ELFd4-4 (444  TTT  < \   hhhDDPtd,, , 4(4(QtdRtd  /lib/ld-linux.so.2GNUGNUHEI:RR`p |(CEK8vqXfUa!c9pyh/)^a  nJ$F.bh.t Q/ (CWs7X<i;pBTmkE'JF^56!QB[sty RXL+6x6gK`)iXK_"7'T` 4 $ x@ `4 D @Н   I   libz.so.1__gmon_start___Jv_RegisterClassesdeflatedeflateBoundinflateinflateInit_crc32inflateEnddeflateEnddeflateInit_libpthread.so.0pthread_selfwaitpidforkpthread_createpthread_joinconnectpthread_setspecificpthread_key_createraiselseek64pthread_getspecific__errno_locationfcntlpthread_exitsigactionfsynclibcurl-gnutls.so.4curl_easy_duphandlecurl_global_cleanupcurl_global_initcurl_multi_performcurl_slist_free_allcurl_easy_setoptcurl_multi_add_handlecurl_multi_info_readcurl_easy_cleanupcurl_easy_initcurl_multi_remove_handlecurl_multi_initcurl_easy_getinfocurl_multi_cleanupcurl_slist_appendlibc.so.6_IO_stdin_usedstrcasestrsocket__xpg_basenamefflushstrcpy__rawmemchrgmtime_r__printf_chkfnmatch_IO_putcgai_strerrorstrncmpstrrchrregexecpipe__strdup__open64_2ftruncate64getpwuidmmap64closedirftellsignalstrncpyregfree__stack_chk_failunlinkselectmkdirreallocstdingetpidstrspnchmod__assert_faillocaltime_rgmtimestrtolisattyfeofstrchrnulsymlinkfgetcfgetsgetpwnamcallocstrlenungetcsetitimersigemptysetgetaddrinfomemsetstrstrstrcspnrmdirfseekchdirmemcmpgetpagesizegetnameinfodup2unsetenv__fxstat64__fprintf_chkputenvstdoutfputcfputsregerrormemcpyfclose__vsnprintf_chkstrtoulmallocgetpassstrcatstrcasecmp__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfregcompstderrmunmapgethostbyname__snprintf_chkgetuidreadlinkexecvpstrncasecmpfilenogethostnamegetcwdfwritefreadiconv_closegettimeofdayrenamemkstemp64__memcpy_chklocaltimestrchrutime__vfprintf_chkmktimeiconvfdopenreaddir64qsorticonv_open__strcpy_chkfreeaddrinfogetrlimit64__sprintf_chkmemmovefopen64accessmemmem__strcat_chkstrcmp__libc_start_mainferrorsnprintf__cxa_atexit_fini_edata__bss_start_endZLIB_1.2.0CURL_GNUTLS_3GLIBC_2.1GLIBC_2.2GLIBC_2.0GLIBC_2.1.1GLIBC_2.2.3GLIBC_2.4GLIBC_2.7GLIBC_2.3GLIBC_2.3.4GLIBC_2.1.3       ' ,L #= 7@ii Eii Oii Y }qi csi oii {ii ii ii Oii Eti si ii Y @ D `           $  (  ,  0  4 8 < @ D H L P T X \ ` d h l p t x  | ! " # $ % & ' ( ) * + , - . / 0 1 2İ 3Ȱ 4̰ 5а 6԰ 7ذ 8ܰ 9 : ; < = > ? @ A B C D E F G H I J$ K( L, M0 N4 O8 P< Q@ RD SH TL UP VT WX X\ Y` Zd [h \l ]p ^t _x `| a b c d e f g h i j k l m n o p q rı sȱ ṯ uб vԱ ر wܱ x y z { | } ~           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                  US[tn3X[5 % % h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h%İ h%Ȱ h%̰ h%а h%԰ h%ذ h%ܰ hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h%ı h%ȱ h%̱ h%б h%Ա h%ر h%ܱ hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h tT$D$$ D$$ ߞD$ Q D$&D$ $ UWVS1,*L$}-uD}8u8}t L$]%Bu|$$R hL$,[^_]ÃD$ 7 D$&D$ $ .WVS D$@D$-7ZT$-D$ $9/D$u)PT$P=D$BDD$2 $.D$u"P T$P tU =D$CDMD$ $.u9D$P T$P t" =D$MDB CMCt MtBuIt$4$3E1҃Bu!\$ t/u"C\$4$ E‹L$9u [^_ÃD$  D$&D$ $ D$  D$&D$ $ D$ 8 D$&D$ $ ZD$  D$&D$ $ 3D$ E D$&D$ $  D$ OF D$&D$ $ D$ J D$&D$ $ D$ M D$&D$ $ D$ lN D$&D$ $ pD$ d D$&D$ $ ID$ pm D$&D$ $ "D$ ,| D$&D$ $ UWVSPU D$DD$LT$$$cT$$}B8-D$(D$,D$0D$8D$<D$4T$ wcavwh` ƹ ƿ ED$4D$4f9]~'T$ ދ8-uHtuD$<9]ًT$ C+D$4;EL$4D$HtT$LT$$sΡD$$oʳ$QD$L$T$@L$(P=AT$(B=J>@b<߃AB=D$(H uCL$(A>D$ D$$T$(Xa$ HD$" $T$$T$$T$(B>L$( A>D$(H>T$(B>B>D$(ǀ\D$ D$$?T$(\$ 脊D$/ $T$$T$$u6T$(B>L$( I? I=@A>ǁ\?D$8 $T$$T$$D$@ $T$$T$$uu$ \D$\ $T$$T$$tND$f $T$$T$$xD$u $T$$T$$u$D$(H=D$(H=T$$D$ $T$$ ƃ-u({rq{N{m{D$ $T$$ T$$u{vu {HD$ $T$$T$$D$ $T$$vAD$ $^T$$%D$ $T$$~T$$D$(HA0L$(A@IAȂA@$ 訇D$(H=T$$*D$ $T$$T$$D$$ $T$$T$$D$3 $T$$T$$0D$< $T$$T$$"D$H $T$$T$$u? T$(BHD$ $0 LT$$D$Q $T$$sD$[ $T$$#T$$AD$k $T$$T$$D$w $T$$T$$D$ $T$$T$$ucD$(@DHBD$(HA D$(@H _D$(H@T$T$$|$$ 0+T$$[D$ $T$$T$$D$(ǀwD$(`@$迱T$(D]D$(H@ D$$ nD$(HA3D$(D$(HA T$(BA BAD$( H@ HA@D$$mD$(H@ HA@D$$hmD$&>Ѓ  ‰G$x|$$D$vuɃ[^_]É'\$\$,t$t$ T$$ t$D$C$m1\$t$ UWVS^pD$0\$4D$D$ D$\$4$`u7$@$ډ1T$0$‹D$ 1҉ЋT$\e3l[^_]Ðt&D$4D$$pT$H$]D$,D$4$]D$(T$,$$D$,  ‹D$,D$(Ѓ $ ‹D$(D$,T$$D$D$ T$$lD$(\$D$D$ $T1t&ft&T$ t$B$i$D$ 1҅^$D$ ^ T$ .t$B$ht&D$(D$D$D$,$n‰NjD$ <$fD$, $N ; D‰\$t$$om S\$$CSD$C $D$ M~)C[Ë$_ D$nD$(D$D$,$/UWVS$$$D$dD$8e$1ɉT$,L$HD$hD$lD$<tQT$<$n D$8:-.z-$zL$8T*t D$deD$| $D$DD$@D$LD$0v( .  m  <9 @  D$TT$,L$0D$D$@t& tD$,D T$,tD $e3 D$| Ĭ[^_]Í&;$D$|D$DT$,\$TL$0D$<\$T$\L$TD$`$T$,L$0D$<\$T$\L$TD$`$LW&D$TT$,L$0D$D$J  S t$0BD$dD$, T$0D$ \$D$\D$TT$TD$ $`T$H1tT$HL$,A %`x}p$-T$,D$8$T$4vY  tFc  uXL$,a|$$ t&F= $*t6<C=tЅűFt$$D$뷍&|$$g l$  |$ pL$, $TC<C=@gC=b1tq ɉL$$tg\$ t&T$$*]$t;v;D$$zL$ (ƉD$|$ $調F[uȋT$$R҉T$$u1[^_]Ít&<|$$t]<t<< C= ‰C=tf4$4$U<#C?t ~? ‰\$4$VpD$ t$$WC<DŽ$ ҉$ ׍t$$Qu닔$ \$ tNDŽ$ J:$L$(ND$ #D$$L$($ u\$ u&0x$؉;0u+DŽ$${?MD$($D$ D$$tlP$$~Pt;C v @$ډ$t@Tk tK9sG$uD$$XC=4@4$K=@|$$^OxXt$4$T$X$l$ $`F<$t9L$ 9J w@HttI@uD$$l$$F<tC?0y$T$ S>0tNt$ tFD$ t  ։1@tS> 1uuӋ$L$ L$(MT$ 1DŽ$ t'|$ $ t$$"Nu닄$ T$( Ru$ \$,T$$ft_1f1uQ$t:?uRu@uхt(D$$뿍& މ1@uԋD$ \$,t@D$ t&1u  ։1@uދD$ f"@uD$(t&"@u$ $RL$( $R$T$ C u9D$$vuC?t$ <.E u<9D$$t-T$@u 0ۅtF$1ۅth1ۅÍ؋t$ \$|$$l$(,fF$ uO<Őt&Bfnt&'L|$D|$Pl$Hl$T\$@u tˋu$E$D$\$}D$,(vC$tPuBu8t3t?G=@uՍD$,$ډy[t&FvD$덍t&vD$0{\$读(v'VSÃP0$tt$$z&C=@u&Pt;F wى$xJt$$|tt [^Ív4$M$ D$Qt&1[^Ã4$#$ D$QvUWVSÃ<@><u&H~Hu⋓LtLtS>Ћ{C>t$;JstN1 f ;ss=t@t(uރ  у \$$D;srfC<$D$MC><$Mt<[^_]Ð1-P$tKՉL$(D$,\$$ut$H@ ‰D$$XH;XL$ ry1ɅtlD$ 1҉l$f0>u 9tl$ uDL- t$t&Í6  DÍ&A?   DÍD$$D$D$ $i8uË` $T$` D$ D$$鵭UWV1S<e$,1$X$P$\$T)D$D5D$$*k9wԍt$,8T$t&T$ǃD$$+t$,$D$裣t td$,e3u<[^_]Ív蟪 SD$ \$(\$$D$D$,\$$؃d[Í'VSÃ$ ta D$D$D$4tFt$D$ T$D$ 4$2D$4$"D$'$D$N$[^$ $4f  뙍&SÃ$貣t[Í&,D$0\$T$4t$  |$$l$(Njl$88!  8.  8: 8I 8X 8v 8 8 8 8  8  8 8 8l$8\$T$4t$ D$0|$$l$(,qt&T$$\ 1\$t$ |$$l$(,ÐT$8D$4D$0 \$t$ |$$l$(,pT$8D$4D$0 ֍T$8D$4D$0 뾍T$$<\t rT$8D$4D$0 농T$$Z CfT$$Z=GЉ t&T$$tZ fT$$\Z fT$$DZ fT$$|[ fT$8D$4D$0 vT$8D$4D$0p v\$\$,t$t$(t$$S C)9GD$ St$T$$4s \$t$ÍvT$1t t fT$ B ÍD$ dD$ UWVS,\$@hD$$`a$KtCXt $ap t D$ $D$ t x $ԡ$ x tD$ D$$藠 =| $. 褞t  @  M  Y  h  w  $ ?tD$ D$$ $ tD$ D$$Ɵ = ,  %$ t  9C .$D$ $pD$@4$[D$:4$ID$/4$跥99t&))D$$_t$£ D$$T$D$KT$D$$Aơ $踞G5 $g_|$l$ƣ $>4$DAơ $u5  Z -  D$D$@$襝D$D$Q$荝D$D$3$uD$D$k$] tD$D$)'$9 D$D$*'$ tD$D$g'$ tD$D$q'$ޜ tD$D$Q'$D$D$-$詜 ~75 ~-D$D$$肜 D$$D$iD$D$4$QD$D$$9$ ͚tD$D$)$  D$"'$D‰D$ p tD$D$'$Û ,[^_]Ðt&D$D$@$蘛D$D$Q$耛v$p  D$ C $ou fD$D$U$ ;v  )G$;\t$|$ţ $ԜD=,$>ơ $H 5  = j= ] $  :$J[ @ D$"D$$L D$ $蟡 VS u 9&s$tD$| $ܙ$"$JuΡ  $| $r͜t $x t $ɛp x t$ޙp  t.$肛D$$D$n$覙  [^ÍS(\$0D$| $ŗvC1-`([ÍD$D$| $([É'$ YT$ T$$@P tJRuÐ&VS5 t& 9`}F t<$Su܋[uu([^É$S- v$t؋Fut 9 ~S\$ -`CCD$D$ $CtCt S SPC tST$ [[ÍvWVS t$| t$$蟛uP xt@9u`9tZ[$u@ D$+D$$ D$ ƚ딍t&@ T$ D$ D$$jf| T$$藖{ $G& [^_É'S(\$| \$$藙t`9D$} ([Ð&UWV1S$$DŽ$C5dƍ&Ct dt@$dRduȋCt$虘9|뱐 1|$$鍼$󫍔$$󫍄$D$$D$D$$DŽ$DŽ$PT$ D$$$Rvļ[^_]Ðt&VS$ t$`t&; |(| t$$`9D$}̐t&ۍu)[$ۍvKuGt CCCCCC `T$D$''$>D$`D$'$$D$D$4'$ D$D$,N$D$D$+N$֓D$D$'$輓D$D$.$袓D$D$P$舓$[^$(T @@$u-t&ʋJ$uB$á $襘  UWVSÃLD$,D$0D$44ǍD$8GD$D$P$Ӓ3D$D$,$豒t$D$'$蛒rD$`D$+Nl$,$tD$D$D$ ,$tD$` T$4D$T$$赓\$D$'Ƌ$t$D$''$<$u;\$$ 9G4$7,$L[^_]Ðt&<$1D$8tȃ%T$<tutu &tu u$-  |$SR \fD$ D$ ,$Hv4$D$`D$+Nŋ$~Pl$l$,D$ ,$D$4$D$LD$D$,t@D$4D$0w=D$l$,fD$D$,vD$,$PD$,uD$ D$&D$ $ t& tPu @$uf$ ِD$$\$\$ t$t$(|$|$,D$$54t$ D$D$8 $t\$t$|$Ðt&|$t$(t$\$ \$D$$ I'S(D$8\$$D$D$D$ D$4D$4D$D$0D$0$D$([Ít&'1ɉt$t$$|$|$ \$\$($t\$t$|$f\$ \$1ɋt$|$fS\$$tD$ D$`$F D$W6[UWVSLD$`|$4t$dD$(D$,D$D$04D$4D$8D$<4<$2V@…^@Et&Hv@HЃ v8/t3.t.-t)D$D$c <$…tIHwT$D$<$D$8T$L$<PT$8T$D$8\$$(4;0 HKHKH K HKHW @@ PV @$hu !t&ыQ$uA$?[^_ *[^_ D$@D$VSP  ҉t tT$$   9u 8t&9tËC$u4$ky[^Ðt&F$C$4$Ry[^ËF$4$ uCT$@BCt\[^_]ËC T$pB D$ D$D$$ T$pD$,R BT$4jB1҅L$,9ȉL$8v]t&\$,9 L$0ut&| Lt}9Ér9 L$0tmL$4SA9T$,L$,9ȉL$8wL$,˃%S3j&„T$@B\[^_]ÉL$0:/Dֿ T$,T$0T$<$r‹D$,9~E\$,\$0t u"D$B u\$G/L$H@ 0@@fыQ uT$pL$HA R T$4W@ t$ D$ D$$fk끍t&UWVS|$0$ .$,.$.Fʼn<$o$.E|$F$p~/,$doD8/uv8/t~GGG F3C(C )C(C`'Cp%$D$`)[^_]Ð\$\$ t$$)teуt u\$t$f шސ$w$}wt$$ D$1믐t&{qD$$D$돐t&D$1ÐUWVS1ۃ - D$vX9}L $$t$ȹt9tV<>u19T$v:: J\$t9t4< u19L$vD$ D$$cE 1k14ft&<\$0\$@t$4|$81t\$0t$4|$8<ÍD$,D${D$(D$ D$<$5Ut|$(t0$a<$xl$ D$\$0t$4|$8<ËD$,t$$D$4u ts,`D$4$\aD$Ev<$l$ D$h%'FF_$D$uG&[t9PtPuL$DT$T$$u2[u͍Gunt$u,[^_]Ív뙍D$$5YUWVSS t' tBu  ؋t$\$É4$S tt$$wPאt& t$؋\$ Í\$Ét$f18D$@O f$VStjD$ $BStVD$O $.StBD$$ f1$St+D$G $StD$* $R։\$t$Ív'\$Ét$|$׀8tKD$|k $RtOD$ $RtCD$ 1$yRu 'f\$t$|$Í' v'ۍvVSӃ$T$T$D$$OT$D$ƋD$:1҅t t$3$[^ÍvUWVSÃ<5 D$.$D$$t$D$(D$,4cT)t$$l$|$ D$. 4$ȏ;- |Lv"tHT$D$4$輆D$(T$L$,PT$(T$,D9- ~</\uD$4${D$(T$,\PT$(T$,D/놐D$D$6 4$耋D$($1ۉD$D$,D$V4$;D$(7<[^_]Ðt&t$t$$|$ D$: 4$̎몍v'UWVSÃL |<$4OD$4D$8D$<4 D$, t41f#t;uD$,4 u| 4 ET$,T$,T$,|$ |$4D$D$B T$<$nMt&< < t|6D$<$ D$8T$< PT$8T$tT$ tӋt$ 1ۅt$É؋\$Ív' $\$t$t$|$|$ox$t$|$ Ít$\$$|$|$ ,D$D$D$4D$D$0$q,Ðt&UWVS,\$DD$h $UED$N     D$D$t&tt80 1ۃ l$u u;#[toD$߃ \$ƈ { 1 É1ۃ-É t߃ v $ D$ D$}t&D$v t'D$$3F1 ,[^_]Í&D$v \$Ɔ t& t t =Lr11D$1CfT$ uCtC#t;u9D$+ tۍvu?ft .  9u\" 1땅t D$D$1\$_t&] 1É1ۃ-É u .0$t 9= t+T$T$1L$Ɔ  T$HD$$ T$T$@f&b f"\ t뀅\$fƆ .t$Ɔ w \$u> 4Z u"Ɔ .  "tm\u ufv1 @Jvntt  ]k t$ $ Ít&'\$\$ t$t$$$?t\$ t$D$$\$\$t$Ív'D$$ Í'< \$,\$@t$0t$Dl$8l$H|$4t t$H\$,D$Dt$0|$4l$8<81D$$ >t@D$$ 豲$D$$D$@T$$a@tD$,$m@t$$It,D$\$,t$0l$8E|$|$4<Ðt&l$Ӑ;D$$ @|$.ft$$D$6D$ t&t$l$$D$Wt&T$t$$T$D$&\$t$$6/ ÉD$D$$D$D$ $/ۉt$1?\$t$ÍvUWVS,T$@D$.\$Dt$H$ >;D$@WOx*+D$@D$tt$@4$@$|1ɉt$1D$Ӄt$Kf1 É1ۃ- 9D$tsus]t$@ t.t@t$t;D$ uϋT$@$ T$G$ >,[^_]D$뾍t 눍t$@$ t$뱋E,1[^_]Ë\$@$ \$딋L$@$d L$v&' $$$$$$Ë$D$ D$$ $t3$=$$$$ļÍ$D$$0 hD$\$D$$$^D$,D$$TB>!( $ D$t$, $<4 4 8 D$\$$Nl\$$) $ $;, t$8, $;t&l$$D$$$`v( $6/ ,5t&t$$ {, $>;댍t&$ $+;, t$7, $ ;$8 uu?&$uߍD$@D$l$$?D$l|$pD$0$@ v$ $:6t6$27\$$ D$, $A$$ ‹D$,#D$$$  D$/JE6$6\$$ D$$ $9D$0D$D$l$D$ D$D$$h,$<=8 8 1\$8D$4D$(|$<,D$04 Džu.4 98 D$(<4 tʃ=4 tq|> DD$4;|$(D$4vD$(+|$(D$D$,|$$R9w-D$4tD$,D$D$: $*j\$8}O|$0&ɉ~7 u$t&]Dt t =u琀|\t9Hv OD$4\$8|$<$t@4 u$D$,$$D$,TD$(9D$0v$l$0)D$D$,l$$69D$04$D$=D$$$"[\$$ D$(f4$$D$,!뜍v'D$$D$ D$D$D$ $Ðt&UWVS\$p$te$L1D$L$(|$0$mD$8 n$D$,D$,D$D$D$8$XD$$D$,D${ $D5 T1D$4t$LD$D$4$4LD$Lt*1 u+v tutE 릍<[u|L[t/<$7|$ÉD$D$$$=921뼐TM ]D$ \$D$| $f.aD$ $N.1D$ $6.D$ ,$.D$k ,$.ud 1l$H\$DD$@ l$H\$DD$@,$1]{l$H\$DD$@l$$x D$$f l$Ht$0\$D|$4D$@\$,l$8< 1 D$ 1$3-l$$l$1$w l$1$_t$0\$É|$׀>[t.D$:4$#t\$t$|$fFD$]$#tp밍<\$,D$D\$@t$0|$4 l$8l$HD$u-,$%', ҉tA1\$,t$0|$4l$8<ÍvD$l$Ht$0\$@|$4\$,D$Dl$8<D$D$D$ $x(P$T$&T$9Ɖx)D$D D$$L$u*L$P9t | .A+\$5u%t$ (ӃD$\$$, fD$$%뢉\$@t$0\$,|$4l$8<\,D$D$D$D$ D$ D$$(t (unk nownf ) , <ɉ\$,l$8͉t$0|$4tZ0ۃ~S uCPupuHtֿ 8t 1ۃÍv؋t$0\$,|$4l$86;\$(ƒ|$,~~FD$4ƃ|$,D$8D$:$D$,t7oD$tD$ D$,$KT$tl$,9tD$,D$$l$h$D$,$%V$$$,$L$D$ZD$,$?UD$lT$p PT$lT$pDt$,$'|$lG GD$$G|$8‰PO@G` D$pB<$蘧G $GA,$UD$($:l$4t4$*Č[^_]Ðt&|$,$u$u \$$P|, r, M8DT$xD$t\$tD$x $gá, D$tCD$xC CD$$$%@@ $苦G $GB$D$l$D$t$ L$D$ $.,$D$47vT$ 4$TT$ D$4fD$,$ :H===t&T$tD$x\$xD$t _T$t :E‰D$t1DH r$D$PD$TL$|$~|$~|$ ~ |$~|$~|$~|$~|$ ~ |$$~$|$(~(|$,|$DWO NvbSwz_t6T$H/ 19GFG F tWV\$0t$4|$8l$<@Ít&G랐t&tҋEGf%ÍCdGyll$hōD$pD$D$pt$`։|$d\$\L$D$ $ D$NjD$p86<- t&t9s)Fl$L$$t V9r[^_]ÍUWVSÃyT$gD$ D$X9D$  11S 1ۅ~1 ufᐅuDT$1+l$  nR11ۅ~1 uf1뾍t&u4)Ńn [^_]ÍFF [^_]f1΍UWVSLD$4l$dT$ ‹L$8D$< tы $T$Ћ@D$R~:Ot a:LuZ9uD/ tED$D$C$DŽ$DŽ$DŽ$4D$4$8Z$1C$D$4$K6C$  c$$ D$bt&$- $É$׉$t 5  $8 b1i8f4   G6t2D$$D$\$$D$4%=9 G6$D$)D$F$蛾G4D$ l D$ D$D$F-$ $$$$ĬÍvDž x fF.fF-.$p$ЫX <$9[8t\$$ VaD$<$G4O|$D$G$$%D$P$DŽ$DŽ$DŽ$4D$\$,$xEG6tW4D$$$T$$,$\$$ `G$ D$M`'fz4\$Ét$u" @1\$t$Í&$D$X¸uҋFF$t$C1\$Ít&S\$ C 3SwD$q $|3-u{wu {D$} $茲u{bu {D$ $`D$ $HD$ $0D$ $D$ $u{au {ZD$ $ԱBu {Ru{tuD$ $謱D$ $蔱D$ $|uPMM4MMMMh D$ $D$ $D$ $u7MExwMfM@XD$, $]D$; $腰ue}xExeD$\$$jt$ PD$G $ D$q $D$ $ٯD$G $tSD$ $譯u/ExCMEx]t%\$$T NExExD$Tt$(t$$q D$t}xuExD$(EtD$ $D$ $D$ $ͮD$ $赮D$ $蝮D$ $腮D$ $mD$ $"D$ $=MMh$T$D$ T$G <=tkuYT$TBtBT$,T$D$ $蒨T$,R\$$ NH$ MT$,D$, <$D$ D$3T$,D$ $uG<=tbuT$TBtGT$,T$D$ $T$,E(Mh$ JLD$,<$D$ D$芧T$,J M]\CMh5M'D$ $,{ l{ o{g{MM\$,$eM MM@reaM PMD$* ,$/;-u{zu{uE0 T$Tl u&T$TSt4D$(M8ED$(D$ D$$ڥE@T$TG誫u6D$ $ܪtTD$ $ȪuM8aD$(M8EQT$TONtD$(E/M8!T$Tt$$' T$Nu&D$H $Hu EXD$(ED$Q $uB D$ D$$Ǥ 9ЉEX|D(EX({D$Tt$$3 D$tD$(EQUXDT$Tt$$> T$qu,D$I $ku$E E D$(EE 1҉$U D$Tt$$m D$D$(D$ $tDž~D$($h D$OH S\$ CS9~L$$ S[fD@0CD$$cSă\$\$ t$D$ $dۉƋD$$D$(Ft t$$n\$t$Ã,t$ t$4\$\$0|$$|$Dl$(%=kC\tS`D$<$T$覦<$<$ T$C=wى\$(\$t$$t$D$  z>f$` l>ƍv'tD$ D$D$l$ÍvUWVSLl$`E,u&E$t$0 ](-}$t Mt,$ Et$tUD$4D$8D$<$D$*T$ 1T$ 15l9l$$~oB B$9G$G4%=T$ D$<$T$ t$D$T$ XGRO$$T$L$7L$(uT$$4$(t&|$(ֹD$$f9D$B6L$(A6ֹB$ D$8C Xt&J0CRNƉJ0C \$\$ t$t$$CHD$CD$H D$C@u;C5t DD҉֩t\$t$Í&DDC5҉uʼn\$t$ÍVST$ \$$B\tR`D$$T$91u*$$t$$lD$H [^Ð|t$p$\$l$|$tl$x/FD$ Ft C6'CD$Pl$ D$TD$X4 T$T$DD$LD$H1D$DD$<@D$ D$,,$CD$,|$PD$<$D$1҅D$,T$$赒,$]$T$贘D$\D$<$T$Vt C6D$\\$lt$p|$tl$x|ff{4uI$1 ҍT$\T$\$$,‹$҉D$\uVT$t&D$$(uNC$C$rD$$ D$5t&<$×$$ j4fL$\D$\$$L$ F$uUWVSL$tT$T$lL$P$pD$h~ ME D$Lk D$L1ҹ D$X@ D$d 1E!Ћ DEL$XT$\L$Xt,$T$Ћ@D$dD$,!$;F t&$d$D$pI1$d$(a$d$$h$D$`~UD$df$h|$L$LB4\$ L$D$- D$$$D$lt4$f$t$$D$EuL$` T$dI $ uD$LD$lmEhc$$dD$pD$D$`T$$$h$T$TT$L$$D$d$$ $dU$dr8~  DŽ$4$1r$ D$h|$h1󫍄$L$P$E $%$E|$V$tL$hT$TD$pB$ 1$DŽ$ED$H$Eh$4E$E $tFD$$D$gT$LtBD$LD$ $VD$LD$ D$ $?$ExD$H$)DƉ$Exn8F@Et $ BFL$\D$dT$XD$ L$D$ T$$貿L$PD$ D$\$ $R>D$XD$p $D$zD$l&t&Fټ$T$\L$dD$ kdT$ L$$$$ۄ$5p  f$٬$\$٬$L$XD$\T$dD$ L$D$T$ $ھT$TD$ D$\$$z=L$\D$dT$XD$ L$D$ T$t&T$TD$ D$T$ $zL[^_]Í&%=OvE  &E  &p$<1۹D$t1 t&1Ʌ~ 1ۃ uv D$LT$xL$pD$ D$0X T$8$L$4L$lD$D$(D$pT$,T$LL$$$D$ L T$T$pL$D$D$lT$ D$$TyD$D$$ D$ AԗL$LD$ D$L$ $x>&t$`t$8$w{\$dt$<$`{E|t&D$D$l $it&D$LD$ $謲|D$LD$ D$$|$QD$$$w$y$DŽ$ [$\$${z$@ $iz$@$Wz$@$$Ez$P$ qD$(  3{&F4fW4f1fG$oL$LT$Ht$\$l$D$(D$|ċ$($jD$pD$4@$pDŽ$ DŽ$DŽ$EP$E%$tD$81dv@6t$0uv1$$9$ T$@ȃt$8p$;-tWlCP҉T$@% L$0L$0A6q$pBvL$0fy4fx4 L$0D$ $DŽ$LDŽ$H$蕰$Lp$+$HDt&%=@+vD$ $x g$p7t$pDžv1ۉt&G|`9tQl4F tщPƃ|$0v L$011틴$(1L$8 v u-l$8t&;D$0 J uZRt֋\$0$pL$0D$t t,$T$Ћ$ @D$t$p$p@lrpD$PPED$PD$P2D|$PD$PD$`T$d D$X D$\~*D$P^;\$PD$XT$\} t$Xl$\$p P  D؉$@ DE…ɉ\$x$$ 1D$hD$lD$8D$<G4VNFT$@VL$DNT$HL$L<$;hÉ9\$F  D$CD@09|7A$D$$ $#$$ t&$ʍ&fx4D$$MCDŽ$HH$$$LST$0RT$@D$8$D$ PD$D$$ $:^L$8$ $pD$$ m&o0l$0Ճ t'<$D$ҋT$@$ ]G4Cfkdټ$l$$$ۄ$5p  f$٬$\$٬$C D$ D$D$ $]C W$ L$0D$0GXD$$ĻD$C@4D$@4D$ D$D$ $VGXD$C${D$ D$D$ $VDŽ$DDŽr퍔$$DT$$L$$4$,DŽ$D$ D$T$ $x;$$$4$$,c$ D$$T$D$, D$D$ $UDŽ$$lY]0F$@$<@$<C@$@G`Ial$D$$<$D$@D$hD$ll$h$D$`D$dD$P@苅$ $i T$($,T$( SÃD$t $]<[Ít&'D$D$D$D$]&\$ÍBt$|$׉$8ƍ@|$\$$KXD>\$t$|$Ít&UW1VSt=y1t2A t&8pt$9։NΉ98u1[^_]f[^_]ÍT$$D$  T$L$ $T$3* $É$։$$D$ T$D$$ΗtJ@*t\@%=$$$$ĜÍ&t$\$$ *xPD$ D$\$$pU1uT$0t@t Epfǡ׍D$9|$v,t$\$T$ED$ZT$hD5DAD$D$ D$(T$;D$ \$$D$z?D$;D$(D$,D$ $A:{.kF t͉,$At$(ƁD$4T$,D$l$$tAL$$D$;t$41u\$CL$4T$;D$D$$$D$9Y$`D$|$4$D$ D$;|$D$oD$‹@9B4D$;@D$vC<.{fvD$ $\B$<e3D$}L[^_]ËT$$L$4D$$T$T$;D$XD@09|/T$CBT$D$B$T$B T$BrBfUWVSD$8T$4D$$%tT$0[^_]ÍvD$<1ۅ119}9T$<,tYkfLt  t9|ǍT0T$$T$<,uÍ@l$8u}L$8T$4D$0\$$$=T$0D$ KD$D$B$a:T$0D$ KD$BD$B$;:T$0[^_]ËL$8T$4D$0$tfUW VS1ۃD$4D$40D$/4$;tjl$4)Xv}t=~u:ut1v/Dȃ9t:txP}YuÅۿ t\$4$NjD$4\$|$D$ D$0$[^_]v1ۿ ˍ'|D$D$$$D$<|fVS\$(t$ tD$$4$D$@tw;/t^$:Ät]1:uv:uDuu[^f/t{/Eƒ[^Ã[^ú/묐1[^É$ &,e$1$0D$D$D$$$e3u,>&V1SD$ $m;t$/[^ÍvPtр.uހxučvΐUWVS$$e$1҉ƒkT$t&$D$D$( C$JC$:ƋCu|(/t(D$$SrCS/PSSD{l$4$<;|x.9rSh{:,$c;l$$D$#wD$(D$C$D$9u/D$8%=@D$uC$-;al$4$<9Ck(tg$e3Ĭ[^_]P.xvD$D$$qD$C$<댍vD$$pW1jT$$T$|vl$1fFtD$$8t [^Ív$D$[^Ðt$$fWVSt$ 4$9t3¸:uVD$/4$61t>4$)Í8D$/$p6t$;t݉$E71[^_ÍUWVS,l$@EEEE E\$Dt0T$D fu+D$DT$DUEu ,1[^_]Í@$rU҉T$D$E~H1t&T$D<;<$G8CCƒ ШCtM ;t$uD$T$D$ JD$ $T$43,1[^_]ËT$DEUM&S\$ C$5C[Ð,$ 30 |$<0 tk$ 34 $# 38 $; 3< $V |3t p ,f$F L0 t$0 k0 F \&0 $6 $0 D$  D$D$T$$4 a:"t&0 ${6$p0 D$ 2 D$D$T$$8 :t&$J ,< f 1t , 1Ðt&0 1f 0 t +0  f @ \$D$ t$t/$2, \$$:u:\$t$Ív$@ 2$\$t$, Ét$\$$ ', Ív' 4 t k4  f,\$ \$0t$$t$4|$(|$8D$m D$ |$D$t$D$$8D$$$Tx\$ t$$|$(,k|$t$$D$m D$ D$D$8$t$$\$0|$(D$4$\$ ,&,D$8\$ \$0t$$t$4|$($=|$D$s D$ D$t$D$$8D$D$$7x\$ t$$|$(,Í$t$$\$0|$(D$8\$ D$4,7& 8 t 8  f < t <  fS\$ D$$ \$P8u g1[É\$$ p[Ít&'tÐt& Dá DVSÃ$:/$tQ2$2t$$D$bn$D$iCS:PSSD$[^Ít&T$W2T$$T$D$n믐S(D$0D$D$D$48/t0\$D$ D$ D$m $kqD$$[i([ÍVSt$ tB>tF4$1s-9ލvw;/u)4$sD$D [^Ð1t&D$ D$$ D$H 6Ð&H t$ -t8u$ ٍ'VS$$c t$K-D$D$D$4t8u[D t:u\tc$0\$4$D$xlD$D$$c D$54$4h$[^͉뚐t&uD$ D$ 4$l뛍vVS\$ t0fu$T  t10fL օu[^Ít&SD$ $D$ É$~\$$T /)*$*$ D$?$-[Í'S$$\$ t3JLu tDD$$AĨ[Ð\$$ hĨ[UWVS x,p8~19uo&9tc9uX(44$ۉ\$~.h4;Ut]|$]1|$ f݃;St>9u|$PyuOP &@< [^_]Ðt&|$U$fSP<<@, [^_]fPDf9})D$  D$D$ $kmÍ&St@>u T$ $d}[Ítԃ[ VS1ۃ@@@u#u[tFt[^Ív t$Ƌ\$X$tFPt؋t$\$ ÍS\$t$ sv,\$f;P t$ ։|$$ωl$(rsD$$kcCS PSSDP f9s$L 44$,t$$D$bh\$t$ |$$l$(,ÍL ,,$d,l$$D$$hd UWVSӃ,H(1G|D$$bCS PSSDN(9}wV49uع|1FTT$~D$$%bCS9l$ PSSDϋN(9|t&F >F,[^_] D$L D$fP ÍVSt$ $H áL P sCCCCCC C(C,C0fCDC$$C4C$$C8C$$qC;D |$ Zt$~09}At$x49t$u|$w@> D$x09|t$\$,D$(O,|$$1T$ |$1T$39l$ ~ ftV8/PN09}YF@ 9;D$$u;l$t9tT$_V8nN09|F M^0FD$$BXCSoPSSDT$FT$NDf1D$|$f-V889؋|$.V8D$D$vD$n,D$8~-N81;9Au&;x9uD$  D$D$ $2 &|$ Et$y9~t&9D$$D$L$ x0\-5L$ ~u 9~ |D$D$\ؽT$T$Qع|~D$&T$D$.~,D$(~"V81;*Bu;vƒ;ht.9uD$  D$D$ $2 vtՃع\D$$UCSD$ PSSDF9D$@D$T$ TT$ $D$t$l$$D$vZF ڋL$s~+FFFF ډFV19T$VVFVyD$$TCS PSSD8N8|P9FFF19lߍt&|D$  FD$ $D$ ]FD$lFFF<1[^_]ù\SMV0~2^<1 x9tFFFf9uӋFFFHN0F@D$$D$ 1D$  D$0D$ $i =D$  D$/D$ $$ D$  D$D$ $= D$$D$ ,D$  D$D$ $v D$  D$D$ $v D$  D$D$ $ tD$  D$D$ $ PD$  D$D$ $ ,D$  D$D$ $M D$  D$1D$ $H t&S\$$tz t3  {tC$D$  [ÐD$$ Q u"t&غ  [D$  D$D$ $ 6D$@WVS |$0D$D$D$4t$D$tgD$D$uut$<$D$á` D$ D$D$D$$u` $ D$ID$uD$4$PD$u!t&4$Q [^_ÐS(D$0D$D$D$4t=\$\$$` D$D$ D$D$D$$'$Q([Ív'S(D$0D$D$D$4tCx\$tB\$$` D$D$ D$D$D$$$P([Ít&&VS$\$0D$D$D$4Kt$1D$D$Ctr` $ D$t$$` D$D$ D$D$D$$T$uD$4$ND$u&4$O$[^Ðt&$1[^Ð&UWVS,l$@T$DT$T$BurZD$&D$ $tbx` D$$D$ )؉D$&tc~u븉,$묍t&T$D$Z| wz` T$D$ BBD$$)؉D$utP\$tP,$` D$@ D$D,[^_]` D$ BD$D$B$h,[^_]á` $ D$l$@,[^_]<\$,Ét$0։l$8͉|$4@<tIPT$T$<$T$ut<$<|9r܋T$@B3t&x)Չ|$ @l$$D$<tċT$@)B1\$,t$0|$4l$8<Ðt&{Ӎt&'UWVS˃LD$,@ T$4|$dt$4D$<t$`8\xL$,A4Ű T$4Ŭ t$$D$Ct$4؍P9sx>ЍP9rD$<vD$,T$,@<T$8D$+D$+JD$,ى<$^D$,@<D$+)9ЉT$$W9T$$t-L ɉL$01ɀ|_1 l$0u19T$$t&,1 1ɀ<_ 9tT9!B <_ u6t&9B <_ u9sVL$hD$+؋l$8)GD$h|$ D$D$t$,$`v1L$u$L$T$\$$t$(,f4$T$L$ t$$D$L$T$$L$T$$D$D$E \$$t$(,Ð$\$Ét$9 $5Kt $D$ɹ: DD$ҋ\$t$Ã,T$Ptu"t$T$,Í&D$D$ $,Ív\$Le$<1$Ps$T$XD$C4$D$ u7$<e3$L$P$T$X\ËCCtw$<D$D$  D$D$,$T$$D$ m)l$,9t$(D$0D$ D$$&{ wVT$0D$DL$(D$$T$61҅t(D$Dx L$Hxxljf T$$u9D$ t&ljͺ͐t&9M|$|$LD$mE D$ D$D$ <$ !%tDQDD$ )$D$ D$ >,$T$ ¬$D$ D$ LD$4BD$44 t&'UWVS,\$@T$9vN{9s{{ u&{ t9ul$DD$D;vu9r,[^_]ÍvD$DD$=D$D$$,[^_]ÉfUWVSD$0$e$1D$0T$PL$T;D$0t"'D$0D$0ǀ@d /L$T|$ $D$X1DlrD$0t&pPuXHuT$0$ BL D$X D$0D$DHhuCP@u<D$Dt.h D$Dtt&p iuD$Dtl$TD$8D$<D$HD$@v\$DL$@tL$0D$@;D$8D$0#T=T$,)T$4S$ $L$,t%$x$x9O>C<uD$4$DŽ$D$T$ $CD$l$$z$ D$0L$T|$ $1uqD$XD$HD$@$1uGL$0iHu uD$؉|$,$aV;|$8rt$4|$Ll$\ ǀT$8L$T,$T$T$PD$DT$Pc1\D$0T$,L$T$T$T$PaT$P$萨P @L$lT$ $D$D$0T$lT$PZXTT$P$$xT$0¬$T$PD$0lD$0:^L$HD$? D$ D$L$D$ $Nڋ !%tDJDD$0)ډT$$\$$D$ D$ T$P$T$0¬$T$PD$0D$0D$ D$ $\$t$t$ |$|$(D$@$%xÉ<$(|$C3@ CC CD$$CF ^ t$\$Ít&'S\$ D$@$贽T$$PT$(PT$,PT$0PT$4P SC[Í&'S(\$4$pT$@\$T$T$t<'<\ ffÍv'$\$Ét$|$E4wà D$|$$Ћ\$t$|$Ít&'WVSÃut&t &u4$u MftFD>ut41&t tw 9uՃ[^_Ít&[^_Ív'UWV1S|eD$l1$=$$Q=T=` uD$2$` oD۸D؀?uL$$$D$$D$t$:D$2D$` 4$$um}1B5 18  =:T$le3ƀ  |[^_]Á|\$|$$ H$$D$$D$(FT$(D$ D$ T$,Pƒ&t>,D$$|$$D$ D$ Pƒ&u‹T$$T$(T$w׋ƒ E‹T$, $L$T$D$T$L$L$,T$$돍&D$$=ƀ$ t 8'k$T$T$=T$D$ D$$VT$$Ɔ@D$h $ ZD$ )t$ t$$D$D$ T$D$4$T$$N1L$5 qL$ SD$2t$,$DAl$$ t&D$D$$ Ht&D$$T$T$t$*$ D$誖T$t$jT$ 4$T$ZD$.4$*4$$ƀ.@D$ D$.T$$T$D$D$ )щL$$^f w@ $T$ Vf$ 謔$_~$ 艔)ЉD$D$ D$ $U$ O$ CvD$$D$ D$D$D$ $IÐt&\$t$$8 $H $Y T$ t$\$T$ $\$t$É'VS$i ot $| Xt $ A$| 3$i %T$ t$\$T$ $m[^Í&Ð,t$(t$\$$Ét$ @D$D$D$4D$$D$[t#$D$D$4$C%\$$t$(,Ít&'UWVS i 8 t6i  t)tl u ([t!t$$u[^_]Ðt& 11ۋt$$tQu8 [^_]Ð5 8 uD$$P  !BDm uVSÃ.merBge_fBile_B XXXXfBXXB$茰ƋC4$D$D$襯;Cu4$x[^$ fUWVS$$DŽ$DŽ$DŽ$4DŽ$DŽ$$U|$<\$n$$DŽ$du $hDŽ$l, $pDŽ$t $xDŽ$| $DŽ$DŽ$$@$L$($$xL$($D$ mE D$2 $D$D$I$dD$ $D$0E$D$*$D$$$$~D$$D$,'x'$D$l$$ftB,$<$r$j4$b$$s"D$,Ĭ[^_]Ít&$0$A$蔩$QD$T$,$$;Av$$ASD$ G D$D$ $' E$ D$莎&'D$DT$$t%D$,DD$4 HJD$ 7 D$.D$ $' (&\|$T$\$L\$lt$Pt$tl$Xl$d3CD$$t]$D$h$ T$ T$xD$T$ƎDދECE\$Lt$P|$Tl$X\ÍFD$$uT$|BD$$qT$ 1 rD$(D$,GD$ xD$0$~ $D$$D$pT$ T$|l$t$D$4D$xT$$D$8$D$[uًl$D$$a|$ËD$$C C &D$ u!D$t}D$$ŤCt&S t8Z  D$t8D$$耤C l$fD$tD$$\Cl$D\$,D$@C t$0|$4l$8<\ \$L$t$Pt$d|$T|$xl$XD D$ D$4$1҅u;  t,T$Wt'|$,$ D$ $D$t$$xD$x%$ D$ $D$` {LD$$ D$舷t.1CBtSDT$1҃{L$‰T$*{LpF,eD$PxCp$eD$PCDT$`D$LD$@D$lD$HT$t$D$XD$@D$ CL$\~Sp҉T$,qT$,$T$h\$1t$$Dt/$蓴u#` $ D$jD$<` D$$E|[^_]Ðt&HH<-\$4D$`$D$PD$dT$h PT$dT$hDT$`$D$D$- X D$8T$,D$D$`$T$< T$`$D$D$dT$h PT$dT$hD|$d|$D$ $"D$4|$dv ` $T$SAD$PD$D$lD$ D$DD$t$$&F$` |$D$D$ D$h$f$ &D$ڳdt&F$VcB&CBD$蘳t&D$4\$<4T$0T$d9T$0< t1111ɉ\$4v1<@;T$0< tvt<@1<:ÉEō\$<&룍t&t$$t" &t$$\"1\$4`+ \$\$ t$|$`4$/31u.CPtC@tQ4$W\$t$|$Ít&ǃ4$PW1t$\$|$É$ tC@ t{LttWt34$T$Ћ` D$T$ PT$@$` $ D$-/D$NK $fUWVS<$T$@9 u 9v uN9v)^ u &9v ut$19FӉP}AxEƒ,[^_]f9l1t&돍t&S\$ $>CD$ [.&'S\$ $C$K\$ D$$[g&UWVS\D$e$L1҉L$(D$h $D$\$LfD$D$$D$|$L#D$<D$@D$DD$Hڋ !%tDJDD$()څw҉t |K F RT$($,$茅T$(KT$Z tt& uT$$L$@؍T$<$*D$DtL$HT$D$t$@T$D|$HT$ T$e$,1T$$\4$T$:J)Gl$,=1~!t& t߃ 9uT$\$$? t@P 9t$1ۅtI$XuY$`t!t$`D$T$T$$蠾$,e3<[^_]Í&Gt$XD$4$T$U$`t뇉$ЀT$$T$U E v$X1D$4$T$kN$XGt]1+UWVS,B(B@ B(%=uC$WD#ƉЉT$fkeʃ@!9u(l$l$|$$LftW@8u,[^_]Ë\$tb1ul$|$4$z?uJfH2l$1|$$D$mNT$J,Mz,C1t&VSDt$PD$KC   T$DD$ D$S D$4$ͤǃ;"SЃB@Cu1Ʌɺ  Dt$$ PD$ D$4$HSDž=kt$$ C8D$ D$p D$4$_vt$$ |$/t*D$(@t t$ D$D$$4 ϩ<[^_]fD$Z D$4$舣D$O D$4$hQD$(@t$ D$ D$$- Rt&  t& 8E׉D$T$ D$G D$4$CuˋEfɺ"  DS\$ L$u7D$u$ hL[Ív$u TL[Í&D$$f 8L[Ív$Xt$t$ t@1$t$Ðt&Xt(~,X$JB1t$Í&Bu"BZL$ ڋt$$^ fB 돐,|$(ljȃ\$ Ӊt$$t2Ot%CS 4$\$ t$$|$(,fBu:u WtCu v$h 7J&$ CR 4$u뙍v1҅K uS 1\$ t$$|$(,ÅC [ 1U3=5/7-'<$ t$<$D$A$c1&Ct GC ډ$D$\$<$St&1ɅS u  1XCet GVD$ډ$¸[D$D$D$$S9vtC S 1#t&tC S !1 vCt GD$ډ$¸D${ D$D$D$ $ǡT$1:CS 4$cCt GC ډ$TC 1>D$D$vD$D$v1~fC S 1C S uC S 1t&UWVS,D$L$IL$9j\$1ۍr$f$< 9l> DڋuD$ tyT$B t&2 uL$t$ $aNjD$p>DD$pD$|$$S<$ ,[^_]f\$1L${EL$AD$,[^_]`뽉'҉L$tT$$ FÐD$$ FÍUWVST$0l$@|$D!19rtftD$4zBD$8D$8BD$t$<$>$\$@t$D|$HL$ĝt&D$$_ =뱍t&'D$ D$7 D$D$ @ $ȓD$(D$D$$$t&SD$$\$ tHT$$T$D$ $T$$:uGuS 1[Í& 9}fL$(D ΐ)(MvCS $q[ÍSD$ X D$$D$$聜1[Ð&SD$$\$ T$(t,D$D$$dx S 1[Ít&ҸR uˋC fCS D$ [t&L$ D$ɋP uxvt!~-1Ít&1Í&x1Ít&Ґɐ&<\$0\$DeD$,1|$8|$@t$4t{t$t$$u=4$-)tIW $T$.1T$,e3uD\$0t$4|$8<Ív\$$< h;΍\$$U P;붸fD$|$ P 1Ív'WVS\$t$t#t!1 $8t9ىu[^_11ɐD$f$9ˉvދ8ҍ:xzxzx z xzxzxzxzx z 8u[1^_ÐD$T$Ít&L\$t  :u)L$|$ u/t>;tSC:uÀ;uv$,e3D$<[^_]ËL$D$4$L$~t$4$x4$n~|*/t4l$t$<$QnD$ D$' <$D$ tu11?fD$D$<$T$(D$L$,BD$(D$,D9t0< tP^vD$D$E <$葾9uЉ<$D$蛵D$(T$, PT$(T$,D|$$# /<$臶<[^_]Í&D$7 $舴t$CD$7 $hD$D$< <$H$# LzL&S(T$D$D$ D$D$$t {=w[XI t 0t 4 t ڃ4 t ¸t ([$ B"fD$ $a< Ð&,l$(l$8t$ t$4|$$|$0\$t\$t$<${?~)u\$t$ |$$l$(,fu$Z !f$s !  D$ D$D$ $MÉ' D$ D$D$ $}É'D$$T$(0D$t D$D$ $Ít&D$$T$(D$t D$D$ $Ít&,|$(|$0T$eD$1\$ \$4t$$D$d|]tC;t$8sfډ1ɉ3T$e3u$\$ t$$|$(,Ð1ɺ }T$T$$  t$$ |$<;>tk9une$Le3J\[^_]Ít&9tx u,1|9wt&\$<\$<$@g)T$,T$LT$D$LD$ $jD$ D$D$0D$L$hD$4t`T$,1|$T$D$ D$ l$D$ 4$V\[^_]ÍD$<<$xft9rt&9vC u)D$(D$D$ 4$轥D$(1L$( 9m";wҀ t݋D$(T$@1$D$@D$DD$D$H4D$@$D$T$DD$Ht$D$$蹎CS PSSDF>.u<.uF<.t1뗋C19D$$s=K|1L$,-|$,vLp-w ;D$$uT$D$$%D$$O G4L$,+T$,W8D$D$$+D$,OG<tYD$$贍CS-PSSD[D$$1Pt&S(D$0D$D$D$4t4T$4\$D$`)D$$T$ L$T([Í&xx u鍶'$$\$$$߉$$P1$$ҋ$l$$D$(FD$|E,D$0t+T$T$ T$D$[T$us$\$ D$?4$D$l1ɉD$$D$0;E,t$S$$$$ĜÍT$,$LD$0xvUWVS,t$\$Hl$L|$PD$P4$yT$DD$ 4$D$T$DD$$D$蔋,$Tl$$D$贐D$TL$T$$D$$NCS PSSDD$X~T$TD$t $T$t<$zT|$$D$:|$@t4$ ,[^_]Ív$D$ЊCS PSSD4$Ћ,[^_]ËD$$D$蘊D$$D$D$D$t&'UWVS,l$D|$Ht&u1ۍv< uE&D tuu|$@T$L<$DD$D$Lt=T$LD$ T$GG$DPD$LGtm9WG\$t$<$D$<$蕉GW PWWD1ۉE2,[^_]ÉD$D$<$FD$tZ \$\$t$t$tt$\$D$t$ Jv'UWVSl$$B,$D$XRT$@$D$\D$$xl$XD$,t D$,D$Xŋ$ET$0҃$T$(D$OuuT$@umȅD$@t^111t& Lօt3t1à LօuD$@T$\D$$T$8$R T$<$T$D$T$4t&1 t&D< uDD$X$\ u0E룍vt$$$B$t0ҍ&@uk2T$$$$r$|$0ND$$$D$D$ $|$Dl$H$\$$($YvD$D$ ,$aXtЉ|$$au뾍D$$  <  u |$4l$X$l$\$$Al$X\$t$RD$X|$0D$Xr$\$XrT$(\$T$ $T$$$$$詇$D$$b$|$OBыR PQQDt$9rf$B!D$,$Ll[^_]f$CPD$$T$8ED$ $ T$T$D$$[}KSL$(L$D$(0 KKDtD$t$0$Ht;D$$|KSL$(L$D$(0 KKDtT$t$0$HL$$L$$g&D$ 8D$(ptD$ |$$D$赁tD$ t$ D$<$D$uG19|$,tS|$Tl$ l$$uCt(D$$)|CS"PSSDtt$$"G<[^_]UWVS,\$@t$DD$9sED$${CS'PSSDt^1<'t)"o1ɉt(<"t$<\t Ff"t\t ÄuL$t$<$xS<"tM<\t)t[97Go(,[^_]Ít&CsPȀTw$ t&L$H1tʋL$H,[^_]D$<$s둍t&D$ t&D$<$r_WD$CGGDD$C/37*S/70ŀ B sL$D$vD$lD$ bD$ XD$ ND$ DC&WVS|$ t$$$'|$=tC$'tۉ$|$=t\u݉|$$\=Ѝv|$$D$ '[^_=WVS|$ t$$$'|$b=t( tS\t6't1ۉ$|$:=u؉|$$D$ '[^_=|$$\=뽍|$$\<|$$n TuD$%=@/DȄu6D$(%=@t!18$t$|$l$ Í&/8Ѹrϐ&$\$l$ l$$t$t$|$|$ 9NՉ9(uB9t>\$ u\$@/Dˋ\$ t&/tF)А$t$|$l$ Ðt&\$(@t/tƍ&/u뽍'l$ l$$\$ t$t$|$|$9ӉN9(u/9ڸ|&T$ 01ɸ09M$t$|$l$ Ít&UWV1SD$$x s9~ID$$(>DP(DD$D$,T$ D$D$($ t}9~ ߍvÍӃ[^_]Ív',\$\$0t$ t$4|$$l$(,<$|$譬S1O( C 9։Ss")T$ōTT$,$3/\$t$ |$$l$(,Ív'UWVSl$1ۋ}ut/1 9J(tJ(u9uE ][^_]Í&'UWVS|$4\$0<$+|$$D$i|$1ƋC$Q;ss7,t&t$$9sv(|$D$[0t׃1[^_]Í't$t$ \$|$|$$^(uC$*W(uC$*19t\$t$|$ÐDD9ۋ\$t$|$ÍS(\$0C(%=uC$k*D$D$4D\$D$D$ $([Ív'L$A.t/tu*1Ðt&Q/t~-guyit>ft/u빐t&ft.u։Q/tu1Àytuv⍴&'Ct&҃;ST$4sX0uP׉t$$vl$8$tD$4$D$uҋt$$t$$ɸT$ $?u(%=uC$3&S0t$0\$,l$0 T$@tQ>f' ‰V(Q@%=u$T$$bT$$NDT$ $D$T$04t$$3RV(@uC$T$$T$$Fl$($T$Jl$,*ˉ$ J J =CUERul$,\$,$T$(B;T$0v\$(l$;Gw9T$$D$$T$ o(xg&@uC$x Hl$$LËȉGȉCGȉCG ȉC GȉCGȉCGȉCGȉCG ȉC G$ȉC$O,K(O0K,O4K0O8K4Wt`ffS>S@%=uC<$T$ T$D$D$$D$8 $ٍ$,$0$ 9t$1$B$TD$DŽ$TDŽ$XDŽ$\4$5$XEERT$$$A$X$\$$$}$]C$B$TD$DŽ$TDŽ$XDŽ$\4$g$XCUER$$$$X$\$$$q$B5x x $D$,$$|$D$x $~90l[^_]ÐuC$ FDŽ$HDIRC1l[^_]Í$Bu$tG$o(mt&$~x t$l$$ $t$D$x $x9$CAl[^_]ÍD$,D$$$D$ D$t1ۋ$BD$xBl[^_]Ct&UWVSt$0\$4~ u0n~<>1ҍ& A%=t6Ft/;Aw*C4$D$t/\$0[^_]7,&9u\$0[^_],\$0[^_]+&UW1VS,\$@$kk11f;C 4F(0tND $L$=$Ǎ@LD$L$|$L$PDʼn$T$ GE(FED$l$$T$u.|$T$$;CQ,[^_]ÐL$$R L$,[^lj_]Ã\$\$(t$t$ |$|$$t 1|/)É\$|$4$1҅xЋ\$t$|$Ðt&в;Fs4F(%=uC$9úuD9럐L\$@t$DƉ|$HeD$<1D$$4$E\$D$@4$JK t(T$ovSD$$@t4P@k8BX4$'\$D$D$ $:[Ð&VS4D$@Pr\$$JT$HD$$k8qD$(T$D$D$,4D$ $T$DF4u:D$F(D$! $D$ D$,D${$64[^Ðt&D$ D$,D$ $D$HːSu ؋$Tu[Ít&' =̙ tЙ t=͙ tԙ tԙ Й ͙ ̙  É'UWVS<…D$,D$$T$11D$ D$&D$L$$؋9L$$ЅډÉL$~qt?t$t7B-D$(D$L$(T$-D$ $T$|\trfD$L$L$tL$D؅D$؉ӃD$ ۉ\$6Ћl$몐t&<|$rL$(T$$ % L$ΡT$l$2$kD$L$GfD$؉ӃD$ ۉbD$ d$$9D$,t&D$ ҉D$,dD$ D$ d$$9D$,uڃ|$,uӉЃ<[^_]ËD$($@! D$ \$Ӊt$pR)\$4$D$ Z4$)Eډ\$%\$t$É'-$Ӊ뢍l$$l! T$f,\$\$ D$$L$$(D$D$$D$Q D$ 't$Ɖ\$|$D$<%  $Rgǡș Vu{tC\$t$|$ÐD$h <$xC1tS/4$CC\$t$|$$<% ̙ e녍t&'UWVSe$1  fC-D$4$u$<% uel$8D$$ D$D$,yt&to{-|$4$stC$T|$D$_ D$ dD$D$dD$,$T=dw{D$D$,l$$詿u$ t&1$e3uLĬ[^_]^$<% d\$$t$$! 봉|$$H% 'UWVSÁ $$e$1T$P=$T$D$t$ډ$T$D$$T$t$,D$t$$<$D$xT$Ku&tD+ uD,1l$4$Jt[ 8u@D$0L$0 t u$T$,$D$Nj$e3ļ[^_]fpackBed-rBefs$D$h tnT$($8D$(D$t=tRC-t$$uS1US US USU CED$VF;t& L$(T$$D$$D$ l Ív   Ðt&UWVS|$0<$t|/t |7/uu[^_]ÉŐ$路l$|$݉$SE/.gifEt$ΐt2$<$xƍ$ht$|$É$D$8VL$43/D3$D$$f[^_]ÍUWVS$$$e $1ɅD$(T$,tE$D$$$D$ D$(D$ D$$D$ d_T$uau߅ۉ|$@t$D &tT$D$\$l$4$t܉ؙ ,[^_]Í~66D$D$DL$@T$l$$D$RP벍t&؋ȅg뜉/&L\$@eT$<1҅|$Hωt$Dtdt$t$D$( $$1҅t&ЋT$~4$^v.T& ǹָDv@uv[^_f@,$9<ty( uOT$,$T$$" T$D$;u$3T$9D$T$$( f$% D$^s$V,$D$$" D$$s$'$$$e$1҉$$$$D$DŽ$\$$& =T$ T$$D$bD$uD$0%=$$T$ D$|$$$t1ډu9$e3$$$$19ډNt11Ҹ0( $tT$@$|$$T$D$tZ$1& <\$$& D$($$ D$jZDŽ$$DŽ$(DŽ$,DŽ$0DŽ$4t&D$($' D$ljD$($耎$(D$$<$f\$$"  jvl$$& j릋D$($& D$i됉\$$-' ioUWVS$$$$& D$8$T$H$D$<$ T$@e$1҉D$D$D$4D$D$D$,$DD$TD$|$$#$$T$4 &|T$4D$D$|$T$D$ D$$v<$$9ӉT$0׽GD$(D$$< tw1 t&G< t <>D9r$D$ D$$;$~v1)9s)Gl$(|$$< uW9s>G< t6s<>t>< ft8؋L$0>t* t%9uD$,$j' D$f1;\$0t؀8 tݍ$T$D$ $D$ D$D$ $$t$8$t$D$$ut$8|$HtT$0T$Ht$4$t$t$$cix _$D$BT$$D$ $ͽT$$D$,-$8 H-t +H H H @ B$D$ D$$i$z :$D$D$,T$$|$T$D$ $4$RD$T$(B1$>,$$e3[^_]Ðt&$T$4T$$D$uv9T$d$|J9t$`rBD$t$$|uB$D$ \$,$xt&$胻,$@$ݾ->$ D$(D$D$ D$$D$D$ $iÐt&L$ T$&'VSD$0\$$t$4D$D$,$D$; tJT$ $T$T$(T$1҅x [^Ít&uT\$$' `ِt&ttG[^f\$$' ``[^Ívủ\$$' K_v\$$' 8_&VS\$ t$$u t&tC@t$$蓿u[^Í&UWVSl$e$\1T$4  1҅t.1t&$ ډ Ƌ u$x T$8D$0 1T$&LD$P\$$- {@@@ @$@(D$\t$D$4,T$(L$`D$t$ D$hD$D$\D$LD$PD$T4@D$ D$$躠D$ $ t$LD$ D$ 4$\L$ $耐4$D$D$D$<D$4$'T$X[ƉD$`tC$d) D$5Cvt$D$4D$dD$ D$hD$D$\D$@$՟D$t#D$dD$ $D$\$) @D$#4vt$`t L$D$`$x* L$4t$`iNtkD$ 4$ZD$ 4$Bt.D$ 4$.tD$ 4$_f ?CD$,$'|$Ɖ$9u֋D$D$;11獶UWVS,\$@u2t&ST$ֹC4S<BRkSPUPUP U @EC0 ȨC0D${T$ ЈC0T$Hu<wC4p,[^_]Í&t$tL$ $2u&D$C0됍vL$DkLt&D$,$D$uD$C0SUWVS$e$1$$D$C@$D$ D$l$$/o,$D$[D$ D$l$C$4,$"9D$$T@l$0D$(D$, D$4OK D$8$誌,$l$PD$TD$貄D$DŽ$|...$xD$)D$$$}D$,$͵D$(D$ l$D$$譺,$5,$@t t],$*uD$$&$D$D$$$D$f$e3D$u[^_]Ðބ&'VS4\$@D$,D$D$(t$DD$$1҅u 4[^Ðt&C@D$$T$,L$(tD|  EˉT$ D$4$L$D$D+ p4[^Ív  EӉT$D$4$L$ D$+ 44[^Í&T$L$ D$D$+ 4$%v',D$D$D$D$D$$@yD$,ÐUWVSD$H $}h9D$\$$x)1D$,D$D$$q}D$,tf9tb8u])9sT)Ãu1t1v:+ Q i KJKJK J KJu/4$tUdD$#un߉t$<$8e\$$>/tg؋t$0\$,|$4l$8<Ða$YdD$M#l$É$d륐t&D$@|$$D$cy&.tR$d,$ljD$G$D$c|$l$$D$gT$u;|$ ;vt%]ut1[^Í&t[^Ãtt$$/ &L\$D\$Tt$Ht$PeD$<1;-\$t%4$@t*D$ $(4$HZ1$(4$0Z1tt8/tb$\$}\|$,D$<$^$ M\$m0 $%$bB %]D$ $0 \$$0 $2 |$$80 $P0 D$$80 D$\$$80 {t&'UWVS<$0  WËD$Pt D$PD$$ ]D$(  !%tDQET$(\$(l$( $ VD$ t?L$PT$(ct \$PtL$P ɉ B<[^_]É\$$ qD$$2 D$,y1Ʌ11t$ \$(t$,|$$ύt&$F $2Ņ,$WbB c9}a /ut B 3T$$3D$ e$B Yqƃ D$ $0 |$P$ Y|$P1&F ^.D$ F T$PD$ q$ T9\$(tD$ 8/t$U$D$ $ YL$PT$(D$ mD$,$aVD$1ҸbB L$L$ƉET$PbB $ )T9\$(bB t\$$ v$ hXuiL$PT$(m1\f 9\$(tD$ $TD$ D$ $ $$ Wt$m0 &-I9\$(  tq$ W$ 0$ 9Lƀ #1t$P$ hWD$P1l$bB C#1Y$bB  t$ F t D$ $#19\$(  L$( Ɓ /Ɓ ƃ D$ $@3 x$2 D$ ED$F $3 O$0 cvuD$$-M'UWVSÃ<1L$$t>21׃A A TF FuՋL$$<[^_]ÉT$,V$|Jƍ@< $l L$$l$Pl$|$D$ 05 D$D$$ NL$$T$,12^'$$T$L$$É$։$$<$D$ k> D$D$MED$$$rDE|$D$D$$$DD$$t$\$$DD$$D$$$@E$$$$ĜÍ'UWVSÃ҉T$~?1ҽ$  ;T$t$<$Ɖ8u݃[^_]Ðt&$ ޹18Dƒ[^_]UWVSӃ,D$@D$D$@ D$tA1ҽ\$ ;T$t$t$8u܃,[^_]Ít&\$T$DD$D$$T$щB RSPSPS P SPA,[^_]Í&$$$$D$$BQBD$tD$xD$|4Ƹu}D$D$\$$EuD$$%=uoD$@|$t\$<$D$NJuWD$|8/uND$$Bu:<$~D$$.$$$Čf|$t<$~ɍ&UWVS|$<$t_l$D$/4$BuCCs v1똍t&UWVSÁT$({D$0D$l$$YF|$`t$\'D$D$l$D$ D$t$$,$(D?tOcD$,11t&ŋ9vt$<$F\$$> Ĝ[^_]Í&H$@ ,$C\$$> `Ĝ[^_]Ðt&oO̓l$,Yt$<$Fl$\$$6 t|$,t`k0TD9r9wT$(L$,B1J$zr2t$<$E\$$p7 @(9tt$<$oE\$$P7 ,$B&,1t$(t$0\$$Vt\$$t$(,Ít&FE$m$@D.idx@|$D$>D$\$$t$(,UWVSÁKe$1 ut&1t 9 skEC,T$T$D$$nCS C  '3T$L3D$H C,D$D$$4CD$C,D$$C$D$C,D$ $ b$PACK$=t =S$9T$ D$l$$X8 |t&1t#C,t$@- C,$e3ļ[^_]ÍD$,%=uxD$HT$LCS D$|D$$BD$|v 0v l$$%? /&l$$7 vl$$> xvl$$7 `$7 O$? >$_CED$$> ȉl$D$$8 ~CS D$ D$C,T$$:!ЃtoC,$D$t$$u7S(S184l$$8 sl$$8 ^l$$8 I?$> cv$$$e$1$$T$,$DŽ$infoDŽ$/altDŽ$ernaDŽ$tesD$|$D$ m D$D$$?D$8D$l$$n?D$h\$d |~ $@ QD$D$l$D$ D$\$$,$2=D$, <$D$X\$4$?$e3u.$$$$Ð,$w09v,ڃցu܋T$<2[^_]Í$W? l1[^_]øύt&'L\$<Ét$@ֺ8|$Dljl$H8D1tftD$P3kC D$TCN>xD$(D$ D$,D$l$4$¸tjL$,A t])Չ3k$D$,t$($ ot$D$k> D$ D$D$D$TD$D$P$,C1\$19^v~$t\$t$Ív[t$\$f4$`1uɋV뭍vSD$L$ Px$t0PR\ȅx1[ÐB[ʋ@Í&I1ҋ[ÍUWVSL-L |$`T$d|$,T$8zhT$8B$0w|$0|$,t$D$Xt hD$X$\$\T$0$D$L$L$4$D$8HD$PT$Tl$$$T$D$D$\$l$ D$D$8T$$$$L$\$D$0L$,5T$<ׁ GT$(t0$L$(GG5+w  Bt$,;5| H 5vlD u!bf595| [sOD {u݋Ct։$.CC+s95| 5B[r&$T$4L$&'L\$<Ít$@ƉL$, F|$Dl$Ht9^ t;L$PT$$L$L$TL$ L$,L$\$ D$D$$$b\$$= D$ΩT$$$Bl$$= D$让fLeD$<1D$T$TD$D$L$XD$D$\$D$Pɺ1T$ D$ D$D$4$HD$dD$D$$D$ 4$]$ $@ D$=|$$.T$T$$D$&|Ív' |$ D$D$(D$D$,$$21뀍t&D$4$ D$t$D$l$ \$D$<$10t$$H> 4&C$t$$A D$Sv몍&$at$$A D$轟&S\$$D$ D$ \$$萼 v$;PACKuC1=t1=TR[Ít&'\$\$ t$t$$D$$x9u$\$t$É$$CA D$4$y@$t$$\A D$VSD$ $/uEt`7tKX1t$t$D$$-[^Í&D$ 4$.t1$B \$dB PD$$\$t$t$ $eCt<t5<t1\$t$ÍvD$,$D$p1\$t$f4$h$t$D$ft륍v'UWVSÃl8!L$,D$T|$4D$\$<$\$,1t*l$Tfl$$蚐[uvD$,4D$,D$$pXʼn$SBtϋE,1D$9 $BD$D$ D$D$<$Cu,$CFCFC F CF<$>D$,$Ҕ\$T1tD$$6[uD$T$裔l[^_]Í,$vD$\D$D$XD$ D$$@1cx!uZ\$$A v'UWVST$De$1҃|$D(L$HT$D; DŽ$DŽ$DŽ$DŽ$DŽ$D$PxxxxD$TxxxxD$XxxxxD$\xxxxD$`xxxxD$dxxxxD$hxxxxD$lxxxxD$pxxxxD$txxxxD$<1ҋt$D,t&K\PDˉ9|$Pt(KЀ vύKvčKKɃ 볉T$<|$@,,L$xT$@T$D$ A D$(D$ $,D$4ۉ\$8D$<D$0t&\$8T$@D$ A D$D$T$C$Y؃$L|$4ÅD$,txt&D$,$tNk,$K&uދL$0|$R9u΋t$4t$z&D$4륐t&|$4ËD$,$T$8ۋT$8t&|$40T$,\$,1҅$D$LD$8L$(v\$,1$蚲S҉T$0u[t&k9sCL$,\T$$\$ $t$(T$$(Ƀt 9r9\$0T$,T$,toT$8u5L$L$A$A$A $A$\$4 $e3 [^_]ÐT$,\$$l$<$\$ D$0 &87zqw\$ tA2B\$\$,$q$u ,t&ȉ8 uZHwt:@2Bt/L$8t$L|$0uD$8\$4 CD$zED$~E$E $E$E$E$E$E $E$D$4f$D$0D$LS1D$4|$4~0$E\$@T$D$A \$T$H9T$4tDҍ$$DL$HPQPQP Q @A1$$k$L$H$A$A$A $A1z$1ۍL$xD$ $É\$48\$P\$@ɺ$ƍ@3$t$|$ã,@$uD3CD3/t&EƉ$_T$@@t{T$4$|D$G@$0T$ƋD$d8D$d)@@4$L$dt$ $D$&4$L[^_]Ét$$B -kD$D$$2!L$dD$ vD$$!L$dT$ Vԍt& LD$dT$dD$$D$(pD$\$\$$$D$,4)D$%L$d\$A$"x]L$dtxT$d)BBD$($D$M D$(L$dD$D$, $D$q%$I!L[^_]ËT$dtE9D$dp@0D$ $D$dj&D$$L$d룐&,|$(|$\$ É|$t$$D$D$D$4$19uD$D$<$= ‹D$Ћ\$ t$$|$(,ÐUWVS$$D$0$T$4$D$XT$HT$$D$F&D$X%=T$,|$,$ͥT$4ET$0EBEBE B EB |$,t&D$8$D$,$e3u8[^_]Ðt&|$,؋T$,v |$,bvUWVS1ہl$$D$0$T$4$D$}u+9w'}f<{u9s {^+9v|$,(D$TD$,D$81D$4L$0D$T1ۋT$4D$ ,$L$T$i.T$8T:-T$(HT$811Tאt&TJЀ L$(D$dt$ $gÍD$d$D$$\$d<D$`L$0D$D$\D$D$XD$D$TD$L$ \$|$$t@D$\D$D$D$X$VT$4l$$B T$D$ ZD$T1$Pf9t$,ƒ)9sW1ېt&<9\{ut;ɉL$huDL$|e3 Č[^_]Ít&1ۉ;T$(ÄɍL$htPu|$h<$u$~G$u xv@tnuL$0BRPQPQP Q @AO|$h<$tt+uf^G$vt8tG<$}tҍ 9\JC߻vWL$0WQW QWQ GAf9 {D$|$$u{}tb` D$|$$u {} D$|$$u {}C<}}T$,1T$4D$4U1T./'$D$4L$8D$HD$HD$LD$P4D$ $%L$0D$TD$ D$$( L$=D$4;D$42L1T$,T$8&|@Tu|{u\$,D$8T$-tD$D$ D$ D$D$$Ct$(\$$D$0,t&\$$t$(,Í&UWVS$$$$ ,$T$8L$0e$1҉D$H|$01tftL$0ډǁ0L$8JtDE<:tl1҄u2f<:t<{tBt<})uf$e3[^_]Í&뫍v~E,E$0ËD$H$D$T$4$T$l$\$$ʨ1;s=4V(%=uC$T$(T$(9ND$\D$D$4$D$h_$T$8$ $T$E؋D$0\$D$ ;m$҉$T$0$B$B$B $BЃD$\$$EC@ʼn)؃D$D$,$eD$\$^,$D$D$L$,L$@AQ 9scL$D)‰T$o$L$9l$ld$D$D$D$$D$HT$@rrDl$,[^_]Ív'VS\$ t$($t$CSt$D$$$D$st9v*Cs0[^ÍD$$s <\$,\$@t$0t$D|$4|$Hl$8D$@$GS|$t$D$ D$)ЉD$S$19vJL$$S|$t$D$ D$)ЉD$S$ž1Ʌu]9sƅtT9sdCs0\$,t$0|$4l$8g t.}aD}l:}l0}&t$$D$\$4$D$,$D$(@$Ө4$;,$3iC1\$DD$p$ptC$D$dT$(D$LT$,D$|D$8$1DD$D$T$\$D$h$,$;5q\$$$LD$$(D$Č[^_]Ð$̍j$? HB$|$ D$G $T$赙#T$$td@ iv|$$F D D$X c똉'UWVSl$t$T$D$D D$HG D$LD$PD$TD$XD$\4l$D$F 4$D$\$<DD$\$p(D$T4D$\D$XD$ D$|$1D$DD$ D$ D$8` D$< D$,l$4$%D$,1D$4$D$|$\?Tt&uIuAD$ <$T$ T$t%)~ǀ??u€?utD$,$4D$ $.u]4$,l[^_]fD$LG v4$1l[^_]Ít&D$4$|$T£$H ?$(I ? l\$\\$|t$`|$dl$hl$pECECEC E CEt$xD$(8tމt$uD$(\$\t$`|$dl$hlÐt&D$t?T$x$;-$)-D$H$ $-D$L|$HD$|$4$z@t(T$LT$T$,D$4$Z@T$,T$tD$tI $PI T$B?D$( t&D$tD$ H $PI D$?&D$tD$0H $PI D$>D$(&D$HD$T$$?uuD$LD$|$$?D$LL$HT$t$D$<D$tD$I $PI D$`>D$D$D$(2$EAEAEA E AED$(ECECEC E CED$(tPD$tD$UH $PI D$=L$<_11ۍvT$D@4;\$Wt9<>u19v4: Jt9tp< u19vD$ D$$褍E D$t&\$$J 3Et&D$$$ E|1賏v<1\$0\$@t$4|$8t\$0t$4|$8<ÍD$,D${D$(D$ D$<$~to|$(t0$H<$$K D$`2\$0t$4|$8<ËD$,t$$D$L4$D$D$\$0t$4|$8<Ít&<$蠕$ D$25t&'UWVS1ۃl$4uBZt&D$6K 4$(tA)߉|$D$ 4$t)x9vt$0D$K މ4$u[^_]Ðtp@5u!8\tK t6t u\Aru@5Ðt&\AnÍt&\A\1É'L\$<Ét$@l$HՉ|$D$豇1tAt:0tJD$$ 4$L$,fL$,1t1u,~u&\$l$$tDžl|$(d넉$耈$TM D$#4$h$4M D$#$|M #UWVSl$l$L$4$D$XD$\ǃNjC ˆD$,$|$t$,$虺C% = tBt|$Xt$\$Iu*$PX,$ l1[^_]Í$Au*$غ ,$ $$ _T$P$$T$

t4$vos{ DC[^_f$CN t&l$ ͋L$9T$$Ét$Oʉ|$9ɉ(u +D$u$t$|$l$ Ðt&~ ݐt&;T$}9҉މu1|/D뱐L$ D$T$ɉHuÐvVS$\$4D$tKD$D$` D$ $D$at*D$D$D$0t$$$[^Ít&11ډ$2w$UN D$fSD$ PH+9r )مɉHu [Í&[$CN [t&'UWVSÃD$ $T$T[jUWVS<8D$,&tbtÉD$,$~]%+uD$PuPD$4$蝗FVPVVDuD$,84$D$I<[^_]ÐD$4$MFV PVVDHG1ɉD$(1\$TZЀ wIL ЃuL$ D$4$FVL$ PVVDt&ZwL fZwL f!\$|$(fD$1҅~ ҃-t&+t!1Ƀ.Ҹu T$!Ív\$\$ t$1|$tD$/$[9tktgx:t\$t$|$Í&x/uS9tڍxf9sω t&9s)D$19$#uߍ&1뛍t&됉'VS$\$0D$:D$D$$D$4[9Ér!L$1ҍD$0$C$[^Ðt&t)؉D$D$\$$^t$0뿐&,zN D$0L$D$D$D$4$,Ð&,}N D$0L$D$D$D$4$,Ð&t$t$$\$\$ 4$]t$$D$襙Ct"S|/tD$D$ $|\$t$Ã,D$0\$$\$4t$(t$4$D$D$D$D$4e$[4$D$軔t$(\$$,ÐVS4e$,1$H\$,$@D$ D$D$$DD$$D$hZ@ \$t$ D$G D$$CX$,e3u 4[^^t&D$$$N D$D$ D$AÍ'D$$$N D$D$ D$Í'D$$$- D$D$ D$$Eat&D$$$N D$D$ D$$at&D$d ÍD$$D$D$ $'D$ $ D$'D$$D$D$ $d &VS4e$,1$@U$3V1 &t,w$%,ru݁t Ƅ4,%rƄ,$,\$\$,D$D$ D$ D$D$$^$DD$$d 'D$$D$D$ $ÃD$$D$D$ $ÐUWV1S,dED$lE҉T$~5t&;D$l$\$<$D$^u&1ST$€cS$€MtHtSu |$|<$? ?  ƀuu|$ƀ4$o&VSt$ t.1ۀ>u /fÀ:t&D$ D$$T$ u݉4$PÃ[^ÍvD$ tJwD$ uf tD$ D$$WD$ u1É'UWVS1ۍ&t%tD$$^qT$0?9u͋L$,A$:1t$(|$<\$4,t&$А‹D$,uI9\$T$($NPt‹L$( $.jtZ$,` D$t$01ft$l9$e3<Ĝ[^_]ÍT$($$L$, $D$D$$QT$$u*J JKJ KJK BC$%E$EIv$_ D$.A|$g6;Dދ(lj$</$a D$Sv,\$ \$4t$$t$0|$(|$8$` 7` D$m |$D$ D$\$D‰D$4$?9vt$0\$ t$$|$(,<&5\$ t$$|$($,UWVSD$ $T$fT$a D$D$>D$ T$$dD$>D$ $Ɖ׉T$ea C4$|$D$>D$ dD$>D$ $Ɖ׉T$~ea C4$|$D$>D$ HdD$>D$ $Ɖ׉T$8ea C4$D$>D$ |$dD$>D$ $Ɖ׉T$da CD$>D$ 4$|$cD$>D$ $T$dT$Xa CT$D$,$<<[^_]ÍE<[^_]Í& 3<[^_]Ð&D$$D$D$D$ $1Í'D$$D$D$D$ $Í'<\$,\$Dt$0t$@|$4|$Hl$8l$L$` !4` |$D$m D$ D$\$D‰D$4$;9v'l$D\$,t$@|$4t$0l$83ډ݃;T$S< < 9TL$0xL$ t)l$$T$|$ D$,$2L$l|$ $+|$ D$D$4$2T$h|$$j+Wt&ڃ;T$TD$,tD$,)?9\$)~wGd$ D$l c  L$KD$t&,$- l$T$$Yb $4c S(ED$D$D$D$0D$$@h u D$=i t"=i tkt $ƒ([Í?c 1 @ c uu  u뿍t&$}b >E[f?랍vVS$\$0D$D$D$4%@=@E@t$t$D$OD$D$b 4$gÀt$D$D$D$b 4$gt$D$D$D$b 4$gt \$uPD$ D$b 4$g4$D$c$[^fD$D$tb 4$Pg+vD$D$ 4$0g떍D$D$ 4$g%vD$D$ 4$f.vt$D$D$tb 4$f&D$D$ 4$fvt$t$$$\$L$D$ t$t$ T$\$ $t$t$t$t${t&'L$(T$$D$ D$ D$D$$=É'SL$ T$~.0 ut& t9u[Í1[Ít&UWVSLD$l@\$`t$d|$hzD>D$0< D$4 D$<T$l1\$81D$ T$$T$l\$$?T$(T$lT$,'v uSۉt+T$ 9T$(F9t4 uӅT$,D$ 9uӍ&\$8D$ D$lD$(t ;L$ L$(D$l11|$$|$(?D$ 9D$D$$$_SD$KBCCD1҃9tG.< u;T$ uD$$^CS PSSD19ut&ҋ|$$t8jt&D$$^CS PSSDu+|$(t$(|$t$$cD$4D$0KtD$ptT$pL[^_]ÍD> uD$<1l$<덉D$ ,&D$<D$4D$0ǍT$ D$lxtD$ 1St$$|$(D$ D$l׃?At&D$D$$l]SD$KBCCD9l$ T$$*< u&D$$ ]CS PSSDC1)u멐D$$\CS PSSDvD$$\CS PSSDLvt$$|$(+|$ t$ D$0D$<l$D$0< 1D$lD$4t!D>D$<D$0D$<1UWVSLT$d|$p҉~L$`| L$`D$ $ ҉D$,11$97oD$0D$ D$,D$D$݉D$,$!uE ur97~nD$8T$`L0\4)9\$lN\$lۉ~(D uD tu1ɋD$hL$T$$$vD$,$"L[^_]Ðt&t| tBt&UWVSÃu"Ht&)hCt$l$$)t(|$D$ 4$'u͋C|$t$$[^_]Í'UWVS,D$H\$D|$Lۋ@T$D$tU1$|$\.KŋUUT$ UU T$)H)ыSH)HыT$L$$T$]u,1[^_]Ít&'UWVSD$8t$0~O\$41nfL$T$,$^;|$8t&K| u؋F u);|$8uڋN ug1[^_]Ðt&L$T$,$X^N VkFtFF 념t&D$,$XFuT+t&V&^tFF 1[^_]ÍFD$$XNu볍UWVSD$,tlD$ c [^_]ÍvPJЀ gp1ɉ҃ LJZЀ v9?T$ /VB< %^1ލ&҃DBJЀ v9T$ Vt&UWVSLT$`L$dZD$0‹I\$4\$(ʼnD$8D$lL$|$u7D$C\$,t$0|$4l$8<Ðt&$ ,CЉ,$i%$d D$'@T$$D$@F‰D$D$ $ Í&UWVS,t$@\$DF `~ $$FD$t0ڹt$ t< uu$ŋD$hD$1 h^D$ $T$T$l$1;!E t9tz1;!1Åt)؉$D$‰ËD$HT$\$,$D$T$u&$/D$D$$9d,[^_]É\$$d D\$$dd 4t&UWVSl$0U tF}~11ېG$$9G$<$E E[^_]Ã,T$0\$D$4t$ |$$4d l$(֋l$88uUtu^d t1 ue 1\$t$ |$$l$(,Ð ݍt&l$8\$D$4t$ T$0|$$l$(,T$$Hd  T$D$$d S\$ D$8D$ $ tCt7! d DЋCd T$$e DD$薽[Ívxe ʐS\$ $ptCQ. $e D‰D$?[Ív't$D$$t$ \$D$4$Í@v7ae Fd L$$e D‰D$؋t$\$Ív$e %e 뿐$oe ļt&6e 말He 럐UWVSd D$`@ɉL$bʉ|$(<$3|$3|$ ݋\$Dl$ |$\|$<3|$41ߋ\$1lj|$4t$4|$\3bʋ\$,4$3\$813t$$|$$t$ t$H11É\$8\$ t$8\$$3bʉt$$t$1t$$3\$\\$$\$\\$\\$@3\$<3\$X3\$(Íbʋt$$l$\13l$ l$b΋L$$3L$ 3L$<L$@L$T3L$Lt$<1ыT$@1ً\$  bӋT$$13T$,ڋ\$,T$ T$D3T$P1‹D$ 1l$$bʉl$$ʼn13D$@ŋD$@D$@D$H3D$T3D$(1bʋt$ NjD$@13D$ |$@D$,D$X3D$D3D$41ȋL$,bD$@11ȉl$D$(D$03D$H3D$8=bʋ\$(1Љ͋T$,13l$,ËD$`X\$`D$(t$ D$T$L$C SKsd[^_]É'D$@@#Eg@ @ܺ@vT2@Ít&'U1WVS,\$@l$HL$D3{L$?StG@)9FS2T$|$L$$Z?T$t ,[^_]Ð)|$[?v/t$؃@@A?wL$E?L@L$tL$l$H\$@L$D,[^_]t&<\$,\$D|$4l$8t$0t$@;kD$e $ȉD$ȉD$7)?D$D$D$D$$1Tʉu\$,t$0|$4l$8<Ð,|$$|$4\$t$ t$8l$(l$0<$itF9Ct$|$,$D5؋t$ \$|$$l$(,Ð|D$D$$$D$1҅uD$ 1%=@‰Ѓ| UWVSe$1$$DŽ$ 9; D$\$$=} D$$$ 1tC$u$$D$$= $ D$$ 5 tI4$<$D=t|/t/|$$(<$D$,D$t$$utD$<%=ud D$D$ $= ) l$E  $uf $e3Ĝ[^_]Í& D$/$tF$@ǡ O$$1t\$$ef t&$ǡ V$f դ $Jf D$蠤 $5f D$諤|$t$$f wD$$f 臤"\$D$<$/ Jv'VS$;/D$$u$f tD$u$zu !%tDJDm u\$D$uD$D$ D$D$$e=e[^ÐD$ D$D$u$$D$t$$/$$3T$$3D$ $$3T$|3D$x D$t$$uu/#m Dt&D$\$$ex=\$D$<$/ et&$f tWV S\$ C18D1`h <$D$tu1[^_ÍD$$4dh $D$1[^_Í D$ ҉D$t $@g 诡$ h 裡,D$ @ L$D$T$D$h D$$|,Ð&VSu$`趻Pu<uG1҃9rtft[^Ðt&Htvf묍vVSu$P u<uG1҃9rtft[^Ðt&Htvf묍vWSu$V¡ףB00u4u<1tft[_Íz/tf뷍t&'WS u$覹¡ףB$$ u4u<1tft[_Íz#tf뷍t&'WSu$¡ףB00u4u<1tft[_Íz/tf뷍t&' )  R 4M    R J   S8-t9&9t4QӀv_tQЀ vQvكAvѸ[f1[Ít&UWVS@$UtW11U4Ft31ېTi tti ti t$;^rЃ4$;}r,$v[^_]Í&'U1WVS,҉D$T$D$t<Ӎ& 19uЉ)‰T$T$ t@D$ft29ku|$s 98uڀ| uӃ,[^_]ÐT$1ۋD$iuD$ $VL$T$L$T$Í@ $T$L$k D  $C$D$($5S(Љ@i ,[^_]Í&UWVSӃlD$i $D$E*JFdl$DL$$D$,$D$DD$\$t$ |$D$~j $L$$T$DD$$L$t& $L$$TL$$l$D,$L$$t$t $ T$,t$ |$$,k T$D$\&rT$4\[^_]ÍD$D$f`T$,\$t$$k T$ t$t$$\$\$ 4$ut$D$ ؋\$&UWVSLD$Zt$ l$4XZXZ X ZXJ1ۉHBD$B4$D$Gml$4$[ot#D$<%=@t'l$4$8ou݋D$L[^_]ÍD$4$dt5D$8T$D$D$$T$3sf$D$leT$빍UWVS<D$ED$,T$ D$$u ]t&D$$T$ B:uT$ t$(D$$N|$ D$ t$<$ÉD$,\$(9D$ t$$;\$(D$$T$  tD$$T$  uދ\$,T$ D$$3x4 KJKJK J KRS\$,D$ l$$GCD$$ C ~U1"D$,T$t$$iT$9t/T$$t$ D$ ~uȍD$,$L<1[^_]fD$,9xuT$ L$T$$U<[^_]$j ~fUWVS\$0|$4u.)$~D$/<$u<$+sk $xI<D$~C $0S CD$DD$$k[^_]VS1ۃt$ tGxAF$t2F~)0&9^~ F $u1ۃ[^f[^ÍvUWVSuktl$ D$ D$$lj\$,t$0|$4l$8<ÍvL$T$ D$ D$$L$wt&D$ E D$ D$$Pn'UWVS\T$tD$ T$T$p$m\$tT$pt$tD$4D$UM E$Pk] څU$t kE D$E$kCE kE @뛍&<\$,á t$0։|$4|$Dl$8l$@( $ ,$L$l$$ D$$\$$ D$L$t$D$ $ L$&<$|$$ D$z( \$,t$0|$4D$@l$8L$XD$4D$@1ҋ@ ‰D$<ЉT$4T$PD$H~+t'T$@1ɀz$AD$DD$D|$Dt9L$P߅ L$4 D$l $诵|$HtfT$@l$D\$1Ҩ¨l\$0 kt$@؋$8 $$<΍t&$0D$TDŽ$D$ D$ T$T$,$(L$T $|$$T$(D$0T$DT$(D$ T$HT$ Bt1;tlT$$$& uҡl,Ep4$T$ ;Buz9uET$ L$H+L$D0\ S s XZXZX Z @BT$$lL$ R4Q(@ A$t&T$ ҉T$ T$ Bۀ|$O$@ $$@@@ ` $@D$$D|$0tD$0؋$$u[^_]Ë\$0t"Ct$@؋$8}uދ$@` $@D$$貭q'UWVS,\$@$]<1҉Ƌ@$tf@u$1&hv$t6t&>O:yzyzy z IJvuыT$Hl$$D$T$T$DT$ ,[^_]ÐP w$Xm t&vÍf$ 1ttڃtӡ DÍv1Ðt&$ SÃDt1HC PSTSLS[Í$9i $ Dӹ$ H¹$~m L豹$, P蠹X\D$$p TmfDRvUWVSÃD$u Lt&tD$;$C$uv.m ljuKC$r$t_:tut&D$[^_]Ít&tK$$t= $u$t" t-u붍D$[v$D$Kv$@UWVS1Ƀ 9rtftһu?Vf tct&wQwu>t F9sL uF9r#|t([^_]Í&FfFf< uƒF [n^_]ÍYf'f&ƒ i $t$|$t(0i tt` ְ8u$t$|$ Ít&ֿN $t$|$( ø볍&'VS=i tBt>=i t7\u v[t4$D$өu[^Í&1ۃ[^Í4$1|$t>lu!~fu~u4$|$Ðt& 4$|$Ít&'UWVS,D$@D$m D$D$DD$D$$D$D$.$ID$D$9D$l$|$\)t(t&3|$l$4$趧u<>t<[uD$$d|$,$CcXCXfD$m tIm t,1[^_]Í&D$ \$@D$HD$D$D,[^_]ot&D$\$@D$HD$D$D,[^_]n'||$t$t$p1\$lÉl$x$D$TD$XD$\4tg1D(rD$D1L$HL$T$DD$(` D$,D$4|$L\$P$D$($W6L$t&\$lt$p|$tl$x|fD$4\$TfL$$D$D$4$萣ulD$($8uDt/t$TMUEut$XL$TT$Xut$\D$\u$Qdt&|$1$m Fۍt&|$1$m F뀍t&|$f1$m FTUWVS|$t$\D$hl$PD$lD$PC D$T4$D$X4D$D$\D$`D$d4D$@ D$DD$HD$Lk[D$dD$0D$DD$@D$ C,$D$D4$t$HD$X D$h1D$hD$$D$8@D$$4$D$()uYCD$D$D$$$cNjD$$$ҡuNxJ4$1p3u`,$ |[^_]fC$n D$]E|[^_]Ðt&C$0n D$8E4$3tD$C$m D$E뇐UWVSӁD$($t$He$1҉L$D$D$(t$D$$.>D$lD$$@D$\|$T#ƋD$dxD$3D$,D$4tvt$,D$3i T$NT$D$<;Z$L$ L$k+D$) $L$yD$t$$t$vL$D$$4$L$Hh)D$D$t$)l$ $ t$|$v"m uC<$<:tJf댍t&D$3D$,D$4D$$1|$3Z$KfD$sD$$4$D$芡y)ЃD$D$ 4$T$8_gD$8D$ $D$9t W9:D$ o)D$ vl$kL$D$D$m  $$$T$D$($D$L$D$D$m  $JfL$D$\$L$$yD$<$ݚT$|$3JZL$D$$t|$4|$4ED$$D$$D$1tD$$t~ tT$JZL$D$,T$L$D$D$($1 $e3 Ĭ[^_]ËFHD$$&D$$mvT$؍L$p D$xgT$|9[|$$:l$tDfD$t$R9$/$|$,$Bv  tu닌$Ƌ+q9 $Aq0& l$,t$_$D$01u2D$,Ĝ[^ _]Ð1D$0D$,t&$t$R9$[$ދ$RT$$t&\$D$$4$hL$$)t$)l$(|$ $D$蕖T$|$$vUm uEzCD$D$$<$莚)D$D$ <$kTt&Gb$W)t&L$|9L$tbL$pV$;$?F$$$$T$D$h$D$$D$ D$,$At$Z,$œT$$nfIdB$D$(T$$)2f$$T$$\$|$$$\$$+Yt^94$X@Qv$)ЉD$$$\&D$ $@$뇐t&1v : t o  uԋ$Q) D$|$F$$\n D$9v$$)ЉD$$$D$ $q$ ҉t$4։|$$L$< \$8S$ |$T$L$ CD$葘T$L$ u C(%0= Dy;t$,$6lt0T$fz4tL$$l$,T$8L$`9rtP|$(u_|$,D&C9w܍&`)L$$T$ ?T$ 륉=d<$&?`D$(3$謁D$T$ D$D$$|C\$0t$4|$8<Ít&+t\$0t$4|$8<Ít&'$0\$|É$$f~4L$,6T$(4$ҹt$ōD$TD$,$sT$(f~4D$XT$(4$蚹t$ǍD$\D$<$t$TL$\T$(D$`<D$l1D4rT$dT$,D$hD$4$D$# D$8D$4D$D$lD$D$dD$ D$\D$D$T$_t$ht D$T$_|t T$\$O|\$|$$$ČÐt&s1D$TD$Xf~4t$T11D$\D$`1tD$LD$ CD$D$@$D$hz:D$LD$ D$D$@$D$/z1҅‰UWVS\e$L1|$ D$BD$@T$D$DD$HD$<${T$?1B8BD$j t1ۅd<$wl$zD$@lD$DpD$Ht$Le3\[^_]Ð4$h9t~l44$]uًL$,$tōD$@t$$u뻍vt9~?l$t ލL$؉,$Pۍ 1ۡl$9t}\$LD$ \$|$$|<$v\$$Jp  UWVSLD$(l$`T$,D$$ D$(P$X<11;uI&;D$8tbD$D$8D$ ~D$\$,$wu D$<À;uD$($:L[^_]ÃL1[^_]Ít&{t҃듐t&1u‰))ʍ0tD$,T$t$ $D$T$$|{T$$uD$ p D$D$ep $xp w&'UW1VSӁ\,$e$L1yD$@D$DD$HD$؃D$t19~&lfx4uxCfx49څ~"1ېt&l$e;t|D$l$twD$@lD$DpD$HtA&Sfz4t$tqvL$<$t$Le3c\[^_]Í&t1&SCfx4un$;5t2lfx4t΋Sfz4t<$|u‰<$L$L$D$C<$9D$u땍vL$<$tD$@\$$fs<$L$L$D$C<$9D$t&|$ D$l$<$pv\$LD$ \$|$$x<$r\$$p t&D$ $ryv'D$P8u @$1҉$ټ$$߬$$ t$0f$٬$ۜ$٬$$fl$PD$jU )x\$pl$|$$FD$tD$ , D$ \$$aT$pD$t$|$8tfD$t$d|$@D$l!hlD$ D$2$p D$C$T$pD$t$.\$ D$ $آfD$PD$ \$ D$,$誢D$ &D$,$耢fD$P|t&D$,$X[UWVS<|$Tt$P|$TbT$TD$@dvw 9rD$ d$ T$ T$,D$ $fD$( l$ D$$l$aT$ D$$`\$l$(D$$\$Pr|v1  3 @q u9L$$St8UT$,M!ʋL$(ы9}) 9\$Pwt$$랍l$9\$PUv\$ tc1t&,@vKT$(D$@)l$@1ҍv4*م~!t&@IVڍTqsYu̓;|$ u$a\$ T$4S4$eT$P,L$,0PT$TH L$ P1tCl$$l$(1DTtt&X Z@u;t$ uӋl$$)L$ 9D$Tu\D$($a<[^_]ø/D$<1[^_]D$,D$ D$($`1D$ @u D$$D$p $q _v'`t&'T$1tfUWVS\\$xt$tME$D$K$ w |$KZD$0 L$0 $dD$4|$p1ɸWv|$4t&ЃȀwAl$4T vуɀ wL$4|$pl$p\$@D$|$D}9މ|$<r11ҋl$4 &w,߃D  3@q 9t$@w9t$@L$T$8$$D$D$(#L$L&|$JF|$p`u 1\$,D$, É3@q #G |D9T$@ʼnt$$)T$ 9}9_ut$^8\ euً\$L$(|$L$(|$(l$(L$ L$(|$$l$L$,l$4B)ȉLD$4$JZD$4D$4\[^_]À|$KOD$8T$9$"D$KbL$8T$D$,D$$D$ D$iL$8T$ T$(l$ρT$$T$(T$,T$-L$(\$|$D$,D$$D$ D$L$(l$(|$NjD$(\$l$l$(%D$ D$(l$$%D$,D$4D$4\[^_]ÐWVSD$\$Ht'01҉1f;t9F׋Du[^_1vUWVS,D$HT$Hl$@89BsVD$H1ҋH;(t,9s2XuT$D(PD$H@,[1^_]Ã,[^_]Ðt&1뷋B\0\$$D$T$HBBtwD$|$D$l$ǐt&ot=D$H1ҋp;t"9w1ҍփxuT$HhBD$T$9T$ul$D$$WT$H:'UWVSD$08h1t011DtT$8$T$T$4x ƃ9u܉[^_]fS\$ C$WCC[Ð1Í'WVS1ۃt&r 4$Vt4uރf[^_É'\t$TƉ\$PeD$L1|$Xt t"T$Le3\$Pt$T|$X\Ð` |$8|$ D$CD$C $]UuSD$,$芏$^VVT$D$D$ D$@D$~j $ D$|$$VD$,FFCYUWV1SÃL$T$4L$D$,$J$le3uN|[^_]1D$ E| D$D$`y $y I$U$z D$u0NUWVSكLD$(|$dT$,D$`L$3\$4u 9\$,D$$D$8؃@D$ D$3D$A&T$(\$D$ t$\$$|$t$y ut#\$$1\$t$|$Ð$ Ӎ&'UWVSD$ :| D$D$`y $)z 9<$OEt$${ D$t&'UWV1S,|$@G$ŋG9sVvD$$D$ D$J T$$D$D$DG9rD5,[^_]Ít&'VS$5 \$0D$t~tyD$D$$d Ct20@9s&f$D$SB 9r$D$$$[^Ð$D$蓅$Nz 7t;D$$D$D$D$$d gBvfD$D$ | D$D$`y $9z 7v',8\$\$0t$ t$8|$$|$4l$(l$<D؋CCtu$(WPWPW P WPHNHNHN H NH$1ɋt$ l$8|$$D$0l$(D$4\$,*fkD$ | D$?D$`y $*z 6 WVS@\$PeT$<1Һ8D$TDڋST$t$(L$HL$HL$H L$ @1ɉ$D$(D$,D$$D$0D$4D$8 8t C0T$$8ۋD$u׋@<$D$D$D$uă [^_D$ O} D$D$`y $*z 2t&'S8\$ D1ҋta$G3Ct%@S$03C$%3CCuۋC $3u6u>19rtft[tf뵍U8WVSZ9}=3L$ ‹l$RL$H|$3|$$1 t;L$~9|$} d1<[^_]fjrT$Dm$L$y$D$ C~dt$NItT$ 1|$, \$(vBB 9˅y݋qΉZ2Ӆ~'T$ 1BB 9uߋT$ Dmt$ FV AD$ QD$ @s D$ l$$ )[\$ s\$(|$,$x} >&'WVS5܋t4=~fD$+9u<$+܋[^_Ð` $+@ $+$.$.$ oÍt&'S\$ $a\$ [-&'W 1T$ L$ D$T$ D$T$$.Ĩ_Ð&1T$ t$} (t3u 1ÍcuxauxtuxDאuD$$ou$} ^(u; 뙍v$1+$YtT <@ ($} 'ts@v $ t Ðt&(D$$s*$*u;($,$v `$Pv Yf8, 끍t&(D$$*뮐 tf$} <'1tT$$} TUWVS,D$D$D$D$D$D$D$$#D$$!D, \\$LË@l$XՉt$P|$TtZD1t6Cu,CD$CC\$Lt$P|$Tl$X\fST$G)ڍDT$t$$c!>"t&D@0TD$P$LP떐t&p |$|$ \$t$teHtrPLD$ T$4$D$x,P4uΉ<$&$~ D$3v\$t$|$Ít&D$$ =HkUWVS$$$;$Q$K}E;$}<4949$$9~4949;$uK$19$J R~$9u1Ĭ[^_]Ël$<$;$$)t$h+$)\$|$+$D$x$DŽ$)ރ\$l$$t$hDŽ$D$tl$D,t$l$|$pt$X$t$Tt$hD$ct$P\$P9\$xt$\$|$\9|$|\$PD$|$\DD$\9D$P$$$D$<\\$@D$Lt$dl$@]Es9MƉƉ+t$<9;D$d,9,D$Hu2D$Hl$df9}9u 9|D$Hl$d)ʼnl$H$D$H9EMl$LD$@l$Ll$T9l$D$Hl$XD$Tl$D|$p$|$$l$$T$8L$$$D$ t$|$ L$$\$,$L$@T$8$$$T$ $L$$$|$$t$$l$\$<$t$T$L$ Ĭ[^_]Ë$\$<$T$H$:D$Ls$$t$0|$4$$t$@zl$D1ҋ|$p$$l$D1|$p$$$L$DP t9t$ 3DP t9넍t&|$ ;|$4}0 L$0t$ t$4v9DB &9ut$ 9f3DB t9u19[^_]Í&3D$ :T$ L$4ߋt$09‰Ǹ8[^_]D$@7T$0t$49} 8 u9|vUWVS,l$HL$@|$D1u69r19t < uL$@؉1,[^_]Ív9s tވT$ T$ L$l$L$\$Őt&DE #HD]  ЍP9w܋\$\$L$t|9tBL$&19uL$&D$D$1T$9vQP @\$&\$ Ʌhƍ&L$L$t$ 뫋\$t&'L$v"09v ҃vDÍ&'UWVST$ō.$L$$l$. h.1E‹T$ J`D$D$ $)L[^_]Ðt&`L$.D$|$L$E|$0l$. .L$ Q0D$ L$ no longer supported.cannot simplify commit %s (because of %s)cannot simplify commit %s (invalid %s)bad tree compare for commit %sreflog of '%s' references pruned commitsInvalid symmetric difference expression %s...%soptions not supported in --stdin modecannot combine --reverse with --walk-reflogscannot combine --parents and --childrencannot combine --reverse with --graphcannot combine --walk-reflogs with --graph--ancestry-path given but there are no bottom commitsFailed to traverse parents of commit %sFailed to simplify parents of commit %s%s:%shttp.sslverifyhttp.sslcerthttp.sslkeyhttp.sslcapathhttp.sslcainfohttp.sslcertpasswordprotectedhttp.minsessionshttp.maxrequestshttp.lowspeedlimithttp.lowspeedtimehttp.noepsvhttp.proxyhttp.postbufferhttp.useragentgit/1.7.5.4Pragma: no-cachePragma:GIT_HTTP_MAX_REQUESTSGIT_SSL_NO_VERIFYGIT_SSL_CERTGIT_SSL_KEYGIT_SSL_CAPATHGIT_SSL_CAINFOGIT_HTTP_USER_AGENTGIT_HTTP_LOW_SPEED_LIMITGIT_HTTP_LOW_SPEED_TIMEGIT_CURL_FTP_NO_EPSVhttps://Certificate Password: GIT_CURL_VERBOSERange: bytes=%ld-strbuf.hlen < sb->allocUsername: objects/%.*s/%s while accessing %s ref: %%%02xobjects/info/packs pack-.pack Getting index for pack %s objects/pack/pack-%s.idx%s.tempUnable to open local file %sUnable to get pack index %s index-pack-oobjects/pack/pack-%s.pack%s.prevfd leakage in start: %dError creating curl multi handle. GIT_SSL_CERT_PASSWORD_PROTECTEDReceived DONE message for unknown request! Unknown CURL message received: %d Unable to start HTTP request for %sUnable to open local file %s for packResuming fetch of pack %s at byte %ld Couldn't create temporary file %s: %sCouldn't truncate temporary file %s: %sResuming fetch of object %s at byte %ld requested range invalid; we may already have all the data.strbuf_setlenGetting alternates list for %s %s/objects/info/http-alternatesCouldn't find request for %s in the queue%s (curl_result = %d, http_code = %ld, sha1 = %s)unable to write sha1 filename %sfd leakage in release: %dRequest for %s abortedFile %s (%s) corruptFile %s has bad hashGetting pack list for %s Getting pack %s which contains %s Unable to get pack file %s %sUnable to start requestUnable to find %s under %sgot %s %s/objects/info/alternates../Also look at %s --recoverSome loose object were found to be corrupt, but they might be just a false '404 Not Found' error message sent with incorrect HTTP status code. Suggest running 'git fsck'. git http-fetch [-c] [-t] [-a] [-v] [--recover] [-w ref] [--stdin] commit-id urlObject %s is a %s, not a blobObject %s is a %s, not a commitbad graft data: %sduplicate graft data: %sshallow %stree bogus commit object %sbad tree pointer in commit %sbad parents in commit %sparent Could not read %sObject %s not a commitnot yettree %s parent %s author %s committer %s encoding %s Warning: commit message does not conform to UTF-8. You may want to amend it after fixing the message, or set the config variable i18n.commitencoding to the encoding your project uses. bad config value for '%s' in %sbogus format in GIT_CONFIG_PARAMETERSkey does not contain a section: %skey does not contain variable name: %scould not lock config file %s: %scould not commit config file %sfailed to write new configuration file %sFailed to expand user dir in: '%s'core.autocrlf=input conflicts with core.eol=crlfInvalid mode for object creation: %sMust be one of nothing, matching, tracking or current.bad config value for '%s'%s has multiple valuestoo many matches for %syesfalseoff[%.*s ""] [%.*s] %.*s = %s\n\tGIT_CONFIG_PARAMETERSbogus config parameter: %sbad config file line %d in %s/etc/gitconfigGIT_CONFIG_NOSYSTEMHOME%s/.gitconfiginvalid key: %sinvalid key (newline): %sopening %s: %sinvalid pattern: %sinvalid config file %sCannot handle files this bigcould not lock config file %srbMissing value for '%s'core.core.filemodecore.trustctimecore.quotepathcore.symlinkscore.ignorecasecore.barecore.ignorestatcore.prefersymlinkrefscore.logallrefupdatescore.warnambiguousrefscore.abbrevcore.loosecompressionbad zlib compression level %dcore.compressioncore.packedgitwindowsizecore.bigfilethresholdcore.packedgitlimitcore.deltabasecachelimitcore.autocrlfinputcore.safecrlfwarncore.eolnativecore.notesrefcore.pagercore.editorcore.askpasscore.excludesfilecore.whitespacecore.fsyncobjectfilescore.preloadindexcore.createobjectrenamecore.sparsecheckoutuser.user.nameuser.emaili18n.i18n.commitencodingi18n.logoutputencodingbranch.branch.autosetupmergebranch.autosetuprebaseneverlocalMalformed value for %spush.push.defaultnothingmatchingupstreamtrackingcurrentMalformed value for %s: %smailmap.mailmap.fileadvice.pager.colorcolor.pagerstrbuf_setlencore.gitproxy for ERR remote error: %s.have-P-pgit+sshssh+gitI don't handle protocol '%s'GIT_PROXY_COMMAND9418cannot start proxy %sLooking up %s ... %s[%d: %s]: errno=%s done. %s %s%chost=%s%ccommand line too longGIT_SSHtortoiseplink-batchunable to forkGIT_ASKPASSSSH_ASKPASSCould not read passwordprotocol error: expected sha/ref, got '%s'No path specified. See 'man git-pull' for valid url syntaxUnable to look up %s (port %s) (%s)done. Connecting to %s (port %s) ... unable to connect a socket (%s)failed to read password from %s strbuf_setlen%lu %c%02d%02dyesterdaysecondslastmonthsyearsin the future%lu seconds ago%lu minutes ago%lu hours ago%lu days ago%lu weeks ago%lu months ago%lu year%s, %lu month%s ago%lu years ago%lu %+05d%04d-%02d-%02dPMAMiso8601rfc2822shortunknown date format %sJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberSundaysMondaysTuesdaysWednesdaysThursdaysFridaysSaturdaysIDLWCATHSTHDTYSTYDTPSTPDTMSTMDTCSTCDTEDTWATGMTUTCWETBSTCETMETMEWTMESTCESTMESZFWTFSTEETEESTWASTWADTCCTJSTEASTEADTGSTNZTNZSTNZDTIDLEnoonmidnightteanowminuteshoursweekszerotwothreefourfivesixseveneightnineten%04d-%02d-%02d %02d:%02d:%02d %+05d%.3s, %d %.3s %d %02d:%02d:%02d %+05d%.3s %.3s %d %02d:%02d:%02d %d%c%+05do w                  ;Zx0N        " & * . 2 a 6   : > B h F J N R V [ ` e j n r v {              n   `  <  ? pR P x  <  Q : ~          %s%4d.%01d%% %.*s diff.cmsg%s%s:%d: %s. invalid diff0,01,%dOption '%c' requires a value %s mode %06o %s mode change %06o => %06o%ccannot hash %s1.2.3.4%sdelta %lu %sliteral %lu @@ -XXXXXX_unable to create temp-fileunable to write temp-file => %s %s (%d%%) %s%s--- %s%s%s %s%s+++ %s%s%s ~ diff.renamelimitdiff.color.color.diff.plainmetafragnewfuncdiff.suppressblankemptydiff.suppress-blank-emptysubmodule.diff.colorcolor.diffdiff.renamescopydiff.autorefreshindexdiff.mnemonicprefixdiff.noprefixdiff.externaldiff.wordregexdiff.ignoresubmodulestextconv/%s-dirtySubproject commit %s%s unable to read %sstat(%s)readlink(%s)cannot read data blob for %sunable to read files to diffa/b/--patchunified--raw--patch-with-raw--numstat--shortstatdirstat--cumulativedirstat-by-file--check--summary--patch-with-stat--name-only--name-status--stat-name-width-B--break-rewrites=--break-rewritesinvalid argument to -B: %s-M--find-renames=--find-renamesinvalid argument to -M: %s-C--find-copies=--find-copiesinvalid argument to -C: %s--no-renames--relative--relative=--ignore-all-space--ignore-space-change--ignore-space-at-eol--patience--binary--full-index--text--find-copies-harder--follow--color--color=--no-color--color-words--color-words=--word-diff--word-diff=bad --word-diff argument: %sword-diff-regex--exit-code--quiet--ext-diff--no-ext-diff--textconv--no-textconv--ignore-submodules--ignore-submodules=--submodule--submodule=--pickaxe-all--pickaxe-regexdiff-filtersrc-prefixdst-prefix--no-prefixinter-hunk-contextCould not open '%s'%s%.*s%s...internal diff status error%s%ssimilarity index %d%%%s %s%scopy from %s %s%scopy to %s %s%srename from %s %s%srename to %s%sindex %s..%s%sdiff --git %s %s%s %s%snew file mode %06o%s %s%sdeleted file mode %06o%s %s%sold mode %06o%s %s%snew mode %06o%s + @@%s %sGIT binary patch GIT_DIFF_OPTS--unified=-u* Unmerged path %s GIT_EXTERNAL_DIFF:%06o %06o %s %c%03d%c%c%c- - %llu %llu %s%-*s | Bin %s%llu%s -> Unmerged %5llu%sdeletecreate%s rewrite Could not open /dev/null{++}[--]%s%s:%d: leftover conflict marker internal error in diff-resolve-rename-copyinternal error: asking to populate invalid file.error while reading from stdin %sBUG: diff is failing to clean up its tempfiles--name-only, --name-status, --check and -s are mutually exclusiveOption '--%s' requires a valueOption '--stat-width' requires a valueOption '--stat-name-width' requires a valueoption `color' expects "always", "auto", or "never"diff--gita/%.*sb/%.*snewfilemode%06o---/dev/null+++b/%.*sdiff--gita/%.*sb/%.*sdeletedfilemode%06o---a/%.*s+++/dev/nulldiff--gita/%.*sb/%.*s---a/%.*s+++b/%.*sfeeding unmodified %s to diffcoreerror reading from textconv command '%s'%s%sdissimilarity index %d%%%s external diff died, stopping at %s. %s%s--- %s%s%s %s%s+++ %s%s%s %s%s@@ -%sBinary files %s and %s differ Invalid regular expression: %s %d files changed, %d insertions(+), %d deletions(-) ------------only found copies from modified paths due to too many files.inexact rename detection was skipped due to too many files.you may want to set your %s variable to at least %d and retry the command.emit_line_0strbuf_setlen@@diff_words_showfn_out_diff_words_aux`jG*?[{\oops in prep_exclude.gitignoreinfo/excludecannot use %s as an exclude filecan't find the current directorystrbuf_setlenGIT_DIRGIT_OBJECT_DIRECTORY%s/objectsGIT_INDEX_FILE%s/indexGIT_GRAFT_FILEinfo/graftsGIT_NO_REPLACE_OBJECTS%s/%s%s/pack/pack-%s.keepCould not set GIT_DIR to '%s'UTF-8GIT_CONFIGGIT_WORK_TREEinternal error: work tree has already been set Current worktree: %s New worktree: %sGIT_ALTERNATE_OBJECT_DIRECTORIES   S    ; # V /usrGIT_EXEC_PATH/usr/lib/git-core/usr/bin:/bintrace: exec:trace: exec failed: %s too many args to run %s%*sgraph.cgraph->num_parents >= 3graph->revs->boundarypar_columntarget * 2 <= igraph->new_mapping[i] == -1graph->new_mapping[i - 2] < 00 <= graph->expansion_row && graph->expansion_row < num_expansion_rowsgraph->new_mapping[i - 1] > targetgraph->new_mapping[i - 3] == target}C#S||}diff_output_prefix_callbackstrbuf_setlengraph_next_linegraph_output_pre_commit_linegraph_output_commit_chargraph_output_post_merge_linegraph_output_collapsing_linegrep.cregexp returned nonsenseNot a valid grep expressionunmatched parenthesisnot a pattern expression %sIn '%s' at %d, %s, %s'%s': %sBinary file matches bug: unknown header field %dbug: malformed header exprauthor committer p->field < (sizeof(header_field)/sizeof(header_field[0]))Unexpected node type (internal error) %d--not not followed by pattern expression--not followed by non pattern expression--and not followed by pattern expressionbug: unknown binary handling modebug: a non-header pattern in grep header list.incomplete pattern expression: %sȑpHmatch_one_pattern      0123456789abcdefYou don't exist. Go away!Your sysadmin must hate you!/etc/mailname(none)invalid date format: %s <GIT_AUTHOR_DATEGIT_AUTHOR_EMAILGIT_AUTHOR_NAMEGIT_COMMITTER_NAMEGIT_COMMITTER_EMAILGIT_COMMITTER_DATEunable to read /etc/mailname: %s empty ident %s <%s> not allowedImpossibly long personal identifierYour parents must have hated you! *** Please tell me who you are. Run git config --global user.email "you@example.com" git config --global user.name "Your Name" to set your account's default identity. Omit --global to set the identity only in this repository. ll-merge.coptsAmerge.defaultmerge.%s: lacks valuedriverrecursiveconflict-marker-sizebuilt-in binary mergebuilt-in 3-way text mergeunionbuilt-in union mergecustom merge driver %s lacks command line.Cannot merge binary files: %s (%s vs. %s) ll_union_mergell_xdl_mergell_binary_mergell_ext_mergeUnable to create '%s.lock': %s. If no other git process is currently running, this probably means a git process crashed in this repository earlier. Make sure no other git process is running and remove the file manually to continue.Unable to create '%s.lock': %scannot fix permission bits on %s%s: symlink too longcannot open '%s' for copyingrefs/headsrefs/remotesrefs/tagsrefs/stashremoteBranch ( %stag: %04d-%fSubject: References: attachmentinlineSubject: [%s %0*d/%d] Subject: [%s] Message-Id: <%s> In-Reply-To: <%s> %s<%s> commit (from %s)log size %i stdoutobject namesFrom %s Mon Sep 17 00:00:00 2001 %sMIME-Version: 1.0 Content-Type: multipart/mixed; boundary="%s%s" This is a multi-part message in MIME format. --%s%s Content-Type: text/plain; charset=UTF-8; format=fixed Content-Transfer-Encoding: 8bit --%s%s Content-Type: text/x-patch; name="%s" Content-Transfer-Encoding: 8bit Content-Disposition: %s; filename="%s" strbuf_setlenSigned-off-by: .mailmap# repo-abbrev:refs/notes/%supdate notes cacheinvalid object type "%s"sha1 mismatch %s object %s has unknown type id %d  M ) J packfile %s index not opened%s SHA1 checksum mismatchpacked %s from %s is corruptPackfile index for %s SHA1 mismatch%s SHA1 does not match its indexinternal error pack-check nth-packed-objectindex CRC mismatch for object %s from %s at offset %llucannot unpack %s from %s at offset %llu no-[=<%s>][<%s>] <%s>[%s][=%s]cat <<\EOF usage: %s or: %s -%c--%s%s-NUM%*s%s switch `%c' %soption `no-%s' %soption `%s' %stakes no valueisn't availableexpects a numerical valueBUG: option '%s' %sBUG: switch '%c' %sshould not accept an argumenthelp-allhelpunknown switch `%c'%s malformed object name %sno such commit %sshould not happen, someone must be hit on the foreheadSTOP_AT_NON_OPTION and KEEP_UNKNOWN don't go togetheruses incompatible flags LASTARG_DEFAULT and OPTARGuses feature not supported for dashless optionsdid you mean `--%s` (with two dashes ?)Ambiguous option: %s (could be --%s%s or --%s%s)expects "always", "auto", or "never"  @ref:.git/.gitstrbuf_setlen F F  read errorpacket: %12s%c PACKPACK ...\%o0123456789abcdefwrite error (disk full?)write error0000The remote end hung up unexpectedlyprotocol error: impossibly long lineprotocol error: bad line length character: %.4sprotocol error: bad line length %dGIT_TRACE_PACKET0123456789abcdefpretty.tformat:?= =?%s?q?=%02X?=mediumfullerfullinvalid --pretty format: %sFrom: %s: %.*s%.*s Date: %s %sDate: %s encoding --pretty formatredgreenblueresetbad parent line in commitMerge:AuthorCommitinvalid --pretty format: '%s' references an alias which points to itselfMIME-Version: 1.0 Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit FM@M@M@M@M@FM@QEM@M@M@HGM@M@M@M@M@M@M@M@M@M@M@M@M@M@M@EM@M@FDM@M@M@M@^DM@M@CM@M@M@DUTF-8strbuf_setlen'\Too many or long arguments\f\r\vgfffffffffffffggggffffffffffffffffffffffffffffffffffffffffgffffggfffgfffffffgfffhf hfOgabtnvfr"\strbuf_setleninternal error: ce_mode is %oInvalid path '%s'unable to index file %sunable to add %s to indexadd '%s' unable to stat '%s'M %s U %s %s: needs update %s: needs merge index file open failedcannot stat the open indexunable to map index filebad signaturebad index versionbad index file sha1 signatureignoring %.4s extension index file corrupt%s: cannot drop to stage #0'%s' appears as both a file and as a directory%s: can only add regular files, symbolic links or git-directoriescannot create an empty blob in the object databaseWill not add file alias '%s' ('%s' already exists in index)index file smaller than expectedUnknown index entry format %08xindex uses %.4s extension, which we do not understand⛲CK)wZSrefs/%sCannot walk reflogs for %sNo current branch%s@{Reflog: %s (%s) Reflog message: %sDuplicated ref, and SHA1s don't match: %s%s does not point to a valid object!'%s' exists; cannot create '%s'cannot delete '%s' from packed refsthere are still refs under '%s'unable to resolve reference %s: %sunable to create directory for %sRef %s is at %s but expected %sThere are still logs under '%s'Trying to write ref %s with nonexistant object %sTrying to write non-commit object %s to branch %srefname %s is a symbolic ref, renaming it is not supportedunable to save current sha1 in %sunable to move logfile logs/%s to logs/refs/.tmp-renamed-log: %sunable to move logfile logs/refs/.tmp-renamed-log to logs/%s: %sunable to write current sha1 into %sunable to lock %s for rollbackunable to restore logfile %s from %s: %sunable to restore logfile %s from logs/refs/.tmp-renamed-log: %sno symlink - falling back to symbolic ref Unable to fix permissions on %sLog %s unexpectedly ended on %s.invalid rule in ref_rev_parse_rules: %sDuplicated ref: %s peeled packed-refstoo long a refname '%s'bad ref for %srefs/replace/Can't verify ref %sUnable to append to %s: %s%s %s %s Unable to append to %sCouldn't write %sCouldn't set %sreflog for %s is a symlinkrefname %s not foundunable to lock %slogs/refs/.tmp-renamed-logunable to delete old %sDirectory not empty: %sunable to delete existing %sDirectory not empty: logs/%sunable to lock %s for updateref: %s refname too long: %s%s.lockUnable to open %s for writingUnable to write to %sUnable to create %sUnable to read log '%s'Log %s is empty.Log %s is corrupt.Log %s has gap after %s.Cannot lock the ref '%s'.Cannot update the ref '%s'.refs/%.*srefs/heads/%.*srefs/tags/%.*srefs/remotes/%.*srefs/remotes/%.*s/HEAD# pack-refs with:RENAMED-REFKey '%s' of pattern had no '*'Value '%s' of pattern has no '*'Config remote shorthand cannot begin with '/': %smore than one receivepack given, using the firstmore than one uploadpack given, using the firstfind_tracking: need either src or dstsrc refspec %s does not match any.src refspec %s matches more than one.%s cannot be resolved to branch.unable to push to unqualified destination: %s The destination refspec neither matches an existing ref on the remote nor begins with refs/, and we are unable to guess a prefix based on the source ref.dst refspec %s matches more than one.dst ref %s receives from more than one src.Didn't think it matches any more* Ignoring funny ref '%s' locallyYour branch is ahead of '%s' by %d commit%s. Your branch is behind '%s' by %d commit%s, and can be fast-forwarded. Your branch and '%s' have diverged, and have %d and %d different commit(s) each, respectively. .remote.mergeurl..insteadof.pushinsteadofremote..mirror.skipdefaultupdate.skipfetchall.url.pushurl.push.fetch.receivepack.uploadpack.tagopt--no-tags.vcsInvalid refspec '%s'originURL:Push:Pull:branches/%.*s:refs/heads/%sHEAD::refs/heads/masterremotes/%s%s tracks both %s and %s(delete)Couldn't find remote ref %srefs/tags/*strbuf_setlen%o%ccannot unmerge '%s'Index records invalid resolve-undo informationfatal: waitpid is confused (%s)%s died of signal %dcannot run %s: %swaitpid for %s failed: %scannot create pipe for %s: %strace: run_command:exec '%s': cd to '%s' failed|&;<>()$`\"' *?[#~=%-c%s "$@"cannot exec '%s'cannot fork() for %s: %sBUG: shell command is emptycannot create pipe: %scannot create thread: %spthread_join failedhooks/%sGIT_INDEX_FILE=%sToo long path: %.*s%s/configPlease upgrade Gitfailed to stat '%s%s%s''%s' is outside repositoryfailed to stat '%s'Error opening '%s'Error reading %sgitdir: Invalid gitfile format: %sNo path in gitfile: %sNot a git repository: %s'$%s' too bigNot a git repository: '%s'Could not chdir to '%s'Could not get directory '%s'Could not come back to cwdGIT_CEILING_DIRECTORIESCannot come back to cwdCannot change to '%s/..'umaskgroupworldeverybodycore.repositoryformatversioncore.sharedrepositorycore.worktreeExpected git repo version <= %d, found %dbad flag '%s' used after filenameambiguous argument '%s': unknown revision or path not in the working tree. Use '--' to separate paths from revisionsambiguous argument '%s': both revision and filename Use '--' to separate filenames from revisionsThis operation must be run in a work treecore.bare and core.worktree do not make senseUnable to read current working directoryGIT_DISCOVERY_ACROSS_FILESYSTEMNot a git repository (or any of the parent directories): %sNot a git repository (or any parent up to mount parent %s) Stopping at filesystem boundary (GIT_DISCOVERY_ACROSS_FILESYSTEM not set).Problem with core.sharedRepository filemode value (0%.3o). The owner of files must always have read and write permissions.BUG: assertion failed in binary searchcannot happen -- lo and hi are identicalofs %u lov %x, hiv %x, kyv %x assertion failure lo %u mi %u hi %u %sGIT_DEBUG_LOOKUPsha1-lookup.clov < hivlo %u hi %u rg %u mi %u sha1_entry_pos%s/pack/pack-1234567890123456789012345678901234567890.%sinsanely long object directory %spack_report: getpagesize() = %10llu pack_report: core.packedGitWindowSize = %10llu pack_report: core.packedGitLimit = %10llu pack_report: pack_used_ctr = %10u pack_report: pack_mmap_calls = %10u pack_report: pack_open_windows = %10u / %10u pack_report: pack_mapped = %10llu / %10llu index file %s is version %u and is not supported by this binary (try upgrading GIT to a newer version)wrong index v1 file size in %swrong index v2 file size in %spackfile %s not a regular filecannot determine file descriptor flagsfile %s is far too short to be a packfilepackfile %s is version %u and not supported (try upgrading GIT to a newer version)packfile %s claims to have %u objects while index indicates %u objectsend of packfile %s is unavailablepackfile %s signature is unavailablepackfile %s does not match index%s: ignoring alternate object stores, nesting too deep.%s: ignoring relative alternate object store %sobject directory %s does not exist; check .git/objects/info/alternates.could not close alternates filepack '%s' still has open windows to itpackfile %s cannot be accessedoffset beyond end of packfile (truncated pack?)packfile %s cannot be mapped: %sunable to open object pack directory: %s: %sgarbage at end of loose object '%s'delta data unpack-initial failed%02x%02x%02x... lo %u hi %u nr %u failed to validate delta base reference at offset %llu from %sfailed to read delta base object %s at offset %llu from %sfailed to unpack compressed delta at offset %llu from %sunknown object type %i at offset %llu in %sfailed to read object %s at offset %llu from %spack %s contains unknown object type %dpack %s contains bad delta base reference of type %sreplacement %s not found for %sloose object %s (stored in %s) is corruptpacked object %s (stored in %s) is corruptunable to write sha1 filename %s: %s unable to set permission to '%s'insufficient permission for adding an object to repository database %s unable to create temporary sha1 filename %s: %s unable to deflate new object %s (%d)deflateEnd on object %s failed (%d)confused by unstable object source data for %s%s: failed to insert into database%s %luOut of memory? mmap failedindex file %s is too smallnon-monotonic index %spackfile %s index unavailablecannot get RLIMIT_NOFILEpackfile %s size changedcannot set FD_CLOEXECfile %s is not a GIT packfile%s/objects %s/packbad object headercorrupt loose object '%s'GIT_USE_LOOKUPlo %u hi %u rg %u mi %u I am totally screwedbad packed object CRC for %sfailed to apply deltaunable to find %sunable to unpack %s headerunable to parse %s headerfailed to read object %sobject file write error (%s)unable to write sha1 fileerror when closing sha1 filefailed utime() on %s: %scannot read sha1_file for %scorrupt commitcorrupt tagshort read %sopen("%s"): %sreadlink("%s"): %s%s: unsupported file type%s is not a valid object%s is not a valid '%s' object0123456789abcdef0123456789abcdefInvalid search pattern: %s%.2s%.2s/short SHA1 %.*s is ambiguous.checkout: moving from @{upstream}@{u}ignoring dangling symref %s.refname '%.*s' is ambiguous.Invalid object name '%s'.BUG: startup_info struct is not initialized.relative path syntax can't be used outside working tree.No upstream branch found for '%s'Log for '%.*s' only goes back to %s.Log for '%.*s' only has %d entries.%.*s: expected %s type, but the object dereferences to %s typePath '%s' is in the index, but not at stage %d. Did you mean ':%d:%s'?Path '%s' is in the index, but not '%s'. Did you mean ':%d:%s' aka ':%d:./%s'?Path '%s' exists on disk, but not in the index.Path '%s' does not exist (neither on disk nor in the index).Path '%s' exists on disk, but not in '%s'.Path '%s' exists, but not '%s'. Did you mean '%s:%s' aka '%s:./%s'?Path '%s' does not exist in '%s'strbuf_setlenshallowbad shallow line: %sinvalid commitBUG: signal out of range: %dyou want to use way too much memory`pos' is too far after the end of the buffer`pos + len' is too far after the end of the bufferBUG: your vsnprintf is broken (returned %d)BUG: your vsnprintf is broken (insatiable)strbuf_setlen%s:%p %h: %m %srev-list^%srevision walk setup failed%s/.git/objects//.gitmodulesuntrackedon-demandbad %s argument: %s.path.fetchrecursesubmodules.ignorefetch.recursesubmodules(submodule deleted)(not checked out)(new submodule)(commits not present)(revision walker failed) (rewind)Submodule %s %s..%s: --recurse-submodules-default--submodule-prefix%s%s/Fetching submodule %s%s --porcelain-unogit status --porcelain failednot checked outcommits not presentnot fast-forwardmultiple merges foundbad --ignore-submodules argument: %sInvalid parameter "%s" for config option "submodule.%s.ignore"Submodule %s contains untracked content Submodule %s contains modified content Could not run git status --porcelainFailed to merge submodule %s (%s)commits don't follow merge-basemerge following commits not foundFound a possible merge resolution for the submodule: If this is correct simply add it to the index for example by using: git update-index --cacheinfo 160000 %s "%s" which will accept this suggestion. strbuf_setlen %m %smissing object referenced by '%.*s'Object %s is a %s, not a tagtype Unknown type %stag tagger Object %s not a tag-----BEGIN PGP SIGNATURE----------BEGIN PGP MESSAGE-----What does '%s' for %s mean? GIT_TRACE(null)GIT_TRACE_SETUPsetup: git_dir: %s setup: worktree: %s setup: cwd: %s setup: prefix: %s Could not open '%s' for tracing: %s Defaulting to tracing on stderr... If you want to trace into a file, then please set %s to an absolute pathname (starting with /). Unable to get current working directoryCould not trace into fd given by GIT_TRACE environment variablecorrupt tree sha %sunable to read root tree (%s)unable to read source tree (%s)unable to read destination tree (%s)unable to set up diff options to follow renamesstrbuf_setlenObject %s is a %s, not a treeObject %s not a treeCommit %s in submodule path %s not foundInvalid commit %s in submodule path %scorrupt tree fileunable to read tree %sstrbuf_setlen&=&warning: error: usage: xfuncnameautocommandcachetextconvfortranhtml^[ ]*(<[Hh][1-6][ ].*>.*)$javaobjcpascalperlphppython^[ ]*((class|def)[ ].*)$rubybibtexcppcsharpdiff=true!diff!^([C*]|[ ]*!) !^[ ]*MODULE[ ]+PROCEDURE[ ] ^[ ]*((END[ ]+)?(PROGRAM|MODULE|BLOCK[ ]+DATA|([^'" ]+[ ]+)*(SUBROUTINE|FUNCTION))[ ]+[A-Z].*)$[a-zA-Z][a-zA-Z0-9_]*|\.([Ee][Qq]|[Nn][Ee]|[Gg][TtEe]|[Ll][TtEe]|[Tt][Rr][Uu][Ee]|[Ff][Aa][Ll][Ss][Ee]|[Aa][Nn][Dd]|[Oo][Rr]|[Nn]?[Ee][Qq][Vv]|[Nn][Oo][Tt])\.|[-+]?[0-9.]+([AaIiDdEeFfLlTtXx][Ss]?[-+]?[0-9.]*)?(_[a-zA-Z0-9][a-zA-Z0-9_]*)?|//|\*\*|::|[/<>=]=|[^[:space:]]|[-][-]+[^<>= ]+|[^[:space:]]|[-][-]+!^[ ]*(catch|do|for|if|instanceof|new|return|switch|throw|while) ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>>?=?|&&|\|\||[^[:space:]]|[-][-]+!^[ ]*(do|for|if|else|return|switch|while) ^[ ]*([-+][ ]*\([ ]*[A-Za-z_][A-Za-z_0-9* ]*\)[ ]*[A-Za-z_].*)$ ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$ ^(@(implementation|interface|protocol)[ ].*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>=?|&&|\|\||::|->|[^[:space:]]|[-][-]+^(((class[ ]+)?(procedure|function)|constructor|destructor|interface|implementation|initialization|finalization)[ ]*.*)$ ^(.*=[ ]*(class|record).*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|<>|<=|>=|:=|\.\.|[^[:space:]]|[-][-]+^[ ]*package .*; ^[ ]*sub .* \{ ^[A-Z]+ \{ ^=head[0-9] [[:alpha:]_'][[:alnum:]_']*|0[xb]?[0-9a-fA-F_]*|[0-9a-fA-F_]+(\.[0-9a-fA-F_]+)?([eE][-+]?[0-9_]+)?|=>|-[rwxoRWXOezsfdlpSugkbctTBMAC>]|~~|::|&&=|\|\|=|//=|\*\*=|&&|\|\||//|\+\+|--|\*\*|\.\.\.?|[-+*/%.^&<>=!|]=|=~|!~|<<|<>|<=>|>>|[^[:space:]]|[-][-]+^[ ]*(((public|protected|private|static)[ ]+)*function.*)$ ^[ ]*(class.*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|[-+*/<>%&^|=!.]=|--|\+\+|<<=?|>>=?|===|&&|\|\||::|->|[^[:space:]]|[-][-]+[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[jJlL]?|0[xX]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|//=?|<<=?|>>=?|\*\*=?|[^[:space:]]|[-][-]+^[ ]*((class|module|def)[ ].*)$(@|@@|\$)?[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|\?(\\C-)?(\\M-)?.|//=?|[-+*/<>%&^|=!]=|<<=?|>>=?|===|\.{1,3}|::|[!=]~|[^[:space:]]|[-][-]+(@[a-zA-Z]{1,}[ ]*\{{0,1}[ ]*[^ "@',\#}{~%]*).*$[={}"]|[^={}" ]+|[^[:space:]]|[-][-]+^(\\((sub)*section|chapter|part)\*{0,1}\{.*)$\\[a-zA-Z@]+|\\.|[a-zA-Z0-9-]+|[^[:space:]]|[-][-]+!^[ ]*[A-Za-z_][A-Za-z_0-9]*:.*$ ^([A-Za-z_][A-Za-z_0-9]*([ ]+[A-Za-z_][A-Za-z_0-9]*([ ]*::[ ]*[^[:space:]]+)?){1,}[ ]*\([^;]*)$ ^((struct|class|enum)[^;]*)$!^[ ]*(do|while|for|if|else|instanceof|new|return|switch|case|throw|catch|using) ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[<>@._[:alnum:]]+[ ]*\(.*\))[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[@._[:alnum:]]+)[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|unsafe|sealed|abstract|partial)[ ]+)*(class|enum|interface|struct)[ ]+.*)$ ^[ ]*(namespace[ ]+.*)$utf-8utf8W]oKXpp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY`24RSrs   "'(229;  * . ` c j o *0/000 #gis strbuf_setlenfetch (unknown)Can't lock ref %sCannot obtain needed %s %s while processing commit %s. walk %s fetch from %sUnable to determine requirements of type %s for %sCould not interpret response from server '%s' as something to pullunable to %s %s: %sOut of memory, strdup failedOut of memory, realloc failedOut of memory, calloc failedOut of memory? fdopen failed/tmpTMPDIRXXXXXXunlinkrmdirOut of memory, malloc failed (tried to allocate %lu bytes)Data too large to fit into virtual memory space.Unable to create temporary file '%s'abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789GIT_FLUSHwrite failure on '%s'fsync error on '%s'%s: write error (%s) , tabwidth=tabwidth %.*s out of rangetrailing whitespacenew blank line at EOFspace before tab in indentindent with spacestrailing-spacespace-before-tabindent-with-non-tabcr-at-eolblank-at-eolblank-at-eoftab-in-indentcannot enforce both tab-in-indent and indent-with-non-tabb @b b c  c @c $c malformed diff output: %s @@Could not stat %sCould not open %sunable to read blob object %smerge.conflictstyle'%s' is not a booleandiff3Last expression must not be negated: %sInvalid regexp to look for hunk header: %sunknown style '%s' given for '%s'strbuf_setlenwrong versionno messageinflateInit: %s (%s)inflateEnd: %sneeds dictionarydata stream errorstream consistency errorunknown errorinflate: out of memoryinflate: %s (%s)? ` p x  ? ? X Could not switch to '%s'Too long path name: '%s/%s'Invalid symlink '%s'symbolic link too long: %sCould not change back to '%s'PWDCould not get current working directoryCannot determine the current working directorypushnonfastforwardstatushintscommitbeforemergeresolveconflictimplicitidentitydetachedhead'%s' is not possible because you have unmerged files. Please, fix them up in the work tree, and then use 'git add/rm ' as appropriate to mark resolution and make a commit, or use 'git commit -a'.'%s' is not possible because you have unmerged files.f  f  f  g   g  1g  %10s: %8u (%llu kB) [attr]%s not allowed: %s:%d core.attributesfile/etc/gitattributesGIT_ATTR_NOSYSTEM[builtin].gitattributesinfo/attributes[attr]binary -diff -text%.*s is not a valid attribute name: %s:%d BUG: non-INDEX attr direction in a bare repo(builtin)false(builtin)true(builtin)unknown strbuf_setleninvalid base85 alphabet %cinvalid base85 sequence %.5s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!#$%&()*+-;<=>?@^_`{|}~%c%d %d %o %.*s%ccache-tree: internal error%s: unmerged (%s) %s: not added yet You have both %s and %s fatal - unsorted cache subtreecache-tree.c: '%.*s' in '%s' not foundinvalid object %06o %s for '%.*s'38;5;%d48;5;%dTERMdumbcolor.uinormalblackyellowmagentacyanwhitebolddimulblinkbad color value '%.*s' for variable '%s'qk xk   ~k  k k k k k k k  %.*s%s%s %s%06oSubproject commit %s object '%s' is not a blob!diff --cc diff --combined ,readlink(%s): %sread error '%s'early EOF '%s'%sindex ..%s%s %snew file mode %06o--- %sdeleted file mode ..%06o+++ -%lu,%lu +%lu,%lu %s%s %s%s::::::::::::::::::::::::::::::::strbuf_setlen P X   X strbuf_setlenidentIdfilter.smudgecleanexternal filter %s failedexternal filter %s failed %dId: $ Id:read from external filter %s failedcannot fork to run external filter %scannot feed the input to external filter %sCRLF will be replaced by LF in %s. The file will have its original line endings in your working directory.CRLF would be replaced by LF in %s.LF will be replaced by CRLF in %s. The file will have its original line endings in your working directory.LF would be replaced by CRLF in %scopy-fd: read returned %scopy-fd: write returned 0copy-fd: write returned %s%s: close error: %sinternal error in merge #1internal error in merge #2internal error in merge #3internal error in merge #4invalid log-grep regex: %sdiffcore-pickaxe.cdata[sz] == '\0'invalid pickaxe regex: %scontainsinternal error: dst already matched.Performing inexact rename detectiondiff-delta.cpacked_entry - (struct index_entry *)mem == entriesѴYiVsg?Df7P*~ {'ZYA n\uT*NN'CMcqH$(~Qڿ80B i6:I_DV<1y UHg=[72waN.ʂ=SGܖ 6k.o; 㐵 mdIP)-_^˵i9/q`ˬymx%!tsC G#cu0׭PycͯE5#egwz3#zo;9 kbѷi>eM? ] {SRЦ-w:ᆑ4}@4m3+]ހ.(uw,܌A!]OJqj&'ȒE R)TZ,m"2TkKةҊs^>*pWGLXY40J}oC9L|Ja%FW$}=ds@`[qFl/:_!j5FH9<`[`=x6(T!fZlG03%Htl߇"Vwra .$b6xޣoӭ~.|܅p ~KP8(zN]{ Lq[(t ?0Q"iQ܃hڬfWfVĻ媍E\P/9YC7?k^f+IvB~'2LO%AA!?CVYRX| e%1_Dž =DdUx-O#[X+j hRd8ޓ 4nomţ2rxud,64JbEvݝE& )p@Hz N#v;'R;*&bU;|b5,]\zcreate_delta_index ~3VԆ(G]>J}y Q/|pENOXHn&B wq_3!uULbׁJڡ4[(VreMA3υ0lY;DT:ՒزkfCF==895GGo>t>ry@ChcJP7p;I}ap 0-N:f76$ %)[k8sK c5"n\6t %w+UaD}lxI,XR&zz+ps}P %c[7t:n }"]]\n}N,5+8U3zrǔ,!RloaU/9uG+"h&ܗ>(@`a;)S7$IF^ffnm0cNH>JE4$bc)MC3ėɷeƄkDˤ: pXPlUC=J-fG kTKVYk[(h~Q6e/VyX'&%p_!VX [x*w1L<<'2dvAK{a5*cB[/Vm-ikP I.Xxj4UWg)f^ h'$ev)Y鮜'/z"Zq `u S#"]N^rC _m$ZL{lL/-AS"|1 *ŤTi,w?WARާn_*8 !F9gPP1]cOd`Dn6]HAw?LA3_W=)LvmgD Ejd;notes.c!tws->nextnote_path_len <= 40 + 19fanout < 20notesubtreeprefix_len * 2 >= npath_len < 40 + 19tree && parent!*pnotes ref %s is invalidnotes.displayrefrefs/notes/commitsGIT_NOTES_REF!t->initialized!display_notes_treesGIT_NOTES_DISPLAY_REF Notes: Notes (%s): tws->path[0] == '\0' && tws->path[1] == '\0'memchr(path + 3 * n, '/', path_len - (3 * n)) == ((void *)0)Could not read %s for notes-indexFailed to load %s %s into notes tree from %s((uintptr_t) (entry) & 3) == 0i == n && parent_stack[i] == tree((void *) ((uintptr_t) (parent->a[index]) & ~3)) == tree((uintptr_t) (*p) & 3) == 2 || ((uintptr_t) (*p) & 3) == 3Failed to read notes tree referenced by %s (%s)strbuf_setleninit_notesload_subtreenote_tree_insertnote_tree_removenote_tree_consolidateinit_display_notesadd_noteremove_noteget_notefor_each_notefor_each_note_helperconstruct_path_with_fanoutwrite_notes_treewrite_each_notetree_write_stack_init_subtreewrite_each_note_helperprune_notesutf-8format_display_notesinternal error: pack revindex fubarbad offset for revindexGIT_PAGERLESSGIT_PAGER_IN_USELESS=FRSXunexpected delta opcode 0delta replay has gone wild, %u.%2.2u GiB, %u.%2.2u MiB, %u.%2.2u KiB, %u bytes | %u.%2.2u MiB/s | %u KiB/s %s: %3u%% (%u/%u)%s%s%s: %u%s%s%s... , %s. donebad replace ref name: %sduplicate replace ref: %sreplace depth too high for object %s \ No newline at end of file 0123456789;0()=%*CL*M*N*U5,Y\,c,0,T,,L-F-m----8.71L($2`(D2t(2($3(3(3)40)dJ\)TK)K)L)4M)N8*TNX*O*O*S +S +TP+Tp+4U+U+V ,W0,TXx,[,\,i$-th-u-v-tw-yP.Dz.z.{.4|.t|/}L/4}l/Ā//D/d/440D`00000ԋ01P14112$2H2l2t22D2t83ԙ\3433ԣ04D4d|4$4D454L55554 6L6D646\77D7T8Զ<8td8|8$848T<9Dl99d99D:t :L:|:$:D:t::l;D;;D<t4<t<<D< =L=l==> >L>$t>>t>>4(?h??T@0@H@$d@@@4@A40AXApATAAT BLBdBB$BBCC$CD$DDD4dDd|DDE TE hE EEdE(FDDF`F$tFTFFFF4G$GDGThGGGH0Hd!tH4'H'H)HT) I)LI$*I*IT+J+`J,tJD,J,J,J$-JD-J-8K.K0K2L2(LT5TL6L$7L8L9PMtMD?Mt?0N@\NANANBN4DODXO4GOGOIO$J(PKhPDMPPPtQ(Q4RPQDZQ\Q^4R_HRD_\R`R`RdaRfSh0S4iXSiS$jSTjSmSm$ToXTpT$qTrDUlU4UUUVĄ(VXVdVtVĊW44W`WxWW$W XĔ8XXTXd0YPYdYYdYZ,ZD@ZtTZhZZZ4D[[[8\\\\ ]48]x]]T^X^^^t_$_4P___`\`|`d````D aT at@aDpaa$aDa b b4bDdbbb4btbDcHc$lccdddHd$tdtdDdDededHee$ h?HI04JXJR$SSTU4U`VXtYY(TZ`Z[[[4\d\8\XD]]]D^^ _L`dT`|`bbcH$d`ee4f@g|ghTiTjjjdkXlll$mdmm(DnTnDooptpHp`$qdstvT$wxwDxx{(|XDTt8č$8TđTPddXlԚTD8DPthTġ$8D|TT(4XTD4,d4ĵ0d`$(\8xD4TT$T$,Ld4|d $,\DTtDp44t$D<|(P4dDtt84`D@\xt$@TXpDd 4\$xtt4X|D4Httl$T0DT4t 4 @ t T D0T d!!$0&`4'd''T()0)`d*+++d,8-23T4t56d6(6H6h6d8<d= d>>$@@@BlBBCtCGt4H$IJ,Kh4LDNdN N$TPPPpPQU,ULVtTWWW$XTX YdTZ4\$]$_(T`T$uu${ {H4|\|}~ <tD40đ$8t`DD<|Ğ$$4H4TD44 T4dԮD ıLxԴ$@$4D0`D($\4Ll44$h( $T | 4 $  T dT t T  4 $D $|  T t T4 X    8 d  $ t 4Ptt$4D<T4D<ThT$@ \TDT$4t$T$h%%$%4%t%%$& D&4&H$'t) $+Ld+`4,,t..,t/l/T4D5t5,6hT6:E Fx$GTMMTO(dPPzR|  00 ,D eAA AH  AAC $t iC HHF{ D (P vAC E j AA /C k 3C IF`( NC`FMH A $,!CpFHN T!JC FFj A $x!hC JJc F $<"C@FPC D <4#AA AAC@ CA AAA #CC LHgD(#)AA AC@W A AAH  A AAH (p$XAA C P AA<%AC CACP AA AAG (,(C KFIS H E C  L)%AC]C8@\)WAC ACE0EAA AA|)AC HHm<)AC CCCP AA AAB p*wC@HHx E D*PAF AC  A AAB W A AAF @H+AAA AAC? AA AAF .`AC r AA @/ AA AAF AA AAH @h AA AAF l'TAE J AG (' CFSV F 8'vAA AAC0jAA AA<'AA AAEp AA AAB 48(tQAC AE0 A AAD Tp(cAA ACE` AA AAH W AA AAA ,(C@FJ] H X H a$(DCPFIFLX )AF FAC3 AA AAH  AA AAE D|)C@QMH H ? E w E [<) C@MQH B  I k E * * ) ,* C0JKn B (P*| C0HO E $|*AA  AD (*FNN[} F ,* FMIIK D $+lC KF\ H s,(+AC O AD X AG X+4`AC d AG |+p'AC aA(+JCKJFs G (+5AC T AG OA0+AF  AF O AH 4(,uAC AC  C AAH (`,C@HFHH\ C P,`AF ACE(r AA AAB MAA AA0,_AC AC0SA AA$-CPPOn H <-p+PAC ` AC `-+PC HSq(-+C0HHHV E (-0-rC@HHHH C -.*AC `A,-.C0HHIb B S E $(.D/C@JN F @P./AA AAF AA AAE @.3LAF AC p A AAB CF AA(.3oAA C g AA(/3vC LHS F q G 0/L4-C i<H/d4AA AAC`  AA AAD $/9C HHU H i(/<:_AA C W AA(/p:@CKKP, C p0<AA CAF AA AAC  AA AAE  AA AAH (|0UCpIFH  E T0tWAA AAFD AA AAF L AA AAH 1,r%AE ZD 1 AA AAG h2$v$AA AACPh AA AAE O AA AAE OAA AAT3wAA AAC@ AA AAH V AA AAF (l3 yKAA C C AAl3DyqAA AAF CA AAH h CA AAB P CA AAB 4T{TAC0~ AA T,4{AA AACP AA AAB  AA AAE T4X}eAA AAC`5 CA AAA C FA AAA (4pC0LHWv D <5UAC AAEpX AA AAA @H51AA CAH  AA AAF @5~AA AAH  AA AAA T5L`AA AAC0a AA AAD  AA AAA <(6TAA FAE0 CA AAA h6.CgT6 AA C ^  AAC T  AAA C  DAA K  CAA 6dXF L A (6_AC C q  CAD @ 7܈OAA AAF AA AAA 8d7~AA C M  AAD T  AAB 07,AA AC zA AAT7AA AAC@b CA AAA  CA AAA ,8PAC YAL8PC0 C h8č|8Ѝ8̍CL A M(8̍C Vk D j A 808,CL A M,9,C0HHHT A T,@9̎C0LHGc G kp9\CL A M9\CL A M(9\EAC h CA SA9 9,:AA E0R  AAE 4:؏ZAC0TA,X:\AA C M  CAB :D(C d:\3C L A ,:AA C0  AAG (: lAF C _ AA ;dcAC XF(<;pAKI AB VATh;AA AAC  AA AAF a AA AAC ;d'C ;X)C e(;pAAE _ DG OA(<=AC Eo CA$D<MCFI_ G P(l<ВC0FPFFl G 8<tAA ACE@AA AA<8,<DAA C   AAF h=wAA AACP? AA AAF R AA AAB JAA AA=(< AA AACP^ CA AAA  CA AAA p AA AAA H CA AAA , >AC | FB w FA <>`0P>\AA AC0A AA >fAC0`A >DyAC0f AE 4>AA C0  FAF C CAh?XeAA AAC@ AA AAE f AA AAA \AA AA(p?\C@FFFJ F T?AA AAE`v AA AAE Z CA AAA (?CPHFFHL E  @,C h08@]AE \ AE S AD [A0l@@C FFx A R F f A (@C FJS J  A (@}C FD^ E @ A ,@dC FHS D Q A ((AĬiAC@u AF gA$TAC0HFl C ^|A`C IFMAMC0e H \(A]FI_\A A @A$AA ACE/ AA AAB T,BAC ACC@] AA AAD e AA AAA @BȲ AA AAFA AA AAA B$uC LH] BRAC LACAAC0{A80CAA AAC@CA AATlCPAA AACP( AA AAE j AA AAA @CؿVAA AC } A AAB FA AAD2PD AA AAC0~ CA AAE ZCA AA,pDPAC } AF FA DPHA EADF DUC IJ~DDPAA CE  C AAE CH AA@DEAA ACCR AA AAA E+C gEWC OD(E\yAA C q AAE FuC0HFcT F AA ACC0S CA AAF k HA AAB ,xFjAA E T  AAA @FAA AAF AA AAE F`XC p A (GC`KHHHs G 4GCP} A 0PGC@QMNn C {(GHgC`PHHR E GC s B p H GeAC _AGH"AC XA,HXAA E0^  AAA <DHAA FAH | AA AAG (H-C0IFFD F H5AC jFH C HHC HH\ A ,IC HHLV C r F 8I$LIF Nd A tI+C gI (IeAC K CF GAI1AC kA$IyC@MFHZ<JhAA AAC0k CA AAH (TJ(FAC E z AA,JLC HHP[ B cJ BC ~PJD}AA FAC0f AA AAB AA AA(Kp&C`HHHH G <HKtEAA AACp< AA AAA TKAAA FAC AA AAA  AA AAF ,K|C HNz E o A <LlAA AACP CA AAA <PLAC AAE@ AA AAC L"AC XAL9AC oA@LAA AAK AA AAB MxRCLHLn8MC [@PMAA AAF" AA AAH <MhBAC CAC@ AA AAA Mx.Ae B AMAA FAC@a CA AAE ^ AC AAD } CA AAE jCA AA,|NCPWKgE G (NPCpHULB B N$MC0I$N\C@XHH[ A (O4AC Eh AADOXO lO(OHAA H y CA8OjAC AAC(\AA AA<O4%AA AAC@ AA AAG ((P$>AC S AH \A(TP8kC@HLHPO B ,P|AA CP  AAA P,&AC `AP<2 PhlC HJVQ+C g8 QAA AAC@AA AA(\Q`gC T[ F ] C 8QAA AAC`AD AA(QHFNg D @QAA AAF5 AA AAE <4RAC AAEP FA AAC 0tR]AC g AD O AH SA0RC FHY F h H a G ,R@kC0FKFk C w A T S7AA AAC@ CA AAC b AF AAE dSh4C [ B S<SuAA AAH0+ AA AAA XS AA AAC AA AAA   AA AAE  T|>AC xA@T-C $TTCPLHH A |Tp<C (TAC y CH JAT(AC `C(T lAC t CE fAUdX$UC@HTHM D DU88XUDAF Ap  AAA Z CAU (U CPFVP B 8UAF C L  CAF K  AAK V?AC wC0V DV XV+AF bA0|V CPFJP B U$VC0LHB G aVD%AC ]C$VT\AK I AA WkAC0cC$DWC@P@ E (lW`CPHJlg H @WAA AAF  AA AAF (W@&C@Ho E TXDAA AAC0 CA AAE  CA AAE (`XYF^Rg C <X0AA AAC0 CA AAG $XAA l AA <X_AA AAF  AA AAA D4Y!AA AC  A AAJ CC AA,|Y!Ar E I A F A OY!$Y!`AC e AF Y$";AE [ AA T Z@"AC ACEPS AA AAD  AA AAH dZ#AC0 CA Z$C T(Z $tC0HHHHr C Z`$7C sZ$7C sZ$,C h[$,C h$,[$C0MXFX B (T[%C@HMHt D [,&JAH[`&2([&8CpFIFL G ['NC FKFs\K'C T\'AA AACP\ CA AAG  CA AAE Pl\`)AF AAE@U CA AAG YAA AAT\)@AA CAEP AA AAA S AA AAA <]+AA AAH AA AAE TX]D0)AA AAFt AA AAF  AA AAE ]3B]X3AA AACp AA AAG  AA AAF  AA AAB z AA AAB <H^6AC AAC` CA AAF T^D8AF AAC@B CA AAD B CA AAH @^8 AC AAC AA AAG $_8FcAC0K AH (H_FFWINS G Tt_xGuAA AAC@ AA AAD s AA AAA <_H:AF AAC@ AA AAA  `I6CHH^X,`I`AA AAC AA AAC n AA AAA h`OAA AAC | CA AAG C AA AAA [ AA AAA ,`XPwAD | AF mA$aN'C T8aPAA AAE@y CA AAH  CA AAH <aQpAC CAEP\CA AA<aU~AA AAC@ AA AAL 4b\VAA AC  A AAH <HbVAA AAC0w AA AAA b4W Pb0WAC AAC@ CA AAA KFC AAbW"<cWC0HHHHs J c E  DcY^C HLc F (hcTYC@HLHJI F c(ZcAC0]A,ctZAA C0  AAE Tc[AA AAC@ AA AAE s AA AAA 0@d|\AA AC qA AA4td\AA AC Y A AAF 4d@]AA AC z A AAE ,d^cAC C@T  AAA (e^CFky C P@e`AC AAC@ AA AAG [CA AA eha^C0HLe D $eaC IZ H (ecSAC E0G AA fPch4 fcC HHHHB C Y G XfDd~C LHWO(|fdFILIR D (fdfCOHKJa H (ffCGHHHp F $ggCHGHHi8(ggvAA ACC$fCA AA$dg8hC0HHQa4ghRAA AAJA AA8ghAA AAC0uCA AA(hiC HL_ B ^ ,hiVAC0PAPhi0dhHj\C@LH_ E d L (htk^CpHHHLS F @hpAA AAC AA AAA i$ylCKHE A 8,ipy AA AAC@AA AA@hiDzAA AAC% AA AAH <i|AA AAFO AA AAC iPC XjX# jtcAC ]A 4dXAA C {  CAL C CA<[AA AACP' CA AAD D܁lAC AC T A AAA CF AA($C@NKB B <PJAA AAC@ AA AAH @"AA AAF  AA AAB HԂAA C@i  CAF [  HAD o  HAH  /C0kT8AA AACPv AA AAG _ AA AAE (LAA C@ AA(C0HLTb C <dAA AAC0 AA AAB <(NAA AACP AA AAE h$HC HGu<TsAA AACP AA AAE 8ȄAA AAC@AA AA(CGIFF A 04AC nAPrAC hl0-AA ACEPj CA AAE a AA AAC d AA AAA ؅$C ` AA F T AA CACp CA AAA ] CA AAE h4 (|@ -AC S AH GAD $ACP^AȆT 4ACPnA(t CPHO A  :C0v@,@ AA CAF!t AA AAA ,p -AA H   AAC ,AC F   AAB Ї,iCFJk A (xdC@HHPS B  aC HHM8@ AA CW  CAH C  FAA |`CPHHy A <AA AAC0g AA AAF <&C L A UL&C L A U \KAC P AC (DC RK H  A TpAA AAF AA AAB F CA AAA (ȉF IPa C < AA AACP AA AAA (4XZC@HPB C ,`C QMw H [\CJdC Ohl|AA AAC@ AA AAH C CA AAG C FA AAD l,AA AAC` AA AAA N AA ACA C CA AAA ("?AC Cu AA ȋ"<Au B C "IAE AA<"AA AAC@ AA AAA ,P#uAD H @  CAG (,$AC C0  AAH <$AA AAEPC AA AAA (@%FNQINP%AA AAEE AA AAF cAA AAPl &AA AAE@N AA AAE TAA AA$&FNY C T'AA AACy AA AAD x FA AAA @ (9C Of,`,(xAA C [  FAA |(((C@(Ў<)5AA Gi AAP)C W(X)C@LHHPx A T@)(AA AAH AA AAH v AA AAF $+pC0JKK E G@ ,AA AAH AA AAG (/F!NIw B l007AA AAC` AA AAC a AA AAC  AA AAE $3C [ A (Ȑt4pAC L AG PC44`AA C J  AAG C CA,4=AE sC0L5:AA AC pA AA( 55FIIQ D , 6fAA C K  AAA ܑ`6l6*AC dA<|6AA AACP AA AAF PP9+AC AAF AA AAH ^AA AA(:Ff6 F @ВL<AA AAF ` AA AAB $=C HKe E <>DP>;AA AC L A AAC  A AAA ?CRT?AA AAC0f AA AAG O CA AAA (d?CPHFKF B @4@AA CAFA% AA AAC x4BxC@FFK]@BzAF AAF> AA AAG 0C^AA CC RA AADCAA AC w A AAH CA AA(\@DmC HHi D U C $DTAm B I O ITDAA AAC`G CC AAB  AA AAF <4GAC AACP AA AAD THH;AA ACC`g EA AAH  IA AAA @|IrAA AACS CA AAH (NCPFIn| D (|OCFFXDQ D (<0PCPFFFD| C <hPAA AAC` AA AAE (R6AA E j CA(ԗRFN]PM B (LTC`FJFaD B (,UC@HLGH B <X$WRAA AAC` AA AAH 4DXC OHFo A k E k@ИX^AA AAF" AA AAF ^OCPF A ,0L^jAA C@]  AAA $`^C`HRFk B d_6Co_5C@i A _JAC@ AA (_CpHL\H A ( `dFNIu H (8bC@HHHH} H (dcC`PHM C (eCPHHHH\ A PgUAC MC guC HHc A ,gAC C O  AAH (4HhC Pi D ] C `9i'C @thAA ACEZ AA AAG @4jAA AAF AA AAB (pC@HHS B 4(TqAA AC@ A AAA l`rAA AAC` CA AAB l CA AAA 7 CA AAA М\voC0HFLQ@v-AA AAF! AA AAF @8xAA AAH!@ AA AAH @|yAC AAF AA AAE <8AA AACp AA AAF $\C HL{ F $(ԃyC0HHK J P@P,AA AAF AA AAH $؋{AF m AA 0cF W A (؞CpHTS A (hAA C ` AA40\AA AFr A AAB <hAA CCCP AA AAA (C0HX\ A ԟhsC TD A đ]AC WAd'C ,0KAC s AH IA(` eC HLq H T$PC0LMw E ؒ-Ƞ7AE mC.AC hA$CAC }A,(TAA C q  AAH X6At(tؓaAA C Y AA(AAA C u AA ̡@ZCRMw(|%C@JUHT G 3C0o43C0o,LЕiAA C H  AAA <|FAA AAC@8CA AA, qAA C J  AAG (p]C@HHHN C #C _80AA AAC@AA AAdl`AA AAC0 CA AAD C CC AAE fCA AA8ԣAA AAC@AA AA8C0HHFE B _ A h H hLAF AAC0i FA AAB W FA AAH P AA CAA hAA AAC@V AA AAG o CA AAC S AA AAA <$xAA AAC0 AA AAH ,dC PSi A i G (XAA H I CAPԥȜAC CFC@S CA AAG OCA AA((CPHHHUN B T#C _l$C0`(:C0vP7AC0oC8pPAC AAC0BAA AA(AA C  AA0$AA AC A AA(XT^AA C V AA$C HHQ{ A ,C hPħdAA ACC@D CA AAE CCC AA$#C \ 0<AEPxAT\'C @h8AA AAH  AA AAA 4iAA AC0 C AAD <AA AAC AA AAA $8AC0~A(HC0HHX` E (t8UAC A AJ CA(l{C0HHOz D (̩CPHHf C ,TC0HHSn D s@($AF AAK  AA AAH l @AA AAF [ AA AAA @ĪAA AAF AA AAB T4AA AAC CA AAC ] CA AAE (`CpMPr F TPAA ACEa CA AAF W CA AAA VAE NAl#AA ACHK CA AAA V AA AAF  AA AAA x6C0o̼#C _NC0@ E EȬ7C0p<<AF AAC@k AA AAE  ,4mAA C E  AAD dȽC HGc C (D CpHT\ E 4(C@JMO G _ A s E 8wAA AAE0gCA AA($w(<CPFJGa E $h4rC0PLV C y4AF C0r  AAB  AAȮDLC i D Xt{C0H_P#C _ #C _$8?F Ndx H (`C0FIL@ B U'C <|VAA ACCp AA AAC  @TAA AAF AA AAD <LAA AAC CA AAG $CPL`v A (3C o(̰PQCPFJo J ,CGZ| H W,(CGZ| H W X$C HGc C |"$C0HFIQ E @TAA AAC? AA AAF 4AF E0  AAA y CA(4qAC U CD MC`4t|AA AE b A AAC R'C (<CFMFKk F ,~AA C0R  CAE ,0EAC c AH C AE P`*AA CCEP AA AAE }AA AA5C q(̳ C@HHIGy D 0hAA AC \C AA<, AA AAC` AA AAA @lAAA AAC AA AAH T.AA AACPO AA AAF  AA AAE <nAC ACCP AA AAB HO$\@C HFHo H ,xAA C0K  AAF 8C0t̵@8C0th`C HHLcC0LHK,$AA F   AAA Th#C _l#C _+C +C  C ԶC C AA F  C \4C W8LAC ACC@AA AA($uC@FFWf D $xC MHFD F ܷAC OE,AA C0b  CAE ,,PAC E @  AAE (\ C$XJ A (MAA C C CAWC j C f<ԸdAA AACP AA AAE ((UAA C0K CA@\TC HIP`AA ACCP CA AAF UCA AAH4C p$̹pC FFPQ H 7C s< 6AA ACCP&CA AA0L>AA AC tA AA@ AA AAF{ AA AAG ĺAC QA$[C0FNC  4LAC S AH XC HG_ G |`-AC [ AA l)AC cA|HC HHp$C HHKc G $4C HHKX B $0\C0HHHOq$X\C0HHHOq8<KAA CAC0{CA AAPPjAA CAC0~ CA AAC SCA AAl#C S A ,+C [ A (HF NKlC A ,t(C0HHHY L _hAA AACPf AA AAG G FA AAH NFA AA#C _(#C _0@ C@HHHHa L c(tF NKlN A $<JC HGX F Y$ȾdJC HGX F Y%$ ACo AD ,+C S A HLC c B dC0j C B C D pC0j C }< AA AAC`) AA AAD <t AA AAC@ AA AAF (AC0Z CG ,LpAA C0  AAC |EC HGn07C s XLA@ G C<AA AAC`N AA AAG <<AA AAC`  CA AAF 8XcAA CCE0QAA AA8AA AAC@wCA AAC'C TXAA AAC0e CA AAF y CA AAA T< AA AAC0 AA AAF c DC AAD <X$AA AAC`  AA AAA (HAA CP CA \AC@VA($=FKR]q G (PC@MHMM F |9C r<\AA AAC@0 AA AAA 8`AA AAC0TAA AA0C0^JS B o E DoAC _ AD h6AC pA C LKB D <pAA AACxAA AA 25PL2AC AAC@Y AA AAB [AA AA$T2C@HP}$|@3bC0HLHB3AC}@3AF AAF  AA AAH ,6AA F  FAB @0L8zAF FC | C AAG \C AAt8-C 88C0t,8AA C   AAF ,L9AA C   AAF ,9AA C x  CAG ,0L:AA C x  CAG ,`:AA C x  CAG L;iCX ;LAD C C8;AC AAC0tAA AAP$P4AA AAC0x AA AAA GAD AAllMAA AAC0 AA AAA  AA AAH E AA AAA <`AA AAH@D AA AAD 2<0AA AACP AA AAF pZAA VA@AA AAF4 AA AAF dXC0FIF|<AA AAC0m CA AAF <LAA HA@`,AA AAF AA AAB (xC@FR A (</AC E a CA8@AA AAC@CA AA8?C HGl<XAAC CAC` AA ACF @" AA AFF CA AAC h-6AA AAEP AA AAB p AA AAD M AA AAG HT.AAC0{A<h.0AC AAFR AA AAF $t4C@HHHH^$4fC0HTV C $$6C PHHz C @ 7uC HPL` A w A q G  F L} Н o̍   H( ooo~  &6FVfvƞ֞&6FVfvƟ֟&6FVfvƠ֠&6FVfvơ֡&6FVfvƢ֢&6FVfvƣ֣&6FVfvƤ֤&6FVfvƥ֥&6FVfvƦ֦&6FVfvƧ֧&6FVfvƨ֨)  4 :  :  : E       :       : 44             E 40  y 9i     /bad-path/T ./ ' ' ./ ' ' ' ' (  , B- B- K]Bn`K֒I D D J M G N LO O N N Q N $Q Q N 8R $S N S HT N T T N U 8V O  O V $O @W dW )O X 8X ,O dX X 0O X $S 4O tY $S  ;O EO xEa EU%i 4} .shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss TThh !$4oP>  F̍ No~~z[o0j (( s HH |Н0w   )( Q  R , ,4(` `'d        "T @ @, 4,