raw date "%s" in ident: %sInvalid rfc2822 date "%s" in ident: %sDate in ident must be 'now': %scan't write crash report %s: %sfast-import: dumping crash report to %s fast-import process: %llu parent process : %llu Most Recent Commands Before Crash active_branches = %lu cur, %lu max ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Not updating %s (new tip %s does not contain %s)Only one import-marks command allowed per streamunknown --date-format argument %s--cat-blob-fd cannot exceed %dimpossibly large object headerEOF in data (%llu bytes remaining)unexpected deflate failure: %dExpected 'data n' command, found: %sEOF in data (terminator '%s' not found)data is too large to use in this contextEOF in data (%lu bytes remaining)Object %s is a %s but a blob was expected.Can't create a branch from itself: %sInvalid ref name or SHA1 expression: %sMissing space after tree-ish: %sEmpty path component found in inputNon-directories cannot have subtreesMissing space after source: %sRoot cannot be a non-directoryExpected committer but didn't get oneGit links cannot be specified 'inline': %sNot a commit (actually a %s): %sDirectories cannot be specified 'inline': %sNot a blob (actually a %s): %sGot feature command '%s' after data commandThis version of fast-import does not support feature %s.Got option command '%s' after data commandThis version of fast-import does not support option: %s--------------------------------------------------------------------- Total objects: %10llu (%10llu duplicates ) blobs : %10llu (%10llu duplicates %10llu deltas) trees : %10llu (%10llu duplicates %10llu deltas) commits: %10llu (%10llu duplicates %10llu deltas) tags : %10llu (%10llu duplicates %10llu deltas) Total branches: %10lu (%10lu loads ) marks: %10llu (%10llu unique ) git fast-import [--date-format=] [--max-pack-size=] [--big-file-threshold=] [--depth=] [--active-branches=] [--export-marks=]strbuf_setlenObject %s is a %s, not a blobObject %s is a %s, not a commitbad graft data: %sduplicate graft data: %sshallow %sbogus commit object %sbad tree pointer in commit %sbad parents in commit %sparent authorcommitterCould not read %sObject %s not a commitnot yetauthor %s committer %s encoding %s Warning: commit message does not conform to UTF-8. You may want to amend it after fixing the message, or set the config variable i18n.commitencoding to the encoding your project uses. bad config value for '%s' in %sbogus format in GIT_CONFIG_PARAMETERSkey does not contain a section: %skey does not contain variable name: %scould not lock config file %s: %scould not commit config file %sfailed to write new configuration file %sFailed to expand user dir in: '%s'core.autocrlf=input conflicts with core.eol=crlfInvalid mode for object creation: %sMust be one of nothing, matching, tracking or current.bad config value for '%s'%s has multiple valuestoo many matches for %syesfalseoff[%.*s ""] [%.*s] %.*s = %s\n\tGIT_CONFIG_PARAMETERSbogus config parameter: %sbad config file line %d in %s/etc/gitconfigGIT_CONFIG_NOSYSTEMHOME%s/.gitconfiginvalid key: %sinvalid key (newline): %sopening %s: %sinvalid pattern: %sinvalid config file %sCannot handle files this bigcould not lock config file %srbMissing value for '%s'core.core.filemodecore.trustctimecore.quotepathcore.symlinkscore.ignorecasecore.barecore.ignorestatcore.prefersymlinkrefscore.logallrefupdatescore.warnambiguousrefscore.abbrevcore.loosecompressionbad zlib compression level %dcore.compressioncore.packedgitwindowsizecore.bigfilethresholdcore.packedgitlimitcore.deltabasecachelimitcore.autocrlfinputcore.safecrlfwarncore.eolnativecore.notesrefcore.pagercore.editorcore.askpasscore.excludesfilecore.whitespacecore.fsyncobjectfilescore.preloadindexcore.createobjectrenamecore.sparsecheckoutuser.user.nameuser.emaili18n.i18n.commitencodingi18n.logoutputencodingbranch.branch.autosetupmergebranch.autosetuprebaseneverlocalMalformed value for %spush.push.defaultnothingmatchingupstreamtrackingcurrentMalformed value for %s: %smailmap.mailmap.fileadvice.pager.colorcolor.pagerstrbuf_setlensha1 file '%s' write error. Out of diskspacesha1 file '%s' write error%s: sha1 file error on close%lu %c%02d%02dyesterdaysecondslastmonthsyearsin the future%lu seconds ago%lu minutes ago%lu hours ago%lu days ago%lu weeks ago%lu months ago%lu year%s, %lu month%s ago%lu years ago%lu %+05d%04d-%02d-%02dPMAMiso8601shortunknown date format %sJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberSundaysMondaysTuesdaysWednesdaysThursdaysFridaysSaturdaysIDLWNTCATHSTHDTYSTYDTPSTPDTMSTMDTCSTCDTEDTWATGMTUTCWETBSTCETMETMEWTMESTCESTMESZFWTFSTEETEESTWASTWADTCCTJSTEASTEADTGSTNZTNZSTNZDTIDLEnoonmidnightteanowminuteshoursweekszerotwothreefourfivesixseveneightnineten%04d-%02d-%02d %02d:%02d:%02d %+05d%.3s, %d %.3s %d %02d:%02d:%02d %+05d%.3s %.3s %d %02d:%02d:%02d %d%c%+05d           % . 7 ? G P [ e m ;Zx0Nw |                                                     u# u( `u1  u  s ps Pt5 t 9 <A h QG : M <1 R V \ a f j p v { diff-delta.cpacked_entry - (struct index_entry *)mem == entriesѴYiVsg?Df7P*~ {'ZYA n\uT*NN'CMcqH$(~Qڿ80B i6:I_DV<1y UHg=[72waN.ʂ=SGܖ 6k.o; 㐵 mdIP)-_^˵i9/q`ˬymx%!tsC G#cu0׭PycͯE5#egwz3#zo;9 kbѷi>eM? ] {SRЦ-w:ᆑ4}@4m3+]ހ.(uw,܌A!]OJqj&'ȒE R)TZ,m"2TkKةҊs^>*pWGLXY40J}oC9L|Ja%FW$}=ds@`[qFl/:_!j5FH9<`[`=x6(T!fZlG03%Htl߇"Vwra .$b6xޣoӭ~.|܅p ~KP8(zN]{ Lq[(t ?0Q"iQ܃hڬfWfVĻ媍E\P/9YC7?k^f+IvB~'2LO%AA!?CVYRX| e%1_Dž =DdUx-O#[X+j hRd8ޓ 4nomţ2rxud,64JbEvݝE& )p@Hz N#v;'R;*&bU;|b5,]\zcreate_delta_index ~3VԆ(G]>J}y Q/|pENOXHn&B wq_3!uULbׁJڡ4[(VreMA3υ0lY;DT:ՒزkfCF==895GGo>t>ry@ChcJP7p;I}ap 0-N:f76$ %)[k8sK c5"n\6t %w+UaD}lxI,XR&zz+ps}P %c[7t:n }"]]\n}N,5+8U3zrǔ,!RloaU/9uG+"h&ܗ>(@`a;)S7$IF^ffnm0cNH>JE4$bc)MC3ėɷeƄkDˤ: pXPlUC=J-fG kTKVYk[(h~Q6e/VyX'&%p_!VX [x*w1L<<'2dvAK{a5*cB[/Vm-ikP I.Xxj4UWg)f^ h'$ev)Y鮜'/z"Zq `u S#"]N^rC _m$ZL{lL/-AS"|1 *ŤTi,w?WARާn_*8 !F9gPP1]cOd`Dn6]HAw?LA3_W=)LvmgD Ejd;*?[{\oops in prep_exclude.gitignoreinfo/excludecannot use %s as an exclude filecan't find the current directorystrbuf_setlenGIT_DIRGIT_OBJECT_DIRECTORY%s/objectsGIT_INDEX_FILE%s/indexGIT_GRAFT_FILEinfo/graftsGIT_NO_REPLACE_OBJECTS%s/%sCould not set GIT_DIR to '%s'UTF-8GIT_CONFIGGIT_WORK_TREEinternal error: work tree has already been set Current worktree: %s New worktree: %sGIT_ALTERNATE_OBJECT_DIRECTORIES( #(  ' ' .( ' ' ' /usrGIT_EXEC_PATH/usr/lib/git-core/usr/bin:/bintrace: exec:trace: exec failed: %s too many args to run %s  0123456789abcdefYou don't exist. Go away!Your sysadmin must hate you!/etc/mailname(none)invalid date format: %s <GIT_AUTHOR_DATEGIT_AUTHOR_EMAILGIT_AUTHOR_NAMEGIT_COMMITTER_NAMEGIT_COMMITTER_EMAILGIT_COMMITTER_DATEunable to read /etc/mailname: %s empty ident %s <%s> not allowedImpossibly long personal identifierYour parents must have hated you! *** Please tell me who you are. Run git config --global user.email "you@example.com" git config --global user.name "Your Name" to set your account's default identity. Omit --global to set the identity only in this repository. Unable to create '%s.lock': %s. If no other git process is currently running, this probably means a git process crashed in this repository earlier. Make sure no other git process is running and remove the file manually to continue.Unable to create '%s.lock': %scannot fix permission bits on %s%s: symlink too longcannot open '%s' for copying.mailmap# repo-abbrev:invalid object type "%s"sha1 mismatch %s object %s has unknown type id %d  YW  U pack/tmp_idx_XXXXXXunable to create '%s'Failed to checksum '%s'keep bad type %dFailed seeking to start of '%s'Unable to reread header of '%s'Unexpected checksum for %s (disk corruption?)refs/ref:.git/.gitstrbuf_setlene/ Ж і  read errorpacket: %12s%c PACKPACK ...\%o0123456789abcdefwrite error (disk full?)0000The remote end hung up unexpectedlyprotocol error: impossibly long lineprotocol error: bad line length character: %.4sprotocol error: bad line length %dGIT_TRACE_PACKET0123456789abcdef, %u.%2.2u GiB, %u.%2.2u MiB, %u.%2.2u KiB, %u bytes | %u.%2.2u MiB/s | %u KiB/s %s: %3u%% (%u/%u)%s%s%s: %u%s%s%s... , %s. done../'\Too many or long arguments\f\r\v_abtnvfr"\strbuf_setleninternal error: ce_mode is %oInvalid path '%s'unable to index file %sunable to add %s to indexadd '%s' unable to stat '%s'M %s U %s %s: needs update %s: needs merge index file open failedcannot stat the open indexunable to map index filebad signaturebad index versionbad index file sha1 signatureignoring %.4s extension index file corrupt%s: cannot drop to stage #0'%s' appears as both a file and as a directory%s: can only add regular files, symbolic links or git-directoriescannot create an empty blob in the object databaseWill not add file alias '%s' ('%s' already exists in index)index file smaller than expectedUnknown index entry format %08xindex uses %.4s extension, which we do not understand⛲CK)wZSDuplicated ref, and SHA1s don't match: %s%s does not point to a valid object!'%s' exists; cannot create '%s'cannot delete '%s' from packed refsthere are still refs under '%s'unable to resolve reference %s: %sunable to create directory for %sRef %s is at %s but expected %sThere are still logs under '%s'Trying to write ref %s with nonexistant object %sTrying to write non-commit object %s to branch %srefname %s is a symbolic ref, renaming it is not supportedunable to save current sha1 in %sunable to move logfile logs/%s to logs/refs/.tmp-renamed-log: %sunable to move logfile logs/refs/.tmp-renamed-log to logs/%s: %sunable to write current sha1 into %sunable to lock %s for rollbackunable to restore logfile %s from %s: %sunable to restore logfile %s from logs/refs/.tmp-renamed-log: %sno symlink - falling back to symbolic ref Unable to fix permissions on %sLog %s unexpectedly ended on %s.invalid rule in ref_rev_parse_rules: %sDuplicated ref: %s peeled packed-refstoo long a refname '%s'bad ref for %srefs/tags/refs/heads/refs/remotes/refs/replace/Can't verify ref %srefs/%srefs/notes/Unable to append to %s: %s%s %s %s Unable to append to %sCouldn't write %sCouldn't set %sreflog for %s is a symlinkrefname %s not foundunable to lock %slogs/refs/.tmp-renamed-logunable to delete old %sDirectory not empty: %sunable to delete existing %sDirectory not empty: logs/%sunable to lock %s for updateref: %s refname too long: %s%s.lockUnable to open %s for writingUnable to write to %sUnable to create %sUnable to read log '%s'Log %s is empty.Log %s is corrupt.Log %s has gap after %s.Cannot lock the ref '%s'.Cannot update the ref '%s'.refs/%.*srefs/heads/%.*srefs/tags/%.*srefs/remotes/%.*srefs/remotes/%.*s/HEAD# pack-refs with:RENAMED-REF%o%ccannot unmerge '%s'Index records invalid resolve-undo informationToo long path: %.*s%s/configPlease upgrade Gitfailed to stat '%s%s%s''%s' is outside repositoryfailed to stat '%s'Error opening '%s'Error reading %sgitdir: Invalid gitfile format: %sNo path in gitfile: %sNot a git repository: %s'$%s' too bigNot a git repository: '%s'Could not chdir to '%s'Could not get directory '%s'Could not come back to cwdGIT_CEILING_DIRECTORIESCannot come back to cwdCannot change to '%s/..'umaskgroupworldeverybodycore.repositoryformatversioncore.sharedrepositorycore.worktreeExpected git repo version <= %d, found %dbad flag '%s' used after filenameambiguous argument '%s': unknown revision or path not in the working tree. Use '--' to separate paths from revisionsambiguous argument '%s': both revision and filename Use '--' to separate filenames from revisionsThis operation must be run in a work treecore.bare and core.worktree do not make senseUnable to read current working directoryGIT_DISCOVERY_ACROSS_FILESYSTEMNot a git repository (or any of the parent directories): %sNot a git repository (or any parent up to mount parent %s) Stopping at filesystem boundary (GIT_DISCOVERY_ACROSS_FILESYSTEM not set).Problem with core.sharedRepository filemode value (0%.3o). The owner of files must always have read and write permissions.%s/pack/pack-1234567890123456789012345678901234567890.%sinsanely long object directory %spack_report: getpagesize() = %10llu pack_report: core.packedGitWindowSize = %10llu pack_report: core.packedGitLimit = %10llu pack_report: pack_used_ctr = %10u pack_report: pack_mmap_calls = %10u pack_report: pack_open_windows = %10u / %10u pack_report: pack_mapped = %10llu / %10llu index file %s is version %u and is not supported by this binary (try upgrading GIT to a newer version)wrong index v1 file size in %swrong index v2 file size in %spackfile %s not a regular filecannot determine file descriptor flagsfile %s is far too short to be a packfilepackfile %s is version %u and not supported (try upgrading GIT to a newer version)packfile %s claims to have %u objects while index indicates %u objectsend of packfile %s is unavailablepackfile %s signature is unavailablepackfile %s does not match index%s: ignoring alternate object stores, nesting too deep.%s: ignoring relative alternate object store %sobject directory %s does not exist; check .git/objects/info/alternates.could not close alternates filepack '%s' still has open windows to itpackfile %s cannot be accessedoffset beyond end of packfile (truncated pack?)packfile %s cannot be mapped: %sunable to open object pack directory: %s: %sgarbage at end of loose object '%s'delta data unpack-initial failed%02x%02x%02x... lo %u hi %u nr %u failed to validate delta base reference at offset %llu from %sfailed to read delta base object %s at offset %llu from %sfailed to unpack compressed delta at offset %llu from %sunknown object type %i at offset %llu in %sfailed to read object %s at offset %llu from %spack %s contains unknown object type %dpack %s contains bad delta base reference of type %sreplacement %s not found for %sloose object %s (stored in %s) is corruptpacked object %s (stored in %s) is corruptunable to write sha1 filename %s: %s unable to set permission to '%s'insufficient permission for adding an object to repository database %s unable to create temporary sha1 filename %s: %s unable to deflate new object %s (%d)deflateEnd on object %s failed (%d)confused by unstable object source data for %s%s: failed to insert into databaseOut of memory? mmap failedindex file %s is too smallnon-monotonic index %spackfile %s index unavailablecannot get RLIMIT_NOFILEpackfile %s size changedcannot set FD_CLOEXECfile %s is not a GIT packfileobjects/info/alternates%s/objects %s/packbad object headercorrupt loose object '%s'GIT_DEBUG_LOOKUPGIT_USE_LOOKUPlo %u hi %u rg %u mi %u I am totally screwedbad packed object CRC for %sfailed to apply deltaunable to find %sunable to unpack %s headerunable to parse %s headerfailed to read object %sobject file write error (%s)unable to write sha1 fileerror when closing sha1 filefailed utime() on %s: %scannot read sha1_file for %scorrupt commitcorrupt tagshort read %sopen("%s"): %sreadlink("%s"): %s%s: unsupported file type%s is not a valid object%s is not a valid '%s' object0123456789abcdef0123456789abcdefInvalid search pattern: %s%.2s%.2s/short SHA1 %.*s is ambiguous.checkout: moving from @{upstream}@{u}ignoring dangling symref %s.refname '%.*s' is ambiguous.Invalid object name '%s'.BUG: startup_info struct is not initialized.relative path syntax can't be used outside working tree.No upstream branch found for '%s'Log for '%.*s' only goes back to %s.Log for '%.*s' only has %d entries.%.*s: expected %s type, but the object dereferences to %s typePath '%s' is in the index, but not at stage %d. Did you mean ':%d:%s'?Path '%s' is in the index, but not '%s'. Did you mean ':%d:%s' aka ':%d:./%s'?Path '%s' exists on disk, but not in the index.Path '%s' does not exist (neither on disk nor in the index).Path '%s' exists on disk, but not in '%s'.Path '%s' exists, but not '%s'. Did you mean '%s:%s' aka '%s:./%s'?Path '%s' does not exist in '%s'strbuf_setlenshallowbad shallow line: %sinvalid commitBUG: signal out of range: %dyou want to use way too much memory`pos' is too far after the end of the buffer`pos + len' is too far after the end of the bufferBUG: your vsnprintf is broken (returned %d)BUG: your vsnprintf is broken (insatiable)strbuf_setlen%s:%p missing object referenced by '%.*s'Object %s is a %s, not a tagtype Unknown type %sObject %s not a tag-----BEGIN PGP SIGNATURE----------BEGIN PGP MESSAGE-----What does '%s' for %s mean? GIT_TRACE(null)GIT_TRACE_SETUPsetup: git_dir: %s setup: worktree: %s setup: cwd: %s setup: prefix: %s Could not open '%s' for tracing: %s Defaulting to tracing on stderr... If you want to trace into a file, then please set %s to an absolute pathname (starting with /). Unable to get current working directoryCould not trace into fd given by GIT_TRACE environment variableObject %s is a %s, not a treeObject %s not a treeCommit %s in submodule path %s not foundInvalid commit %s in submodule path %scorrupt tree fileunable to read tree %sstrbuf_setlenwarning: error: usage: utf-8utf8W]oKXpp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY`24RSrs   "'(229;  * . ` c j o *0/000 #gis strbuf_setlenunable to %s %s: %sOut of memory, strdup failedOut of memory, realloc failedOut of memory, calloc failedOut of memory? fdopen failed/tmpTMPDIRunlinkrmdirOut of memory, malloc failed (tried to allocate %lu bytes)Data too large to fit into virtual memory space.Unable to create temporary file '%s'abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789GIT_FLUSHwrite failure on '%s'fsync error on '%s'%s: write error (%s) , tabwidth=tabwidth %.*s out of rangetrailing whitespacenew blank line at EOFspace before tab in indentindent with spacestrailing-spacespace-before-tabindent-with-non-tabcr-at-eolblank-at-eolblank-at-eoftab-in-indentcannot enforce both tab-in-indent and indent-with-non-tabl^ @{^ ^ ^ ^ @^ ^ wrong versionno messageinflateInit: %s (%s)inflateEnd: %sneeds dictionarydata stream errorstream consistency errorunknown errorinflate: out of memoryinflate: %s (%s)ߡߡߡCould not switch to '%s'Too long path name: '%s/%s'Invalid symlink '%s'symbolic link too long: %sCould not change back to '%s'PWDCould not get current working directoryCannot determine the current working directorypushnonfastforwardstatushintscommitbeforemergeresolveconflictimplicitidentitydetachedhead'%s' is not possible because you have unmerged files. Please, fix them up in the work tree, and then use 'git add/rm ' as appropriate to mark resolution and make a commit, or use 'git commit -a'.'%s' is not possible because you have unmerged files.a  a  a  a  a  a  %10s: %8u (%llu kB) [attr]%s not allowed: %s:%d core.attributesfile/etc/gitattributesGIT_ATTR_NOSYSTEM[builtin].gitattributesinfo/attributes[attr]binary -diff -text%.*s is not a valid attribute name: %s:%d BUG: non-INDEX attr direction in a bare repo(builtin)false(builtin)true(builtin)unknown strbuf_setlen%c%d %d %o %.*s%ccache-tree: internal error%s: unmerged (%s) %s: not added yet You have both %s and %s fatal - unsorted cache subtreecache-tree.c: '%.*s' in '%s' not foundinvalid object %06o %s for '%.*s'phXstrbuf_setlenidentIdautofilter.smudgecleanexternal filter %s failedexternal filter %s failed %dId: $ Id:read from external filter %s failedcannot fork to run external filter %scannot feed the input to external filter %sCRLF will be replaced by LF in %s. The file will have its original line endings in your working directory.CRLF would be replaced by LF in %s.LF will be replaced by CRLF in %s. The file will have its original line endings in your working directory.LF would be replaced by CRLF in %scopy-fd: read returned %scopy-fd: write returned 0copy-fd: write returned %s%s: close error: %spackfile %s index not opened%s SHA1 checksum mismatchpacked %s from %s is corruptPackfile index for %s SHA1 mismatch%s SHA1 does not match its indexinternal error pack-check nth-packed-objectindex CRC mismatch for object %s from %s at offset %llucannot unpack %s from %s at offset %lluinternal error: pack revindex fubarbad offset for revindexunexpected delta opcode 0delta replay has gone wildKey '%s' of pattern had no '*'Value '%s' of pattern has no '*'Config remote shorthand cannot begin with '/': %smore than one receivepack given, using the firstmore than one uploadpack given, using the firstfind_tracking: need either src or dstsrc refspec %s does not match any.src refspec %s matches more than one.%s cannot be resolved to branch.unable to push to unqualified destination: %s The destination refspec neither matches an existing ref on the remote nor begins with refs/, and we are unable to guess a prefix based on the source ref.dst refspec %s matches more than one.dst ref %s receives from more than one src.Didn't think it matches any more* Ignoring funny ref '%s' locallyYour branch is ahead of '%s' by %d commit%s. Your branch is behind '%s' by %d commit%s, and can be fast-forwarded. Your branch and '%s' have diverged, and have %d and %d different commit(s) each, respectively. .remote.mergeurl..insteadof.pushinsteadofremote..mirror.skipdefaultupdate.skipfetchall.url.pushurl.push.fetch.receivepack.uploadpack.tagopt--no-tags--tags.proxy.vcsInvalid refspec '%s'originURL:Push:Pull:branches/%.*s:refs/heads/%sHEAD::refs/heads/masterremotes/%s%s tracks both %s and %s(delete)Couldn't find remote ref %s--left-rightrefs/tags/*strbuf_setlenbad replace ref name: %sduplicate replace ref: %sreplace depth too high for object %s--all--branches--remotes--reflog--not--no-walk--do-walk--bisectmax-countskip-n requires an argument-nmax-agesinceaftermin-agebeforeuntil--first-parent--ancestry-path--walk-reflogs--defaultbad --default argument--merge--topo-order--simplify-merges--simplify-by-decoration--date-order--early-output--parents--dense--sparse--show-all--remove-empty--merges--no-merges--min-parents=--no-min-parents--max-parents=--no-max-parents--boundary--left-only--right-only--cherry--count--cherry-mark--cherry-pick--objects--objects-edge--unpacked--unpacked=--cc--pretty--pretty=--format=--show-notes--show-notes=--no-notes--standard-notes--no-standard-notes--oneline--graph--root--no-commit-id--always--no-abbrev--abbrev--abbrev=--abbrev-commit--full-diff--full-history--relative-date--log-sizegrepcommand line--extended-regexp--regexp-ignore-case--fixed-strings--all-matchnone--reverse--childrenbad object %sbad tree %sInvalid revision range %s..%s^@^!unknown option `%s'refs/bisect/badrefs/bisect/goodglob--branches=--tags=--remotes=--stdin--stdin given twice?bad revision '%s'--merge without HEAD?MERGE_HEAD--merge without MERGE_HEAD?bad default revision '%s'diff_setup_done failedbad tagunable to parse commit %s%s is unknown object^--left-only is incompatible with --right-only or --cherry--right-only is incompatible with --left-only--cherry is incompatible with --left-only--cherry-mark is incompatible with --cherry-pick--cherry-pick is incompatible with --cherry-mark--unpacked= no longer supported.cannot simplify commit %s (because of %s)cannot simplify commit %s (invalid %s)bad tree compare for commit %sreflog of '%s' references pruned commitsInvalid symmetric difference expression %s...%soptions not supported in --stdin modecannot combine --reverse with --walk-reflogscannot combine --parents and --childrencannot combine --reverse with --graphcannot combine --walk-reflogs with --graph--ancestry-path given but there are no bottom commitsFailed to traverse parents of commit %sFailed to simplify parents of commit %swaitpid is confused (%s)%s died of signal %dcannot run %s: %swaitpid for %s failed: %scannot create pipe for %s: %strace: run_command:exec '%s': cd to '%s' failed|&;<>()$`\"' *?[#~=%-c%s "$@"cannot exec '%s'cannot fork() for %s: %sBUG: shell command is emptycannot create pipe: %scannot create thread: %spthread_join failedhooks/%sGIT_INDEX_FILE=%sBUG: assertion failed in binary searchcannot happen -- lo and hi are identicalofs %u lov %x, hiv %x, kyv %x assertion failure lo %u mi %u hi %u %ssha1-lookup.clov < hivlo %u hi %u rg %u mi %u sha1_entry_poscorrupt tree sha %sunable to read root tree (%s)unable to read source tree (%s)unable to read destination tree (%s)unable to set up diff options to follow renamesstrbuf_setlen%s%4d.%01d%% %.*s diff.cmsg%s%s:%d: %s. invalid diff0,01,%dOption '%c' requires a value %s mode %06o %s mode change %06o => %06o%ccannot hash %s%sdelta %lu %sliteral %lu @@ -XXXXXX_unable to create temp-fileunable to write temp-file => %s %s (%d%%) %s%s--- %s%s%s %s%s+++ %s%s%s ~ diff.renamelimitdiff.color.color.diff.plainmetafragnewfuncdiff.suppressblankemptydiff.suppress-blank-emptysubmodule.diff.colorcolor.diffdiff.renamescopydiff.autorefreshindexdiff.mnemonicprefixdiff.noprefixdiff.externaldiff.wordregexdiff.ignoresubmodulestextconv/%s-dirtySubproject commit %s%s unable to read %sstat(%s)readlink(%s)cannot read data blob for %sunable to read files to diffa/b/--patchunified--raw--patch-with-raw--numstat--shortstatdirstat--cumulativedirstat-by-file--check--summary--patch-with-stat--name-only--name-status--stat-name-width-B--break-rewrites=--break-rewritesinvalid argument to -B: %s-M--find-renames=--find-renamesinvalid argument to -M: %s-C--find-copies=--find-copiesinvalid argument to -C: %s--no-renames--relative--relative=--ignore-all-space--ignore-space-change--ignore-space-at-eol--patience--binary--full-index--text--find-copies-harder--follow--color--color=--no-color--color-words--color-words=--word-diff--word-diff=bad --word-diff argument: %sword-diff-regex--exit-code--quiet--ext-diff--no-ext-diff--textconv--no-textconv--ignore-submodules--ignore-submodules=--submodule--submodule=--pickaxe-all--pickaxe-regexdiff-filtersrc-prefixdst-prefix--no-prefixinter-hunk-contextCould not open '%s'%s%.*s%s...internal diff status error%s%ssimilarity index %d%%%s %s%scopy from %s %s%scopy to %s %s%srename from %s %s%srename to %s%sindex %s..%s%sdiff --git %s %s%s %s%snew file mode %06o%s %s%sdeleted file mode %06o%s %s%sold mode %06o%s %s%snew mode %06o%s + @@%s %sGIT binary patch GIT_DIFF_OPTS--unified=-u* Unmerged path %s GIT_EXTERNAL_DIFF:%06o %06o %s %c%03d%c%c%c- - %llu %llu %s%-*s | Bin %s%llu%s -> Unmerged %5llu%sdeletecreate%s rewrite Could not open /dev/null{++}[--]%s%s:%d: leftover conflict marker internal error in diff-resolve-rename-copyinternal error: asking to populate invalid file.error while reading from stdin %sBUG: diff is failing to clean up its tempfiles--name-only, --name-status, --check and -s are mutually exclusiveOption '--%s' requires a valueOption '--stat-width' requires a valueOption '--stat-name-width' requires a valueoption `color' expects "always", "auto", or "never"diff--gita/%.*sb/%.*snewfilemode%06o---/dev/null+++b/%.*sdiff--gita/%.*sb/%.*sdeletedfilemode%06o---a/%.*s+++/dev/nulldiff--gita/%.*sb/%.*s---a/%.*s+++b/%.*sfeeding unmodified %s to diffcoreerror reading from textconv command '%s'%s%sdissimilarity index %d%%%s external diff died, stopping at %s. %s%s--- %s%s%s %s%s+++ %s%s%s %s%s@@ -%sBinary files %s and %s differ Invalid regular expression: %s %d files changed, %d insertions(+), %d deletions(-) ------------only found copies from modified paths due to too many files.inexact rename detection was skipped due to too many files.you may want to set your %s variable to at least %d and retry the command.emit_line_0strbuf_setlen@@diff_words_showfn_out_diff_words_aux`jG%*sgraph.cgraph->num_parents >= 3graph->revs->boundarypar_columntarget * 2 <= igraph->new_mapping[i] == -1graph->new_mapping[i - 2] < 00 <= graph->expansion_row && graph->expansion_row < num_expansion_rowsgraph->new_mapping[i - 1] > targetgraph->new_mapping[i - 3] == targeta b Sb 3c c^ _ diff_output_prefix_callbackstrbuf_setlengraph_next_linegraph_output_pre_commit_linegraph_output_commit_chargraph_output_post_merge_linegraph_output_collapsing_linegrep.cregexp returned nonsenseNot a valid grep expressionunmatched parenthesisnot a pattern expression %sIn '%s' at %d, %s, %s'%s': %sBinary file matches bug: unknown header field %dbug: malformed header exprp->field < (sizeof(header_field)/sizeof(header_field[0]))Unexpected node type (internal error) %d--not not followed by pattern expression--not followed by non pattern expression--and not followed by pattern expressionbug: unknown binary handling modebug: a non-header pattern in grep header list.incomplete pattern expression: %ss s s Xs t match_one_patternD L  ll-merge.coptsOAmerge.defaultmerge.%s: lacks valuedriverrecursiveconflict-marker-sizebuilt-in binary mergebuilt-in 3-way text mergeunionbuilt-in union mergecustom merge driver %s lacks command line.Cannot merge binary files: %s (%s vs. %s) ll_union_mergell_xdl_mergell_binary_mergell_ext_mergerefs/headsrefs/remotesrefs/tagsrefs/stashremoteBranch ( %stag: %04d-%fSubject: References: attachmentSubject: [%s %0*d/%d] Subject: [%s] Message-Id: <%s> In-Reply-To: <%s> %s<%s> (from %s)log size %i stdoutobject namesFrom %s Mon Sep 17 00:00:00 2001 %sMIME-Version: 1.0 Content-Type: multipart/mixed; boundary="%s%s" This is a multi-part message in MIME format. --%s%s Content-Type: text/plain; charset=UTF-8; format=fixed Content-Transfer-Encoding: 8bit --%s%s Content-Type: text/x-patch; name="%s" Content-Transfer-Encoding: 8bit Content-Disposition: %s; filename="%s" strbuf_setlenSigned-off-by: refs/notes/%supdate notes cache no-[=<%s>][<%s>] <%s>[%s][=%s]cat <<\EOF usage: %s or: %s -%c--%s%s-NUM%*s%s switch `%c' %soption `no-%s' %soption `%s' %stakes no valueisn't availableexpects a numerical valueBUG: option '%s' %sBUG: switch '%c' %sshould not accept an argumenthelp-allhelpunknown switch `%c'malformed object name %sno such commit %sshould not happen, someone must be hit on the foreheadSTOP_AT_NON_OPTION and KEEP_UNKNOWN don't go togetheruses incompatible flags LASTARG_DEFAULT and OPTARGuses feature not supported for dashless optionsdid you mean `--%s` (with two dashes ?)Ambiguous option: %s (could be --%s%s or --%s%s)expects "always", "auto", or "never"   @ @ ض з 8  ` pretty.tformat:?= =?%s?q?=%02X?=mediumfullerfullinvalid --pretty format: %sFrom: %s: %.*s%.*s Date: %s %sDate: %s encoding --pretty formatgreenblueresetbad parent line in commitMerge:AuthorCommitinvalid --pretty format: '%s' references an alias which points to itselfMIME-Version: 1.0 Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit e - - - - - w - 1 - - - ( - - - - - - - - - - - - - - -  - -   - - - - > - -  - - - z UTF-8strbuf_setlenCannot walk reflogs for %sNo current branch%s@{Reflog: %s (%s) Reflog message: %s %h: %m %srev-list^%srevision walk setup failed%s/.git/objects//.gitmodulesuntrackedon-demandbad %s argument: %s.path.fetchrecursesubmodules.ignorefetch.recursesubmodules(submodule deleted)(not checked out)(new submodule)(commits not present)(revision walker failed) (rewind)Submodule %s %s..--recurse-submodules-default--submodule-prefix%s%s/Fetching submodule %s%s --porcelain-unogit status --porcelain failednot checked outcommits not presentnot fast-forwardmultiple merges foundbad --ignore-submodules argument: %sInvalid parameter "%s" for config option "submodule.%s.ignore"Submodule %s contains untracked content Submodule %s contains modified content Could not run git status --porcelainFailed to merge submodule %s (%s)commits don't follow merge-basemerge following commits not foundFound a possible merge resolution for the submodule: If this is correct simply add it to the index for example by using: git update-index --cacheinfo 160000 %s "%s" which will accept this suggestion. strbuf_setlen %m %sxfuncnamecommandcachetextconvfortranhtml^[ ]*(<[Hh][1-6][ ].*>.*)$javaobjcpascalperlphppython^[ ]*((class|def)[ ].*)$rubybibtexcppcsharpdiff=true!diff!^([C*]|[ ]*!) !^[ ]*MODULE[ ]+PROCEDURE[ ] ^[ ]*((END[ ]+)?(PROGRAM|MODULE|BLOCK[ ]+DATA|([^'" ]+[ ]+)*(SUBROUTINE|FUNCTION))[ ]+[A-Z].*)$[a-zA-Z][a-zA-Z0-9_]*|\.([Ee][Qq]|[Nn][Ee]|[Gg][TtEe]|[Ll][TtEe]|[Tt][Rr][Uu][Ee]|[Ff][Aa][Ll][Ss][Ee]|[Aa][Nn][Dd]|[Oo][Rr]|[Nn]?[Ee][Qq][Vv]|[Nn][Oo][Tt])\.|[-+]?[0-9.]+([AaIiDdEeFfLlTtXx][Ss]?[-+]?[0-9.]*)?(_[a-zA-Z0-9][a-zA-Z0-9_]*)?|//|\*\*|::|[/<>=]=|[^[:space:]]|[-][-]+[^<>= ]+|[^[:space:]]|[-][-]+!^[ ]*(catch|do|for|if|instanceof|new|return|switch|throw|while) ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>>?=?|&&|\|\||[^[:space:]]|[-][-]+!^[ ]*(do|for|if|else|return|switch|while) ^[ ]*([-+][ ]*\([ ]*[A-Za-z_][A-Za-z_0-9* ]*\)[ ]*[A-Za-z_].*)$ ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$ ^(@(implementation|interface|protocol)[ ].*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>=?|&&|\|\||::|->|[^[:space:]]|[-][-]+^(((class[ ]+)?(procedure|function)|constructor|destructor|interface|implementation|initialization|finalization)[ ]*.*)$ ^(.*=[ ]*(class|record).*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|<>|<=|>=|:=|\.\.|[^[:space:]]|[-][-]+^[ ]*package .*; ^[ ]*sub .* \{ ^[A-Z]+ \{ ^=head[0-9] [[:alpha:]_'][[:alnum:]_']*|0[xb]?[0-9a-fA-F_]*|[0-9a-fA-F_]+(\.[0-9a-fA-F_]+)?([eE][-+]?[0-9_]+)?|=>|-[rwxoRWXOezsfdlpSugkbctTBMAC>]|~~|::|&&=|\|\|=|//=|\*\*=|&&|\|\||//|\+\+|--|\*\*|\.\.\.?|[-+*/%.^&<>=!|]=|=~|!~|<<|<>|<=>|>>|[^[:space:]]|[-][-]+^[ ]*(((public|protected|private|static)[ ]+)*function.*)$ ^[ ]*(class.*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|[-+*/<>%&^|=!.]=|--|\+\+|<<=?|>>=?|===|&&|\|\||::|->|[^[:space:]]|[-][-]+[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[jJlL]?|0[xX]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|//=?|<<=?|>>=?|\*\*=?|[^[:space:]]|[-][-]+^[ ]*((class|module|def)[ ].*)$(@|@@|\$)?[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|\?(\\C-)?(\\M-)?.|//=?|[-+*/<>%&^|=!]=|<<=?|>>=?|===|\.{1,3}|::|[!=]~|[^[:space:]]|[-][-]+(@[a-zA-Z]{1,}[ ]*\{{0,1}[ ]*[^ "@',\#}{~%]*).*$[={}"]|[^={}" ]+|[^[:space:]]|[-][-]+^(\\((sub)*section|chapter|part)\*{0,1}\{.*)$\\[a-zA-Z@]+|\\.|[a-zA-Z0-9-]+|[^[:space:]]|[-][-]+!^[ ]*[A-Za-z_][A-Za-z_0-9]*:.*$ ^([A-Za-z_][A-Za-z_0-9]*([ ]+[A-Za-z_][A-Za-z_0-9]*([ ]*::[ ]*[^[:space:]]+)?){1,}[ ]*\([^;]*)$ ^((struct|class|enum)[^;]*)$!^[ ]*(do|while|for|if|else|instanceof|new|return|switch|case|throw|catch|using) ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[<>@._[:alnum:]]+[ ]*\(.*\))[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[@._[:alnum:]]+)[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|unsafe|sealed|abstract|partial)[ ]+)*(class|enum|interface|struct)[ ]+.*)$ ^[ ]*(namespace[ ]+.*)$malformed diff output: %s @@Could not stat %sCould not open %sunable to read blob object %smerge.conflictstyle'%s' is not a booleandiff3Last expression must not be negated: %sInvalid regexp to look for hunk header: %sunknown style '%s' given for '%s'strbuf_setleninvalid base85 alphabet %cinvalid base85 sequence %.5s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!#$%&()*+-;<=>?@^_`{|}~38;5;%d48;5;%dTERMdumbcolor.uinormalblackyellowmagentacyanwhitebolddimulblinkbad color value '%.*s' for variable '%s'          ĩ ȩ ˩ r %.*s%s%s %s%06oSubproject commit %s object '%s' is not a blob!diff --cc diff --combined ,readlink(%s): %sread error '%s'early EOF '%s'%sindex ..%s%s %snew file mode %06o--- %sdeleted file mode ..%06o+++ -%lu,%lu +%lu,%lu %s%s %s%s::::::::::::::::::::::::::::::::strbuf_setleninternal error in merge #1internal error in merge #2internal error in merge #3internal error in merge #4invalid log-grep regex: %sdiffcore-pickaxe.cdata[sz] == '\0'invalid pickaxe regex: %scontainsinternal error: dst already matched.Performing inexact rename detectionnotes.c!tws->nextnote_path_len <= 40 + 19fanout < 20notesubtreeprefix_len * 2 >= npath_len < 40 + 19tree && parent!*pnotes ref %s is invalidnotes.displayrefrefs/notes/commitsGIT_NOTES_REF!t->initialized!display_notes_treesGIT_NOTES_DISPLAY_REF Notes: Notes (%s): tws->path[0] == '\0' && tws->path[1] == '\0'memchr(path + 3 * n, '/', path_len - (3 * n)) == ((void *)0)Could not read %s for notes-indexFailed to load %s %s into notes tree from %s((uintptr_t) (entry) & 3) == 0i == n && parent_stack[i] == tree((void *) ((uintptr_t) (parent->a[index]) & ~3)) == tree((uintptr_t) (*p) & 3) == 2 || ((uintptr_t) (*p) & 3) == 3Failed to read notes tree referenced by %s (%s)strbuf_setleninit_notesload_subtreenote_tree_insertnote_tree_removenote_tree_consolidateinit_display_notesadd_noteremove_noteget_notefor_each_notefor_each_note_helperconstruct_path_with_fanoutwrite_notes_treewrite_each_notetree_write_stack_init_subtreewrite_each_note_helperprune_notesutf-8format_display_notesGIT_PAGERLESSGIT_PAGER_IN_USELESS=FRSX \ No newline at end of file 0123456789;@(-x;G?afL)x9` $5 \(0p(`((( ),)pP))p))0)p * L*px**p**$+` x+ +!+0!+! , "8,"d,p#,@(,)-*p-,- .-`.-P/(.0|.2.4.p</>P/ A/B/`C00D@0D0F0`G1I,1Jt1pR1X1PY<2[|2]2P^30cD3cd3e3k3mH4p4`s4vT5vx5v5@w5w5x6x86yp6z6{6|7|T7P}x7}7}77808D8d8 8`8$90`9990:@:X:p::@:@8;;;;<P <H<0t<<<@ == =`==>pD>\>p>>> >4?T???0?p4@L@x@0@ A@A dAAA`AB(BZ>Z>[ ?<[?`[@[B[D[E$\G|\0I\0J\PK]LP]pM]N] N]N^N(^`P^Q^ Q^Q^Q_ R_PR0_RH_PSp_ T_0T_@V_V`0X0`Y\`Yp`[`@[`\`\a]pa@^a_ b`cLbdbeb0fc@fcflc gchc0ic0jdj4dpkdd0mdmd`n(ep`eperepsfs4fpu\fuf@vfwfwfy$g0zPg{|g{g|g|h}@h}|h0~h~h hi@iii i(jhjИjjpjjdk0k@ lHl hlllФl m @mmPmm` n Pnnnno\ooo(p`Tppp@ppp8q Lq@`qpxqqqPqqr r8r@Prphrr rPrrrP0s\s0s`sstht`ttt0upuuuv`v@vpvvpwHwpw@w0w8xXxPxx y4y`Xyy@yypzDz@dzpzzz,{pX{{{{ | $|`P|t|||}P4}t}}p}0H~P p~0 ~p ~  ,0 @ X0 P  @ HpP( P|0ԁp4 d@xp ؂0!,#X$0%ăP%؃& &8P'(*+$,h,--P.8 12І4(9lp:P;ć<>0P>\0@A`CD EXK`KKLM(PMDMhpNPR TUDPVhV`WWY@``a`bgXg|iPk@tHuu`v؎P~~D@`p`@0 \Pp<Pp`0(TPxԒpD@tЏ@\Ԕ@P`H\0ܖ` И$D` 4L P`4РԙP L0`@P@T@hЫP4Ld0М00T`h ԝ p8LĞ؞@8П`pD(@ TPh`|ء`8pd P<P`̣0(L lp ܤ@,h`إ PԦ0 Lt`ا 4 T@Ԩ`(H`@ĩP ,lP Ԫ0$< 0 p P 0P(L0ܭ8P@$L0xPЯ0!@0"pp#$P%%T &P&&̱@+$+Dp,@.ܲ//P111Գ33 @4X4lp5P6д`78L`88 :;@`=C@J4pJHJpLMMN8@OO̸O0PQTRWĹPWWZ\`Z\`] ], ^Tp^^P`ܻ`a0aT`bb@cȼceXPfȽg pnH`qrȾr0stPupuv v̿pv |H|@}P~~pP@Ttp, Phpd0|@@h0|P0, Lpx` @T`t(<l@(L`@ lP @$@ <P|@P D0 `0@` Lt0Ppd@0(0 @ Dp @@ LppPPPH!"$$P&X' ++,@4@7`9$989Lp:p0;;@0C CH0DxDDHPHpIHJKpL4P[\[[]_0_`H`pd0ee$ fPPfhkll0o( Х Ц `$P <` <``м@(T $XP` p4T t <`@0$|pp(HPp0\x ``P (PT\8lP ( H `p@TPP Xl@8Lx\$(L`(`p,.$.|<=0>?h@0AG$HLIxJ0MM8Od`O0PPR4`Tl VVpWW(PXT[[aapcLgilPmPn|ppp q`r4rp`stvp@ww0xpy, zX`zp{ |} ~~`DPdPP$P|@l $P`Pв$0L @ H@`@D@` 8 Pt   $ d 0 @   X `   ( @`    < 0|   p$PP@`|@@d,l@<\ P  @p x0P,@Th0|`@<0 ! ""@P#d0%%0& &0+t,0,,-(`1hP<==8DxDF GzR|  0.D#AE[A(d-AC C] CA8AA CCE@AA AAlRC GI~ AE t AE ,AF G}  AAA @VC T A (\yAA E m CA 9C Mh @2C0c <\AA AAC@r AA AAA ( JAA E ~ CA48JAC AA@A AA(pC0JOFJn A ;C U H Z$CPUB F PTAA CDE@ CA AAC ACA AA 8MAC0GA \ MAC0GA 80AE \ AA $DpC0FJSy A (uAE0Z AG KA(AA C0~ AA,$DAA F   AAA <TAA AACpO AA AAF 0dC0^J J t D 'C PAA CCE` AA AAH vAA AA 0hAC  AF 8TdAE0\ CC { CB  CH H6C Jh4hAC AE  A AAC P eAC CCC@ AA AAC AA AA(<<,CPQLv B 8h@AC AAC0AA AA(gAA AAF@<X cAA AAC`0 AA AAE T8AA FACPm AA AAA J AA AAD <hpAC AAC@ AA AAA $C IJW A ,HC0KIIH H UTAA AAE0v AA AAE O AA AAA @XPAA AAF AA AAA  jC0FLH A (X6C0FFSn H DlAA AC  A AAJ C A AAA @4 DAA AAFW AA AAC @x AA AAF AA AAB < %HAC AAEP AA AAA < 'AC FFC`5 AA AAD T< (uAC CAE@2 FA AAH ~ CA AAD , *C0FLJg B n< D+AA AACk AA AAB  /sC p E vD$ D0AA AE0 F AAB C C AAH @l 1AC FAF5 AA AAF T 7AA ACCP AA AAG C CA AAA < `9%AA AACPl AA AAA TH PAA AAF AA AAF , AB R AAA A  @C HGc C 8 0A 8L ,A}AA AAE oAA AA$ pAC HKK G  AC W, AAA C `  AAA 4 PBC HJ~ E \ D { E T0(C AA AAC0 CA AAB C CC AAA ,CAA F  AAA DKCf G <DAA CAC0j CA AAG tEwC Ll E 8E_LF&AC `A(l,FCpHer F , IC@HPV G _ A $JvC@XFKD A XJdJ&AC `A $tJ@AA xAlHJ?AA CCEPf AA AAA S AA AAA  AA AAA (`LEAC C0{ AA8L|AA AAC@pAA AA8 LyAA AAC0mAA AA \ M,AC \ CE <MPAA AAC@) AA AAD <(NDAA AACP AA AAA 8P+C g<PPAA AAEP CA AAA <XPAA AAC@_ CA AAD  Q?AH tA<@QAA AACP AA AAA <R5AA AACPu CA AAF 8g1C LSwC0FQ\(lLTC0MHQL C $ VC JIy A yVC HI$(WC FIFa G (WMAA E0A CA<4WfAA CAEP1 CA AAF <tXAA ACE` CA AAA (ZAA C0 AAl[zAA AAC`~ AA AAG w FA AAH P CA AAA (P(]`AE0P CG |C|\]=C y],C0_ A $]fC HF\ C u(]aCGHH_ G \$^+C0d<<^AA AAC@ AA AAH \b%C L A T$|bFC HH_ F Mc#C \4cC@MHHH[ E  F dMC OzTdAA AAC@ AA AAA B CA AAA (l f6FS][ G  l+C g@8l:AA AAFa AA AAA 4pC W(  AA AAG hH $AA AACPh AA AAE O AA AAE OAA AAT ĥAA AAC@ AA AAH V AA AAF ( !KAA C C AAl8! qAA AAF CA AAH h CA AAB P CA AAB !0TAC0~ AA T!lAA AACP AA AAB  AA AAE T$"4eAA AAC`5 CA AAA C FA AAA (|"LC0LHWv D <"ЭUAC AAEpX AA AAA @"1AA CAH  AA AAF @,#~AA AAH  AA AAA Tp#(`AA AAC0a AA AAD  AA AAA <#0AA FAE0 CA AAA $е.CgT $AA C ^  AAC T  AAA C  DAA K  CAA x$@XF L A ($_AC C q  CAD @$OAA AAF AA AAA 8%ĸ~AA C M  AAD T  AAB 0@%AA AC zA AATt%dAA AAC@b CA AAA  CA AAA %,AC YA%,C0 C &&0&CL A M(P&C Vk D j A |& &CL A M,&C0HHHT A T,&C0LHGc G k'8CL A M0'8CL A M(P'8EAC h CA SA|'\ 'h,'dAA E0R  AAE 'ZAC0TA,'\AA C M  CAB (( (C d@(83C L A ,\(\AA C0  AAG ((lAF C _ AA (@cAC XF((pAKI AB VA,)пPAC } AF FA 8)PHA EA\)F p)XUC IJ~D)AA CE  C AAE CH AA@)AA ACCR AA AAA  *H+C g8*`WC OD(X*yAA C q AA* *eAC _A*<"AC XA,*LAA E0^  AAA < +AA FAH | AA AAG (L+-C0IFFD F x+5AC jF+ C +HC HH\ A ,+C HHLV C r F ,$,F Nd A <,+C gT, (h,eAC K CF GA,1AC kA<,AC AAE@ AA AAC ,"AC XA-9AC oA@4-AA AAK AA AAB x-RCLHLn-C [@-AA AAF" AA AAH <-BAC CAC@ AA AAA 8..Ae B A\.AA FAC@a CA AAE ^ AC AAD } CA AAE jCA AA(.4AC Eh AA / / 4/(H/HAA H y CA8t/jAC AAC(\AA AA</(%AA AAC@ AA AAG (/>AC S AH \A(0,kC@HLHPO B ,H0pAA CP  AAA x0 &AC `A002 0\lC HJV0+C g80AA AAC@AA AA$1T3C RZ@D1t>AA AAF  AA AAA @1pNAA AAF AA AAA ,1|AA F   AAA 41vAA AC \ A AAA 42d+AF bA0X2pCPFJP B U$2,C0LHB G a2%AC ]C$2\AK I AA 2kAC0cC$ 3(C@P@ E (H3`CPHJlg H @t3$AA AAF  AA AAF (3&C@Ho E T3AA AAC0 CA AAE  CA AAE (<4LYF^Rg C <h4AA AAC0 CA AAG $4@AA l AA <48_AA AAF  AA AAA D5XAA AC  A AAJ CC AA,X5Ar E I A F A O5@$5<`AC e AF 5t;AE [ AA T5AC ACEPS AA AAD  AA AAH @6AC0 CA d6TC T(|6\tC0HHHHr C 67C s67C s6,C h6,C h$70C0MXFX B (07C@HMHt D \7| 8p7xC0FKHz B  A  H 7LaC0](7~C`FILW C (7yCPLHLg F 8L408X8AA AF C AAA h8`+C g(8xWFlX C 8C Wh8AA AAC | CA AAG C AA AAA [ AA AAA ,09HwAD | AF mA`9'C Tt9AA AAE@y CA AAH  CA AAH <9pAC CAEP\CA AA< : ~AA AAC@ AA AAL 4L:LAA AC  A AAH <:AA AAC0w AA AAA :$ P: AC AAC@ CA AAA KFC AA,;|"<@;C0HHHHs J c E  ;^C HLc F (;DC@HLHJI F ;cAC0]A,;dAA C0  AAE T$<AA AAC@ AA AAE s AA AAA 0|<lAA AC qA AA4<AA AC Y A AAF 4<0 AA AC z A AAE , = cAC C@T  AAA (P= CFky C P|= AC AAC@ AA AAG [CA AA =X ^C0HLe D $= C IZ H (> SAC E0G AAH>@h4\>C HHHHB C Y G >4~C LHWO(>FILIR D (>TCOHKJa H (?CGHHHp F $AA ACHS AA AAC F?-C iF?CWPF@AF AAC0r CA AAA CA AA@G@yAA AAF# AA AAF @`GC$AA AAH AA AAH @GE7AA AAH+ AA AAE (GH]AEd AE kA<HIIAA ACC@ CA AAG $THJCPFUF@ D |HJC@YH\ H HXK0C l<HpKAA AACP AA AAE HL IL IL.C j8IL" LI MMC HHHm$pI8MYC0HHHHqIpM#C _IM+C gIM#C _IM+C gIM#C _JM+C g(JN.C j,@JN}AA C@  CAB pJhO+C gJO.C jJO3C0o4JOAC AE . C AAC (JQiAC ` DH qGPK\QjAA AAC0R AA AAC CCA AApKxQ,AC dCKQ,AC dCKQ9AC oATKQAA AAC` CA AAG  AA AAB ((LTbC HHHn G Q,TLTAA F }  AAA (L$UCPJSO A <LVC0PQm G C E L L <LWAC AAH a AA AAE <0MHZAA AAC` AA AAF (pM\!FU^h A <MbAA AAF AA AAD @MeAA AAF AA AAA @ NhjaAA AAF AA AAF dNm+C g|NmHNmAA C J  CAE l  HAC S  HAD (NLn9AA C o CA@O`nAA AAF!K AA AAG (LOpC0HLTb C <xOqAA AAC0 AA AAB <O0rNAA AACP AA AAE O@sHC HGu<PpssAA AACP AA AAE 8XPtAA AAC@AA AA,Pu-AA H   AAC ,PvAC F   AAB PviCFJk A (QwdC@HHPS B DQDxaC HHM8dQxAA CW  CAH C  FAA QxCPHHy A <QdyAA AAC0g AA AAF Ry&C L A U$Ry&C L A U DRyKAC P AC (hRzC RK H  A TRzAA AAF AA AAB F CA AAA (RL|F IPa C <S AA AACP AA AAA (XSZC@HPB C ,SC QMw H [SCJSC O(S?AC Cu AA T<Au B C 4T$IAE AA<XTPAA AAC@ AA AAA ,T0uAD H @  CAG (TAC C0  AAH <TAA AAEPC AA AAA (4UFNQINP`UHAA AAEE AA AAF cAA AAPUtAA AAE@N AA AAE TAA AA$VFNY C T0V؊AA AACy AA AAD x FA AAA V`9C Of,VxAA C [  FAA VЋV܋WC@(W5AA Gi AADWC W(\WC@LHHPx A TW@(AA AAH AA AAH v AA AAF $WpC0JKK E G@X`AA AAH AA AAG (LXܒF!NIw B lxXP7AA AAC` AA AAC a AA AAC  AA AAE $X C [ A (YȗpAC L AG PC4 AA AAG 0(] ^AA CC RA AAD\]LAA AC w A AAH CA AA(]mC HHi D U C $]اTAm B I O IT]AA AAC`G CC AAB  AA AAF <P^AC AACP AA AAD T^;AA ACC`g EA AAH  IA AAA @^ЬrAA AACS CA AAH (,_ CPFIn| D (X_вCFFXDQ D (_CPFFFD| C <_AA AAC` AA AAE (_ص6AA E j CA(`FN]PM B (H`C`FJFaD B (t`C@HLGH B <`xRAA AAC` AA AAH 4`C OHFo A k E k@aP^AA AAF" AA AAF \alOCPF A ,xajAA C@]  AAA $aC`HRFk B a6Coa5C@i A bJAC@ AA ((b0CpHL\H A (TbdFNIu H (bC@HHHH} H (b C`PHM C (bCPHHHH\ A cUAC MC (cuC HHc A ,Lc<AC C O  AAH (|cC Pi D ] C cvg'C @cAA ACEZ AA AAG @dAA AAF AA AAB (DdC@HHS B 4pdAA AC@ A AAA ldpAA AAC` CA AAB l CA AAA 7 CA AAA eoC0HFLQ@4hpXAA C {  CAL C CA<[AA AACP' CA AAD DlAC AC T A AAA CF AA((C@NKB B <TJAA AAC@ AA AAH @"AA AAF  AA AAB H؜AA C@i  CAF [  HAD o  HAH $/C0kT<AA AACPv AA AAG _ AA AAE (4AA C@ AA (ԝ{C0H[U E $C NLv E (0<,PeAA AH  AAC $iC HHF{ D (@vAC E j AAԞ/C k3C IF`( NC`FMH A $8CpFHN `JC FFj A $hC JJc F $,C@FPC D <ԟ$AA AAC@ CA AAA CC LHgD4)AA AC@W A AAH  A AAH (|XAA C P AA<AC CACP AA AAG ,C KFIS H E C ,<%AC]C8LLWAC ACE0EAA AApAC HHm<AC CCCP AA AAB `wC@HHx E D PAF AC  A AAB W A AAF @TAAA AAC? AA AAF `AC r AA @ AA AAF AA AAH @Xv AA AAF} AA AAE (D uC0HFHO  C (pCPHHOa E 8AA E y  CAD e  CAA Pأ`2AA AAEP! AA AAB AA AA4,LAA C@u  AAD K AAdzxKC \ A f(@CGIFF A Ĥ4AC nArAC hx-AA ACEPj CA AAE a AA AAC d AA AAA l<$C `TAA F T AA CACp CA AAA ] CA AAE |(-AC S AH GA<$ACP^A\4ACPnA(|CPHO A `":C0v@"AA CAF!t AA AAA h#|AA AAC@ AA AAH C CA AAG C FA AAD lp$AA AAC` AA AAA N AA ACA C CA AAA ((C0FIL@ B  #'C < h(VAA ACCp AA AAC `* t*@*TAA AAF AA AAD <̨-AA AAC CA AAG $ |2CPL`v A P43qAA CAE(I AA AAH LAA AA<@3AF AAC@x AA AAH Dȩ3bAC AC E A AAH FA AA39 $4?Ai F F B H 4VC o F dd4"AC XAt4M484zAC CAE0fCA AAT5AA ACE0 AA AAG Q AA AAC <@5AA AAC` AA AAA 4(7CPPJHV E  A 98C HHd(ث 9zC`MIHJf G (t;2C@FKHHp D $0<C FIFd D PXAA CCH@ AA AAD AA AA<>AA ACEp AA AAF $@XAVCpLRX G hClC g F d D SC$C ]8=cAA ACE@SAA AA(CFINIKh G D}C0FKB B $0DC@FL~ E },XECKJF B } A 'C (lFKCPFFHIU C <ȮGAC FCCCA AA@HJAA CCH> AA AAF L JTAE J AG (pHJ CFSV F 8,LvAA AAC0jAA AA<دpLAA AAEp AA AAB 4MQAC AE0 A AAD TPOcAA ACE` AA AAH W AA AAA ,0RC@FJ] H X H a$ذRCPFIFLXXSAF FAC3 AA AAH  AA AAE D\ [C@QMH H ? E w E [<T]C@MQH B  I k E 4_@_) \_C0JKn B (0_C0HO E $\`AA  AD (aFNN[} F ,eFMIIK D $hlC KF\ H s,PhAC O AD X AG 8h`AC d AG \h'AC aA(|hJCKJFs G ( l5AC T AG OA0Գ4lAF  AF O AH 4 muAC AC  C AAH (@hnC@HFHH\ C PlnAF ACE(r AA AAB MAA AA0_AC AC0SA AA$4oCPPOn H }PAC ` AC @~PC HSq(`H~C0HHHV E (rC@HHHH C *AC `A,صC0HHIb B S E $C@JN F @0XAA AAF AA AAE @t$LAF AC p A AAB CF AA(0oAA C g AA(tvC LHS F q G Ȇ-C i<(AA AAC`  AA AAD $h@C HHU H i(_AA C W AA(@CKKP, C pAA CAF AA AAC  AA AAE  AA AAH (\|CpIFH  E TAA AAFD AA AAF L AA AAH TAA AAC  AA AAF a AA AAC 8'C L )C e(d$AAE _ DG OA(H=AC Eo CA$\MCFI_ G P(C0FPFFl G 8(AA ACE@AA AAL,`AA C   AAF hwAA AACP? AA AAF R AA AAB JAA AA< AA AACP^ CA AAA  CA AAA p AA AAA H CA AAA ,AC | FB w FA 0ȻAA AC0A AA fAC0`A yAC0f AE 4DTAA C0  FAF C CAh| eAA AAC@ AA AAE f AA AAA \AA AA(C@FFFJ F TAA AAE`v AA AAE Z CA AAA (l\CPHFFHL E ,C h0]AE \ AE S AD [A0C FFx A R F f A (`C FJS J  A (D}C FD^ E @ A ,pC FHS D Q A (xiAC@u AF gA$̾C0HFl C ^4`C IFMtMC0e H \(4]FI_\A A @`AA ACE/ AA AAB T4AC ACC@] AA AAD e AA AAA @| AA AAFA AA AAA @uC LH] d4RAC LApAAC0{A8AA AAC@CA AATAA AACP( AA AAE j AA AAA @<VAA AC } A AAB FA AA2PAA AAC0~ CA AAE ZCA AA@uC0HFcTAA ACC0S CA AAF k HA AAB ,`8jAA E T  AAA @xAA AAF AA AAE XC p A (8C`KHHHs G CP} A 080C@QMNn C {(lgC`PHHR E  C s B p H $yC@MFHZ<AA AAC0k CA AAH ( FAC E z AA,LC HHP[ B c|BC ~P}AA FAC0f AA AAB AA AA(&C`HHHH G <EAA AACp< AA AAA TTAAA FAC AA AAA  AA AAF , C HNz E o A < AA AACP CA AAA ,l CPWKgE G (LCpHULB B xMC0I$(C@XHH[ A <AC AAEP FA AAC 0p]AC g AD O AH SA0,C FHY F h H a G ,`kC0FKFk C w A T87AA AAC@ CA AAC b AF AAE  4C [ B S<@uAA AAH0+ AA AAA XH AA AAC AA AAA   AA AAE 4 >AC xAT -C $p CPLHH A (!<C (T!AC y CH JA@!(AC `C(`!lAC t CE fA"X$h"C@HTHM D "8"AF Ap  AAA Z CA`# (,\# CPFVP B 8X@%AF C L  CAF K  AAK %?AC wC%%%JAH&2( ,&8CpFIFL G 8@'NC FKFs\'C TpX'AA AACP\ CA AAG  CA AAE P)AF AAE@U CA AAG YAA AAT<)@AA CAEP AA AAA S AA AAA <t$+AA AAH AA AAE T/)AA AAFt AA AAF  AA AAE  2B 2AA AACp AA AAG  AA AAF  AA AAB z AA AAB <6AC AAC` CA AAF T7AF AAC@B CA AAD B CA AAH @<\8 AC AAC AA AAG EcAC0K AH ($FFWINS G TGuAA AAC@ AA AAD s AA AAA <(@H:AF AAC@ AA AAA h@I6CHH^X`I`AA AAC AA AAC n AA AAA $dO_CPJ_N F ( PC0HHHP F 8`Q!C ]<PxQAA AAC` AA AAG dXTAA AAC0| AA AAA S AA AAA JAA AA(T-C0PHO A $UHAC BA,HUAA C@  AAF xpVAEPxA|'C @V8AA AAH  AA AAA 4XiAA AC0 C AAD <,YAA AAC AA AAA ll[AC0~A([C0HHX` E (l\UAC A AJ CA(\{C0HHOz D (\CPHHf C ,@_C0HHSn D s@p_$AF AAK  AA AAH e @eAA AAF [ AA AAA @ gAA AAF AA AAB TPhjAA AAC CA AAC ] CA AAE ( lCpMPr F 8oAC ACC@AA AA(ouC@FFWf D $<LqC MHFD F drAC OE,rAA C0b  CAE <$s<AA AAC`  CA AAF 8$tcAA CCE0QAA AA80XtAA AAC@wCA AAl'C TtAA AAC0e CA AAF y CA AAA T`uAA AAC0 AA AAF c DC AAD <0v$AA AAC`  AA AAA (pwAA CP CA w\AC@VA((x=FKR]q G (PPAA AAC0x AA AAA GAD AAlMAA AAC0 AA AAA  AA AAH E AA AAA <l| AA AAH@D AA AAD  2< AA AACP AA AAF ZAA VA@$ AA AAF4 AA AAF h XC0FIF|< AA AAC0m CA AAF LAA HA@HAA AAF AA AAB (4C@FR A (`X/AC E a CA8\AA AAC@CA AA?C HGl<AAC CAC` AA ACF @( AA AFF CA AAC hl"6AA AAEP AA AAB p AA AAD M AA AAG p#AAC0{A<#0AC AAFR AA AAF $8)C@HHHH^$`)fC0HTV C $@+C PHHz C @(,uC HPL` A w A q G  F D  | o  0  Ȕ oooP  &6FVfvƚ֚&6FVfvƛ֛&6FVfvƜ֜&6FVfvƝ֝&6FVfvƞ֞&6FVfvƟ֟&6FVfvƠ֠&6FVfvơ֡&6FVfvƢ֢&6FVfv       + /bad-path/Җ r> = = r> = = = = =  K]Bn`K֒I   U YW wPc   n n  - \{ -  - {       -       -           Lj ψ z S   c  p 3 9  Ď      4  X  ! l X &  | -   2  l 6 =  X t  ] 8 l `  Ȥ d  X h  X o o y ʰ .shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss TThh !$4o4> @ F  0NoPPH[oj  s Ȕ |0w #V| |z z]  1D(D DY O O O O O O R  \D" \