ELF44m4 (444  TTTtYtY^  ` _  hhhDDPtd<  ((QtdRtd^  /lib/ld-linux.so.2GNUGNU7[a6MCEQ`p |(CEK8vqXfUa!cg!tnL8 '/^R  >>{F .tVZ`lrC^X<iXB9kF6T*I_Dt`ez1nn67KK[N-`zfuG)4S z@kWO5 X'y@7g P ( ` P Fd @< \    libz.so.1__gmon_start___Jv_RegisterClassesdeflatedeflateBoundinflateinflateInit_crc32inflateEnddeflateEnddeflateInit_libpthread.so.0pthread_selfwaitpidforkpthread_createpthread_joinconnectpthread_setspecificpthread_key_createraiselseek64pthread_getspecific__errno_locationfcntlpthread_exitsigactionfsynclibcurl-gnutls.so.4curl_easy_duphandlecurl_global_cleanupcurl_global_initcurl_multi_performcurl_slist_free_allcurl_easy_setoptcurl_multi_add_handlecurl_multi_info_readcurl_easy_cleanupcurl_easy_initcurl_multi_remove_handlecurl_multi_initcurl_easy_getinfocurl_multi_cleanupcurl_slist_appendlibexpat.so.1XML_SetUserDataXML_ErrorStringXML_SetElementHandler_finiXML_SetCharacterDataHandlerXML_ParserCreateXML_ParserFreeXML_GetErrorCodeXML_Parselibc.so.6_IO_stdin_usedstrcasestrsocket__xpg_basenamefflushstrcpy__rawmemchrgmtime_r__printf_chkfnmatch_IO_putcgai_strerrorstrncmpstrrchrregexecpipe__strdup__open64_2ftruncate64getpwuidmmap64closedirftellsignalstrncpyregfree__stack_chk_failunlinkselectmkdirreallocstdingetpidstrspnchmod__assert_faillocaltime_rgmtimestrtolisattyfeofstrchrnulsymlinkfgetcfgetsgetpwnamcallocstrlenungetcsetitimersigemptysetgetaddrinfomemsetstrstrstrcspnrmdirfseekchdirmemcmpgetpagesizegetnameinfodup2unsetenv__fxstat64__fprintf_chkputenvstdoutfputcfputsregerrormemcpyfclose__vsnprintf_chkstrtoulmallocgetpassstrcatstrcasecmp__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfregcompstderrmunmapgethostbyname__snprintf_chkgetuidreadlinkexecvpstrncasecmpfilenogethostnamegetcwdfwritefreadiconv_closegettimeofdayrenamemkstemp64__memcpy_chklocaltimestrchrutime__vfprintf_chkmktimeiconvfdopenreaddir64qsorticonv_open__strcpy_chkfreeaddrinfogetrlimit64__sprintf_chkmemmovefopen64accessmemmem__strcat_chkstrcmp__libc_start_mainferrorsnprintf__cxa_atexit_edata__bss_start_endZLIB_1.2.0CURL_GNUTLS_3GLIBC_2.1GLIBC_2.2GLIBC_2.0GLIBC_2.1.1GLIBC_2.2.3GLIBC_2.4GLIBC_2.7GLIBC_2.3GLIBC_2.3.4GLIBC_2.1.3       ' L #= @ii ii ii  qi si  ii ii ii *ii ii ti 4si @ii  ` d            $  (  ,  0  4 8 < @ D H L P T X \ ` d h l p t x  | ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J$ K( L, M0 N4 O8 P< Q@ RD SH TL UP VT WX X\ Y` Zd [h \l ]p ^t _x `| a b c d e f g h i j k l m n o p q r s t u v w x y  z { | } ~           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                          US[ìPt~&eX[5 % % h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`D$ ! D$&D$t $} D tT$D$$# D$$W% D$ , D$&D$t $} =UWVS1,*L$}-uD}8u8}t L$]%Bu|$$3 1L$,[^_]ÃD$ @ D$&D$t $} WVS D$@D$-7ZT$-D$/7 $jD$u)PT$P=D$BDD$7 $iD$u"P T$P tU =D$CDMD$n7 $iu9D$P T$P t" =D$MDB CMCt MtBuIt$4$z1҃Bu!\$ t/u"C\$4$tz‹L$9u [^_ÃD$ mA D$&D$t $} -D$ E D$&D$t $} D$ Y D$&D$t $} D$ \ D$&D$t $} D$ ̓ D$&D$t $} D$  D$&D$t $} jD$  D$&D$t $} CD$ L D$&D$t $} D$ D$&D$t $} D$ D$&D$t $} D$ 0 D$&D$t $} D$ D$&D$t $} UWVS] e$1$D$$ } %D$@D$H;?- | U\$D)T$L|$LL$H] ׹@D$$\HË@9|8@09 CCD$C $KC $C K$pe DŽ$t DŽ$DŽ$DŽ$tDŽ$DŽ$DŽ$DŽ$rD$t ÉD$$$n$yD$Q $UD$ $Ep$$PÉL$D$'$$D$D$$xD$PD$,N$^D$D$N$D$D$D$'$'|$D$'$D$D$+N$ D$'D$$D$D$.$D$ D$4'$t$D$''$$\k1$n$$D$$ [D$tD$xD$|:$D$p$$D$pD$MD$;D$p<$$D$ $D$$D$T$p$D$(OD$(t<$$6D$ D$D$ ` $EDŽ$$$u0 $Z D$U $$ D$<$$md<$ed4$y$D$8 $h u؋8ۇu$e3D$8$e[^_]ÃKD$ <$83D$% <$  ;u 8D$DD$L$g4a w C蝋C   芋D$0C x xt=  PT$$tשD$D$$ á` D$ ]) $U|$HN T$LD$ $D$D$DT$D$ <  : D$DD$8\$L.  L$L ɉL$LL$LA@L$(P=AT$(B=J>@b<߃AB=D$(H $DT$$`T$$D$M $DT$$(D$^ $T$$T$$D$i $T$$T$$D$v $T$$T$$u[T$(B> uCL$(A>D$ D$$?T$(Xa$ ȲD$ $T$$@T$$T$(B>L$( A>D$(H>T$(B>B>D$(ǀ\D$ D$${T$(\$P D$ $T$$|T$$u6T$(B>L$( I? I=@A>ǁ\?D$ $T$$*T$$D$ $T$$ T$$uu$ ܰD$ $T$$TT$$tND$ $T$$8T$$xD$ $T$$T$$u$D$(H=D$(H=T$$D$ $AT$$ ƃ-u({rq{N{m{D$ $T$$T$$u{vu {HD$ $T$$RT$$D$ $T$$@AD$ $@T$$%D$ $T$$T$$D$(HA0L$(A@IAȂA@$ (D$(H=@$T$(D]D$(H@ D$$m 胕D$(HA3D$(D$(HA T$(BA BAD$( H@ HA@D$$ D$(H@ HA@D$$D$&>Ѓ  ‰G$|$$D$vuɃ[^_]É'\$\$,t$t$ T$$ t$D$C$m1\$t$ UWVS^pD$0\$4D$D$ D$\$4$ u7$@$ډ1T$0$‹D$ 1҉ЋT$\e3l[^_]Ðt&D$4D$$ T$H$D$,D$4$D$(T$,$$D$,  ‹D$,D$(Ѓ $ ‹D$(D$,T$$D$D$ T$$lD$(\$D$D$ $T1t&ft&T$ t$B$腐$D$ 1҅^$D$ ^ T$ .t$B$t&D$(D$D$D$,$‰NjD$ <$ D$, $蚷  D‰\$t$$ S\$$CSD$C $D$ M~)C[Ë$ D$脕D$(D$D$,$VUWVS$$$D$dD$8e$1ɉT$,L$HD$hD$lD$<tQT$<$n D$8:-.z-$zL$8T*t D$deD$| $D$DD$@D$LD$0v     <   D$TT$,L$0D$D$@t& tD$,D T$,tD $e3 D$| Ĭ[^_]Í&;$D$|D$DT$,\$TL$0D$<\$T$\L$TD$$D T$,L$0D$<\$T$\L$TD$$ W&D$TT$,L$0D$D$T$(t>   t$0BD$dD$, T$0D$/ \$D$\D$TT$TD$ $uT$H1tT$HL$,A %`x}p$ -$T$,D$8$T$4v  tF  uXL$,a|$$ t&F= $,t6<C=tЅűFt$$D$뷍&|$$g l$  |$ pL$, $萤C<C=@gC=b1tq ɉL$$tg\$ t&T$$*]$t;v;D$$袘L$ (ƉD$|$ $F[uȋT$$R҉T$$u1[^_]Ít&<|$$t]<t<< C= ‰C=tf4$4$#w<#C?t ~? ‰\$4$xpD$; t$$WC<DŽ$ ҉$ ׍t$$"su닔$ \$ tNDŽ$ J:$L$(芢D$ #D$$L$($ u\$ u&0x$-؉;0u+DŽ$${?MD$($D$ D$$tlP$$躡Pt;C v @$ډ$t@Tk tK9sG$uD$$zC=4@4$K=@|$$~qxt$4$T$$l$ $`F<$t9L$ 9J w@HttI@uD$$l$$F<tC?0y$T$ S>0tNt$ tFD$ t  ։1@tS> 1uuӋ$L$ L$(MT$ 1DŽ$ t'|$ $ t$$Bpu닄$ T$( Ru$ \$,T$$ft_1f1uQ$t:?uRu@uхt(D$$뿍& މ1@uԋD$ \$,t@D$ t&1u  ։1@uދD$ f"@uD$(t&"@u$ $:tL$( $.t$T$ C u9D$$vuC?t$ <.E u<9D$$t-T$@u 0ۅtF$1ۅth1ۅÍ؋t$ \$|$$l$(,fF$uO<Őt&Bfnt&'L|$D|$Pl$Hl$T\$@u tˋu$E$D$\$}D$,(vC$tPuBu8t3t?G=@uՍD$,$ډy[t&FvD$덍t&vD$0{\$读(v'VSÃP0$<tt$$&C=@u&Pt;F wى$xJt$$|tt [^Ív4$m$D D$=yt&1[^Ã4$C$ D$yvUWVSÃ<@><u&H~Hu⋓LtLtS>Ћ{C>t$[lstN1 f ;ss=t@t(uރ  у \$$g;srfC<$D$pC><$ot<[^_]Ð1-P$tKՉL$(D$,\$$ut$H@ ‰D$$XH;XL$ ry1ɅtlD$ 1҉l$f0>u 9tl$ uDk t$t&ÍI '+ DÍ&A? ; ; DÍD$$D$D$ $i8uË $T$ D$ D$$1UWV1S<e$,1$X$P$\$T)D$D5D$$:9wԍt$,8T$t&T$ǃD$$+t$,$D$t t$,e3u<[^_]Ív SD$ \$(\$$D$D$,\$${ ؃[Í'VSÃ$ ta D$D$D$ttFt$D$ T$D$l 4$D$4$D$'$D$芑$[^$F  $D  뙍&SÃ$Ώt[Í&,D$0\$T$4t$ r |$$l$(Njl$88  8  8 8 8 8 8 8 8  8  8)  84 8D 8l$8\$T$4t$ D$0|$$l$(,魓t&T$$~ 1\$t$ |$$l$(,ÐT$8D$4D$0 \$t$ |$$l$(,T$8D$4D$0 ֍T$8D$4D$0 뾍T$$\~t rT$8D$4D$0 농T$$| CfT$$|=GЉ t&T$$| fT$$|| fT$$d| fT$$} fT$8D$4D$0 vT$8D$4D$0 v\$\$,t$t$(t$$S C)9GD$ St$T$$ps \$t$ÍvT$1t t fT$ B ÍD$ D$ UWVS,\$@D$$$ǓtCXt $  D$_ $*D$p   $$x  tD$ D$$ӌ y $ t            $ [tD$ D$$/ $ .tD$ D$$ = ,  %$ ݉t  9C .$D$6 $2pD$@4$wD$:4$eD$/4$399t&))D$$}t$£ D$$T$D$臌T$D$$iơ $G5 $w}|$l$ƣ $<>4$hơ $豊5  ZI-  D$D$@$D$D$Q$ɉD$D$3$豉D$D$k$虉 tD$D$)'$u D$D$*'$T tD$D$g'$7 tD$D$q'$ tD$D$Q'$D$D$-$ ~75 ~-D$D$$辈 D$$D$襈D$D$4$荈D$D$$u$Q tD$D$)$M S D$"'$D‰D$*  tD$D$'$ ,[^_]Ðt&D$D$@$ԇD$D$Q$輇v$ (D$1 C $u fD$D$U$\;v  )G$Kzt$|$ţ $D=,$eơ $脇 5  = j= ] $: / :$Zy ` D$"D$$ D$ W$+ VS u 9&s$tD$ $$^$膆uΡ  $; $ $  $  t$  t.$辇D$$D$誄$  [^ÍS(\$0D$ $vC1-([ÍD$D$ $/([É'$ wT$ T$$@P tJRuÐ&VS5 t& 9}F t<$Su܋[uu([^É$菈- v$t؋Fut 9 ~S\$ -CCD$D$ $ CtCt S SPC tST$ [[ÍvWVS t$ t$$ۇuP xt@9u`9tZ[$u` D$+D$$ D$ 딍t&` T$ D$ D$$蛀jf T$$ӂ{ $G& [^_É'S(\$ \$$Ӆtꡠ9D$} ([Ð&UWV1S$$DŽ$C5ƍ&Ct t@$RuȋCt$Մ9|뱐 1|$$鍼$󫍔$$󫍄$D$$D$D$$DŽ$DŽ$PT$ D$$$Rvļ[^_]Ðt&VS$ t$t&; |( t$$[9D$}̐t&ۍu)[$ۍvKuG CCCCCC T$D$''$zD$D$'$`D$D$4'$FD$D$,N$,D$D$+N$D$D$'$D$D$.$D$D$P$$[^$(r @@$u-t&ʋJ$uB$á $  UWVSÃLD$,D$0D$4tǍD$8GD$D$P$3D$D$,$~t$D$'$~rD$D$+Nl$,$~D$D$D$p ,$D$` T$4D$T$$\$D$'Ƌ$Y~t$D$''$C~<$u;\$$@ &aG4$s,$OL[^_]Ðt&<$1D$8tȃ%T$<tutu &tu u$ +$cp \fD$ D$f ,$v4$TD$D$+Nŋ$8}~Pl$l$,D$b ,$ D$4$D$~D$D$,t@D$4D$0w=D$l$,fD$D$,vD$,$D$,uD$ k D$&D$t $} P|t& tPu @$uf$ ِD$$\$\$ t$t$(|$|$,D$$[t$ D$D$ $ t\$t$|$Ðt&|$t$(t$\$ \$D$$N 'S(D$8\$$D$D$D$ D$4D$tD$D$0D$0$D$p([Ít&'1ɉt$t$$|$|$ \$\$($t\$t$|$f\$ \$1ɋt$|$fS\$$tD$ D$$ D$][UWVSLD$`|$4t$dD$(D$,D$D$0tD$4D$8D$D$8\$/ $uD$,DT$,D$($ ‹D$,T$$xT$tfT$L$D$($D D$1Y,$vD$($vn4D$8L$XD$ $tڋL$$΋D$Tl$$uL$L $ D$($KvtT$Xl$$談|$D$T$t ,$ve$L$X $m,$D$肧,$D$uD$T$O$D$T$' D$,X,$w,$ufyt&'S\$ C t$vC @t$wǃǃD$ [,uUWVSl$]$'~E $(vUE @9t&‹9u,$g$vT$ ׍D.idx@.temf@p1D$@D$@a D$Dl t$Hl$LD$PD$D$8 $Duu{1<$=l$1v<$ l,$D$ѥu5<$l4$D$蹥u$4$t1l[^_]Ív4$sl[^_]É,$u4$u4$st&WVSP|$`t$deD$L1D$ D$$D$(t$"fx1ǀt$t$ 4$pR<$4$D$o D$4$sD$<$jD$ D$ D$D$4$D$7yD$>/ 4$qC BS PT$D$'$5rD$D$+N$rD$'D$$q D$''D$$qC $t~cupt$t$.D$ b D$D$4$wt$$sD$D$''$bqT$Le3u_P[^_É<$xt$D$ D$D$ ` $n^t$$d T$q$1quvUWVS| $ e$l 1$ 4$$D$8cVÉVV Vǀ 4$t$N=hST$($D$ D$ D$D$4D$D$vD$4D$ D$ D$D$D$4$v4$mT$(t$$ oD$($mtD$$ RT$(D$D$$GveT$08Xd1T$0$8T$<$D$8,$D$D$cD$4$u&D$,$ND$T$,$dD$$N\$ D$$Z9,$r4$Rl|$081T$0$ T$<$.D$,toD$ D$D$$ mD$D$$NrD$,,$q4$k5\$D$'$mD$D$+N$m D$D$'$pmD$'D$$Rm D$''D$$1mD$,thT$,$N D$ b D$D$T$4$Mst$$]nD$''D$$l$l e3| [^_]Ít&|$,&/f名t&D$8T$,D$ D$D$ ` T$$ih‹~$:iT$($ T$D$OD$4$l$|l$1rl4$iD$,vZfI名t&D$(D$/T$$$,kT$$t"D$(T$$D$$gh/T$$D$(T$$D$D$$qT$$vƃ7t&f|$07bf^g$g$ D$D$(D$MJo&'D$tJ Rǀ Ít&WVSp$$AnǃP @ǃ= ut$$8D$<$֙$aD$C$͛Ɖp[^_Ít&D$D$\$$guϋD$@ D$\$t$ |$$l$(,ÍSà  9uD9t,ы8utC$Ug$Mg[Ít&88֋8 ɍ',t$ t$4D$:\$\$0|$$4$l$(dxD34$h<$hl;k~4$l$ZkƉ4$qhf.|$$kC$ft$ C|$$\$0l$(D$4C \$,t&'S\$ C$IfD$(D$D$$$YC[Ð<\$0\$@t$4eD$,1|$8s{t$$ muC u34$g1t6D$,e3\$0t$4|$8<Ðt&ƀ ϐt&F$ag$-XF fCt$t$$gt$$¥t$be{4$t-@ |$$uD$ <$뷉4$tÐt&it&'$$$$e$1$$ktJS҉T$t?T * '- .t=t&$e3 F$$$$ļÐT$$e$VS\$,ET$$gf$Su4$e$t$D$x\$$$5E _$iM HMHMH MHMHM!HM%HM)H M-@$E1D$$8e$VSET$$efD$D$ $D$ D$C$bE<gVS$ $d4$dD$tUt$1á D$ D$D$D$$}hD$D$$tt$xb$[^D$$ L\$<á t$@։|$Dωl$HD$$D$(D$,t$c$cD$T\$\$$š D$ D$D$D$,$gD$\$,$,$a$al$(GGG Gu\$h xhD8l$4$|$_|$t$$ ;W& <4$.KC\$0Ct$ \$|$$l$(,t&$Snt&D$7 4$\hD$/$aVFL\$<\$Pt$@|$Dl$HCD$,C$GD$ơ $FD$($C$YD$H*+L$ $lLST$$NjD$($wT$$D$  D$D$T$<$D$w]L$ D$,D$<$L$D$ <$WE<t`t$P\$ CJD$4D$ D$ 4$D$w4$D$D$ CD$4D$ 4$D$AC 4$D$) D$4$D$gC@ `X|$D$'$9SCD$D$$ SD$PD$,N$SD$D$N$R|$D$'$RD$D$+N$RD$D$,$RD$L D$4'$RD$D$.$nRD$D$6$TRCD$'D$$;R4$t+4C$$e3u)[^_]ÍvCC$$RCV&WV1S uF t< t2C$ u 3vC$t)t 8u1[^_Í&D$ $p@ `X40C$$u` D$D$$P D$ T @<$Ut&P $D$D$ $CW@ `XD$D$P$mPCD$'D$$TPC,D$D$'$;PD$m D$4'$!PD$D$+N$P4$t4C$`CC$$]PC=C$,ؾvWVSà 8D$t$D$D$ttgD$s $V\$4$߉D$<&Nt&t.<"uD$D$x 4$f_u&4$D$ [^_Ð<fuD$D$ 4$6봍t&D$D$ 4$떍D$D$ 4$svUWVSe$1 |$hD$LD$PD$TtD$XD$\D$`$D$dtvP4$lPD$4At$á D$ D$D$D$$?T $ PD$/D$,L,|$,D4$@D$ht|$l],$D$/K]ET$,ƉPD$D$P$6M|$D$'$ MD$m D$4'$MD$D$+N$L4$8` D$D$$` D$ P<$1=M$e3Ĝ[^_]É|$, l$LD$ ,$ƉD$f4$t$sL4$D$XD$  D$D$Rt$$MD$ $MD$,Ɖxl$D$'$KD$PD$D$$KD$PD$,N$KD$D$N$Kl$D$'$KD$\D$D$'$lKD$D$+N$RK\$D$'$D$<D$@D$D>|$H4$D$8D$8D$HD$;D$p<4$POD$0=4$0QD$`D$ 4$D$D$dD$`OT$8$D$(ID$(t84$?H$MD$ D$D$ ` $FG<4$gNU` |$ D$< D$$F<$1aIgMt&'L\$<1t$@։|$Dωl$Hl$$D$$D$(D$,t|u',$D$製D$\$AD$ D$4'$$AC$D$BD$ $BD$''D$$@D$D$+N$@CD$'D$$@4$脻,4C$f@ƀ  [^_,$蕁|$t$D$ D$ {t&s( t.$WD$ D$D$ ` $=@ [^_C(0t4$34$tǐt& @f04$2uu`  5 R$T$j@1$yD$ D$D$ ` $<$KD$! D$D$ ` $< <$D$ Gu8~$uD$F$?Fu׉<$f4$xvCC$$>Cf` D$D$ D$5 D$$;n,$E|$t$D$ D$ +t&@ `X40C$$蝸E` D$D$$P D$ A<$ @$~D$ D$D$ ` $; @J$< @t&'UWVSÃ, S 9XtVD9uvrJD9tiʅuC$<$'UWVS| D$0T$" D$.t$(D$l$,D$$t?D$(X~4|$ 1ۉfD$1t|$$x9^֋T$19T$t$ T$9T$v.T$T$$: tL$D$v9t  uD$T$1 9T$t$  (҅ulЋT$9T$v`D$L$8>t9tV<>u19T$v:: J\$t9t4< u19L$vD$ D$$.E 1k1`0t&<\$0\$@t$4|$81t\$0t$4|$8<ÍD$,D${D$(D$ D$<$Zt|$(t0$+<$xl$q" D$8\$0t$4|$8<ËD$,t$$D$4u( ts,`D$4$x+D$Ev<$l$_" D$ %'FF_$D$uG&[t9PtPuL$DT$T$$u2[u͍Gunt$u,[^_]Ív뙍D$$5YUWVStT$ tӋt$ 1ۅt$É؋\$Ív' $\$t$t$|$|$ox$t$|$ Ít$\$$|$|$ ,D$D$D$4D$D$0$q,Ðt&UWVS,\$DD$ Z $qD$ND & L P T D$D$t&tt80& 1ۃ l$u@ u;#[toD$߃ \$ƈ` {T 1@ É1ۃ-É t߃ ` vD $& D$P D$t&D$vT t'D$$O1D ,[^_]Í&D$v \$Ɔ` t& t t =Lr11D$1CfT$@ uCtC#t;u9D$+ tۍvu?ft` .`  9u\"` 1땅t D$D$1\$_t&]@ 1É1ۃ-É u .0$t ` 9=T t+T$T$1L$Ɔ` ` T$HD$$` T$T$@f&b f"\ t뀅\$fƆ` .t$Ɔ` w \$u> 4Z@ u"Ɔ` .`  "tm\u ufv1 @Jvntt  ]k` t$&& $` Ít&'\$\$ t$t$$$ t\$ t$D$$\$\$t$Ív'D$$5& Í'<@ \$,\$@t$0t$Dl$8l$H|$4t t$H\$,D$Dt$0|$4l$8<81D$$I& t@D$$N& $D$$D$ T$$} tD$,$ t$$It,D$\$,t$0l$8E|$|$4<Ðt&l$Ӑ;D$$' |$.ft$$D$6D$ t&t$l$$D$Wt&T$t$$T$D$&\$t$$m yÉD$D$$D$D$ $/ۉt$M \$t$ÍvUWVS,T$@D$.\$Dt$H$);D$@WOx*+D$@D$tt$@4$ $l1ɉt$1D$Ӄt$Kf1@ É1ۃ- 9D$tsus]t$@ t.t@t$t;D$ uϋT$@$l& T$$),[^_]D$뾍t 눍t$@$\& t$Z뱋E,1[^_]Ë\$@$$ \$3딋L$@$# L$v&'@ $$$$$$Ë$D$ D$ $t3$$$$$ļÍ$D$$ XD$\$D$$$0dD$,D$$ >! $ D$t$ $   D$\$$@l\$$& o $ t$ $t&l$$D$$$(fv $m 茲5t&t$$&  $Z댍t& $G t$ $)$ uu?&$uߍD$@D$l$$< D$l|$pD$0$& ;v $t6$\$$& D$ $A$ ‹D$,#D$$$t$  D$J1$\$$0$ D$b $D$0D$D$l$D$ D$D$$,$=  1\$8D$4D$(|$<,D$0 Džu. 9 D$(< tʃ= tq|> DD$4;|$(D$4vD$(+|$(D$D$,|$$B9w-D$4tD$,D$D$S $j\$8}O|$0&ɉ~7 u$t&]Dt t =u琀|\t9Hv OD$4\$8|$<$t@ u$D$,$$D$,TD$(9D$0v$l$0)D$D$,l$$&9D$04$D$ D$$$`\$$T$ D$(f4$$D$,!뜍v'D$$D$ D$D$D$ $Ðt&UWVS\$p$te$L1D$L$(|$0$]D$8@ n$D$,D$,D$D$D$8$^D$$D$,D$& $`L T1D$4t$LD$D$4$LD$Lt*1@ u+v@ tutEL 릍<[u|L[t/<$|$ÉD$D$$$-921뼐TM ]D$ \$) fl$H\$DD$@\$,t$0|$4l$8D$@ % D$( $D$( $hD$( $yD$( $x#D$( $`~D$( $Hur,$1 l$1$. |t6 1cD$( ,$t6 1>D$( $aD$) $1D$$) $D$6) ,$zD$e ,$budx6 1l$H\$DD$@ l$H\$DD$@,$1M{l$H\$DD$@l$$$ ^D$$' Nl$Ht$0\$D|$4D$@\$,l$8<x6 1 D$=) 1$l$$l$1$wt6 l$1$_t$0\$É|$׀>[t.D$:4$t\$t$|$fFD$]$tp밍<\$,D$D\$@t$0|$4* l$8l$HD$u-,$A ҉tA1\$,t$0|$4l$8<ÍvD$l$Ht$0\$@|$4\$,D$Dl$8<D$D$D$* $P$T$T$9Ɖx)D$D D$$L$L$P9t | .A+\$5u%t$g (ӃD$\$$ fD$$뢉\$@t$0\$,|$4l$8<\,D$D$D$D$ D$ D$$t (unk nownf ) , <ɉ\$,l$8͉t$0|$4tZ0ۃ~S) uCPupuHtֿ 8t 1ۃÍv؋t$0\$,|$4l$86;\$(ƒ|$,~~FD$4ƃ|$,D$8D$:$D$,t7oD$tD$ D$,$gT$tl$,9tD$,D$$l$h$D$,$[$$$,$L$D$_D$,$ZD$lT$p PT$lT$pDt$,$|$lG GD$$7|$8‰PO@GB D$pB<$G $GA,$[D$($Vl$4t4$FČ[^_]Ðt&|$,$e$* \$$г r M8DT$xD$t\$tD$x+ $Wá D$tCD$xC CD$$$@@ $G $GB$D$l$D$t$ L$D$Y+ $莥,$"D$47vT$ 4$DT$ D$4fD$,$, N:H===t&T$tD$x\$xD$t+ _T$t"+ :E‰D$t1DH r$D$PD$TL$L$$ $$, D$D$tD$h, D$D$D$xD$ ` $?!D$|P@D$r; D$D$ ` $<$` D$D$$R+ D$  t$(* t$(7 D$,&w $L$$D$,D$|P@ T$,D$D$<+ D$T$D$D$xD$ ` $-$UL$$o* JD$81e$j+ G$+ ;$ + D$)$$D, D$ D$tD$D$xD$D$($* D$'1|$ f\$\$ t$1t$ t${Ƌ$$\$t$É'WVS@t$P$+ X;u4$l@[^_Ít&t$8t$1 D$4\$4D$<D$D$4$., 4 0 D$D$$, D$^D$$4$z4 1u< tt< u, tL9sB4 0 4 @[^_Ðt&D$$, LR=, :D$$, $R, 뙐t&$+ Z$+ $\$$, 跿H‰|$$Xt$p yl$ wV wQ~au\jx]BxVxPik|$~|$~|$ ~ |$~|$~|$~|$~|$ ~ |$$~$|$(~(|$,|$DWO NvbSwz_t6T$H/ 19GFG F tWV\$0t$4|$8l$<@Ít&G랐t&tҋEGf%ÍCdGyll$hōD$pD$D$pt$`։|$d\$\L$D$ $D$NjD$p86<- t&t9s)Fl$L$$t V9r[^_]ÍUWVSÃyT$gD$ D$X9D$  11S 1ۅ~1 ufᐅuDT$1+l$  nR11ۅ~1 uf1뾍t&u4)Ńn [^_]ÍFF [^_]f1΍UWVSLD$4l$dT$ ‹L$8D$<; tы $T$Ћ@D$R~:Ot a:LuZ9uD/@ tED$t$8C\$4<Í&Pt$8C\$4<Í&C4$D$9D$t$8C\$4<ÍLt$@ƋA|$D׉\$<ˉl$HP@|$ 4$D$4 D$C|$*l$kdD$,D$*D$,5@  fD$(l$(\$l$* ,$D$PK$D$\$D$C$DŽ$DŽ$DŽ$tD$4$Z$1C$D$4$tK6C$X< lh$$5 D$Tht&$- $É$׉$t 58&  $< h1i8f4  p6 G6t2D$$D$\$$6D$4%=9 G6$XD$)D$F$跈G4D$ D$ D$D$F-$|$$$$ĬÍvDž ; fF.fF-.$$Pp6 <$9G8t\$$6 fD$<$G4O|$D$G$$%D$P$DŽ$DŽ$DŽ$tD$\$,$ xEG6XtW4D$$$T$$,$\$$6 eG$%6 D$e'fz4\$Ét$u"; @1\$t$Í&$D$X¸uҋFF$t$C1\$Ít&S\$ C7 XZ $D$ @D$D$@<$Rjl$XD$|$,$袒$XuF$I$臤D$(D$D$X$_F$dT$XD$($D$<&L$D|$0|$ $D$,T$(L$$D$T$L$D$H> D$ @D$D$@<$yi"$: E&|$,D$(M4|$ l$DD$L$$Bl$D$= D$t&$$$D$ $$DŽ$DŽ$DŽ$L$l$D$PD$$v$B6 Df'WVS5~#=19t$u1[^_Ð[^_Ít&VSD$$ơ~#1ېt&$9䡬$a[^ÐD$(\$\$$t$t$ uMu\$t$Ðt&$ @ DC=wى\$(\$t$$t$D$ `@ Cf$? Cƍv'D$ D$D$$]ÍvUWVSLl$`E,u&E$t$ ](-}$t Mt,$Et$UD$4D$8D$<$D$*T$ -^T$ 159l$$~oB B$9G$G4%=T$ D$<$T$ t$D$T$ XGRO$$T$L$X7L$(uT$$4$(t&|$(ֹD$$f9D$B6L$(A6XֹB$p> D$=C Xt&J0CRNƉJ0C \$\$ t$t$$CHD$CD$4 D$C@u;C5t DD҉֩t\$t$Í&DDC5҉uʼn\$t$ÍVST$ \$$B\tR`D$$T$`1u*$$t$$D$H [^Ð|t$p$\$l$|$tl$x/FD$ Ft C6'CD$Pl$ D$TD$Xt T$T$DD$LD$H1D$DD$<@D$ D$,,$# CD$,|$PD$<$D$1҅D$,T$$\,$)T$贘D$\D$<$$Vt C6D$\\$lt$p|$tl$x|ff{4uI$1; ҍT$\T$\$$‹$҉D$\uVT$t&D$$(uNC$C$rD$$> D$:t&<$×$$B6 9fL$\D$\$$L$ 0F$UWVSL$tT$T$lL$P$pD$h~ ME D$Lk D$L1ҹ; D$X` D$d; 1E!Ћ DEL$XT$\L$Xt,$T$Ћ@D$dD$,!$F T$$$ۄ$5@ L$ f$D$d$D$٬$\$٬$D$lZ‰ȉ>t&$d$D$pI1$d$(a$d$$h$D$`~UD$df$h|$L$LB4\$ L$D$: D$$$JD$lt4$O$t$$D$EuL$` T$dI $%; qKD$LD$lmEhc$$dD$pD$D$`T$$$h$T$TT$L$$D$d$$ $dU$dr8~  DŽ$4$1r$ D$h|$h1󫍄$L$P$E $%$E|$R$tL$hT$TD$pB$ 1$DŽ$ED$H$Eh$4E$E $tFD$$D$cT$LtBD$LD$3; $趾D$LD$ D$ $[M$ExD$H$@Ɖ$Exn8F@Et $ >F&t$`t$8$E\$dt$<$|EE|t&D$D$ $t&D$LD$>; $ |D$LD$ D$$F$QD$$$@$y$DŽ$ [$\$$D$@ $D$@$sD$@$$aD$P D$T$ $<$F밸멋Et$T? D$ $B6  &l$\$\Él$hՉt$`|$d3F4ft%=@{G4ft%=@   D$(FW$T$T$ D$$D$HET$ DЋE`T$LC urslD$(D$$U; ;D$(  3{&F4fW4f1fG$oL$LT$Ht$\$l$D$(D$|ċ$($4D$pD$4@$pDŽ$ DŽ$DŽ$EP$E%$D$81dv@6t$0uv1$$9$ T$@ȃt$8p$;-WCP҉T$@% L$0L$0A6q$pBvL$0fy4fx4 L$0D$ $DŽ$LDŽ$H$蕰$Lp$+$HDt&%=@+vD$y6 $; 1$p7$pDžv1ۉt&G|`9Q4F tщPƃ|$0v L$011틴$(1L$8 v u-l$8t&;D$0 J uZRt֋\$0$pL$0D$t; t,$T$Ћ$ @D$t$p$p@lrpD$PPED$PD$P2D|$PD$PD$`T$d D$X D$\~*D$P^;\$PD$XT$\} t$Xl$\$p( P;  D؉$` DE…ɉ\$x$$ 1D$hD$lD$8D$<G4VNFT$@VL$DNT$HL$L<$W2É9\$F  D$CD@09|7A$D$$ $$$ t&$ʍ&fx4D$$MCDŽ$HH$$$LST$0RT$@D$8$D$ D$D$$ $&(L$8$ $pD$$; m&o0l$0Ճ t'<$D$ҋT$@$&G4Cfkdټ$l$$$ۄ$5@  f$٬$\$٬$C D$v; D$D$ $'C T$($(T$( SÃD$@ $6(<[Ít&'D$D$D$D$C(&\$ÍBt$|$׉$8ƍ@|$\$$g"D>\$t$|$Ít&UW1VSt=y1t2A t&8pt$9։NΉ98u1[^_]f[^_]ÍT$$D$  T$L$ $T$/ $É$։$$D$ T$D$$ .tJ@*t\@%=$$$$ĜÍ&t$\$$ l/xPD$ D$\$$1uT$0t@t Epfǡ$׍D$9|$v ,t$\$T$ED$%T$hD5D<$1 Ĝ[^_]Ð$1Ĝ[^_]Ð$w땉$m<${ S(D$0\$4D$D$ 8D$D$D$; $Ex([É\$$(A |UWVStD$$1t [^Ív$D$[^Ðt$$fWVSt$ 4$t¸:uVD$/4$1t>4$)Í8D$/$t$t݉$a1[^_ÍUWVS,l$@EEEE E\$Dt0T$D fu+D$DT$DUEu ,1[^_]Í@$bU҉T$D$E~H1t&T$D<;<$cCCƒ ШCtM ;t$uD$T$D$ @D$ $T$ ,1[^_]ËT$DEUM&S\$ C$C[Ð,${A 6 |$,6 tk$A 6 $A 6 $A 6 $A xt  ,f$/ 6 t$6 k6 / \&6 $ $6 D$ A D$D$T$$6 "t&6 $$`6 D$ A D$D$T$$6 mt&$A 茫6 f 1t 6 1Ðt&6 1f 6 t +6  f 6 \$D$ t$t/$.6 \$$u:\$t$Ív$6 .$\$t$6 Ét$\$$HB )'6 Ív' 6 t k6  f,\$ \$0t$$t$4|$(|$8D$A D$ |$D$t$D$$PD$$$Dx\$ t$$|$(,k|$t$$D$A D$ D$D$$t$$\$0|$(D$4$\$ ,&,D$8\$ \$0t$$t$4|$($=|$D$A D$ D$t$D$$vD$D$$>x\$ t$$|$(,Í$0t$$\$0|$(D$8\$ D$4,& 6 t 6  f 6 t 6  fS\$ D$${A \$u g1[É\$$B [Ít&'tÐt&&B Dá&B DVSÃ$:/$tQ.$t$$D$s$D$rnCS:PSSD$[^Ít&T$sT$$T$D$ss믐S(D$0D$D$D$t8/t0\$D$ D$C D$A $vD$$n([ÍVSt$ tB>tF4$s-9ލvw;/u)4$sD$v6 [^Ð1t&D$ D$$ C D$6 Ð&6 t$ C t8u$C ٍ'VS$$ t$GD$D$D$tt8u[6 t:u\tc$\$4$D$qD$D$$ D$(4$m$[^͉뚐t&uD$ D$-C 4$uq뛍vVS\$ t0fu$*  t10fL օu[^Ít&SD$ $D$;C É$ޫ\$$* ${$HC D$蟭$[Í'S$$\$ t3JLu tDD$$AĨ[Ð\$$`C Ĩ[UWVS x,p8~19uo&9tc9uX(44$ۉ\$~.h4;Ut]|$]1|$ f݃;St>9u|$PyuO6 &@< [^_]Ðt&|$U$fSP<<@, [^_]fPDf9})D$ ; D$D$xC $rÍ&St@>u T$ $D[[Ítԃ[ VS1ۃ@@@u#u[tFt[^Ív t$Ƌ\$X$tFPt؋t$\$ ÍS\$t$ sv,\$f;6 t$ ։|$$ωl$(rsD$$hCS PSSD6 f9s$6 44$t$$D$m\$t$ |$$l$(,Í6 ,,$l$$D$md UWVSӃ,H(1G|D$$gCS PSSDN(9}wV49uع|1FTT$~D$$gCS9l$ PSSDϋN(9|t&F >F,[^_] D$6 D$f6 ÍVSt$ $Há6 6 sCCCCCC C(C,C0fCDC$$C4C$$rC8C$$aC;D |$ Zt$~09}At$x49t$u|$w@> D$x09|t$\$,D$(O,|$$1T$ |$1T$39l$ ~ ftV8/PN09}YF@ 9;D$$u;l$t9tT$_V8nN09|F M^0FD$$]CSoPSSDT$FT$NDf1D$|$f-V889؋|$.V8D$D$vD$n,D$8~-N81;9Au&;x9uD$ tE D$D$|C $C 3&|$ Et$y9~t&9D$$D$L$ x0\-5L$ ~u 9~ |D$D$\ؽT$T$Qع|~D$&T$D$.~,D$(~"V81;*Bu;vƒ;ht.9uD$ tE D$D$|C $C vtՃع\D$$[CSD$ PSSDF9D$@D$T$ TT$ $D$`R$l$$D$_F ڋL$s~+FFFF ډFV19T$VVFVyD$$ZCS PSSD8N8|P9FFF19lߍt&|D$ ; FD$xC $D$jbFD$lFFF<1[^_]ù\SMV0~2^<1 x9tFFFf9uӋFFFHN0F@D$$D$ 1D$ E D$0D$|C $C YD$ E D$/D$|C $D 5D$ E D$D$|C $C D$$D$ ,D$ tE D$D$|C $ D$ tE D$D$|C $ D$ [E D$D$|C $C D$ >E D$D$|C $\D lD$ >E D$D$|C $C HD$ E D$D$|C $C $D$ E D$1D$|C $D t&S\$$tz t3  {tC$D$  [ÐD$$ V  udt&غ  [D$ E D$D$|C $w RD$@WVS |$0D$D$D$tt$D$tgD$D$uut$<$D$á D$ D$D$D$$u $ D$D$uD$4$UD$uSt&4$V [^_ÐS(D$0D$D$D$tt=\$\$$ D$D$ D$D$D$$C$V([Ív'S(D$0D$D$D$ttCx\$tB\$$ D$D$ D$D$D$$$ V([Ít&&VS$\$0D$D$D$tKt$1D$D$Ctr $ D$t$$ D$D$ D$D$D$$T$uD$4$TD$u&4$ U$[^Ðt&$1[^Ð&UWVS,l$@T$DT$T$BurZD$&D$ $tbx D$$D$ )؉D$Btc~u븉,$묍t&T$D$Z| wz T$D$ BBD$$)؉D$utP\$tP,$ D$@ D$D,[^_]w D$ BD$D$B$,[^_]á $ D$7l$@,[^_]<\$,Ét$0։l$8͉|$4@<tIPT$T$<$T$ut<$X|9r܋T$@B3t&x)Չ|$ @l$$D$XtċT$@)B1\$,t$0|$4l$8<Ðt&{Ӎt&'UWVS˃LD$,@ T$4|$dt$4D$<t$`8\xL$,A40H T$4,H t$$D$t$4؍P9sx>ЍP9rD$<vD$,T$,@<T$8D$+D$+JD$,ى<$^D$,@<D$+)9ЉT$$W9T$$t-L@ ɉL$01ɀ|_1 l$0u19T$$t&,1@ 1ɀ<_ 9tT9!B@ <_ u6t&9B@ <_ u9sVL$hD$+؋l$8)GD$h|$ D$D$t$,$lv1L$u$L$T$\$$t$(,f4$T$L$t$$D$L$T$$L$T$$D$D$3 \$$t$(,Ð$\$Ét$U$5KtH $D$ɹS DD$ҋ\$t$Ã,T$Ptu"t$T$,Í&D$D$H $,Ív\$Le$<1$Ps$T$XD$C4$D$-u7$<e3$L$P$T$X\ËCCtw$<D$D$ ,F D$D$,$T$$D$ m)l$,9t$(D$0D$ D$$&{ wVT$0D$DL$(D$$T$61҅t(D$Dx L$Hxxljf T$$u9D$ t&ljͺ͐t&9M|$|$LD$! D$ D$D$ <$!%tDQDD$ )$D$ D$ >,$T$ ¬$D$ D$ LD$4BD$44t&'UWVS,\$@T$9vN{9s{{ u&{ t9ul$DD$D;vu9r,[^_]ÍvD$DD$=D$D$$,[^_]ÉfUWVSD$0$e$1D$0T$PL$T;D$0t"'D$0D$0ǀ@d /L$T|$ $D$X1DlrD$0t&pPuXHuT$0$ BL D$X D$0D$DHhuCP@u<D$Dt.h D$Dtt&p iuD$Dtl$TD$8D$<D$HD$@v\$DL$@tL$0D$@;D$8D$0#T=T$,)T$4S$ $L$,t%$x$x9O>C<uD$4$DŽ$D$T$ $CD$l$$z$G _D$0L$T|$ $1uqD$XD$HD$@$1uGL$0iHu uD$؉|$,$aV;|$8rt$4|$Ll$\ ǀT$8L$T,$T$T$PD$DT$Pc1\D$0T$,L$T$T$T$PaT$P$P @L$lT$ $D$D$0T$lT$PZXTT$P$$T$0¬$T$PD$0lD$0:^L$HD$X~ D$ D$L$D$ $ڋ !%tDJDD$0)ډT$$\$$D$ D$t<'<\ ffÍv'$\$Ét$|$a4w8 D$|$$Ћ\$t$|$Ít&'WVSÃut&t &u4$u MftFD>ut41&t tw8 9uՃ[^_Ít&[^_Ív'UWV1S|eD$l1$=$$Q= T=7 uD$2$7 oD۸ D؀?uL$$西$ D$$D$t$:D$2D$7 4$調$um}1BI 1;  =:T$le3ƀ8 8 |[^_]Á|\$|$$HJ 訝课$$ýD$$D$(FT$(D$ D$ T$,Pƒ&t>,D$$|$$D$ D$ Pƒ&u‹T$$T$(T$w׋ƒ@ E‹T$, $L$T$D$赼T$L$L$,T$$돍&D$$= ƀ$ J t 8'k$T$襼T$=T$D$ D$$ 踹VT$$Ɔ @D$ Z $I vD$ )t$ t$$D$D$ T$ D$4$޸T$$j1L$I qL$'+ SD$2t$,$DAl$$I \t&D$D$$  Ht&D$$ T$蹵T$t$$$J D$ T$t$膺T$ 4$T$膽D$.4$&4$$ ƀ .@D$ D$.T$$ڶT$D$D$ )щL$ $^f w` $T$赴 Vf$J  ${~$QI )ЉD$D$ D$I  $EG$hJ 诙$kI 裙vD$$D$ D$D$D$ $IÐt&\$t$$I ŵ$I 践$I 詵T$ t$\$T$ $\$t$É'VS$I kt $I Tt $J =$I /$I !T$ t$\$T$ $m[^Í&ÐUWVSl$T$$L$$$@D$,E=tT$`tl[^_]Í$}T$ۃ $t$|$T$$4$|$Tt$\&ۉD$XT$|$4t$HBD$B<$D$|L$(ft$<$脆D$P%=@=tċL$LD$HL$ $~E=tu щT$ L$TL$$T$T$$t$<$r$?9D$,~T$,$P@T$B$ET$Bl[^_]ÍD$($D$4$D$ T$m|1ۃD$P%=@T$LD$HT$$z$T$L$L$$T$T$T$‰p4$T$t$ $D$Q-$P$D$'$QA/BAADvD$$'$$K 莕D$$$ D$oD$ K D$&D$t $} $K ? UWVS|$0l$4tdt&@uaX$u H[tA3@tF($E= tuՃ Љ4$T$8[ufu[^_]Ð@($uu㍶UWVS,D$\$@|$Dt$LD$$)'+&E(tD$; D$$t$,$׉$du΋s11At&< C=t" |$D$$T$HfS9s\K @x u<t<uL$HD$D$؉|$$S9r&uD$$&,[^_]ËC $ٱCCC ʃ$[|$$P D$',t$(t$\$$Ét$ @D$D$D$tD$$D$^Rt#$LD$D$4$C%\$$t$(,Ít&'UWVS< i X t6Y @ t)tl< u ([t!t$$׷u[^_]Ðt&@ 11ۋt$$護tQuX [^_]Ð5< X uD$$0< < BDm@ uVSÃ.merBge_fBile_B XXXXfBXXB$ƋC4$D$D$5;Cu4$4[^$o4 fUWVS$$DŽ$DŽ$DŽ$tDŽ$DŽ$$U|$<\$n$$DŽ$d $hDŽ$lK $pDŽ$t7 $xDŽ$|J $DŽ$DŽ$$@$L$($$xL$($D$ ! D$2 $D$D$E$dD$ $D$! E$D$*$D$$$$~D$$D$,#x'$D$l$$RtB,$F<$$4$$$s"D$,Ĭ[^_]Ít&$0$A$$$QD$T$,$x$;Av$Z$ASD$ L D$D$K $K ]E$tL D$莎&'D$DT$$t%D$,DD$4 HJD$ L D$.D$K $K &\|$T$\$L\$lt$Pt$tl$Xl$d3CD$$t]$D$h$L T$ T$xD$T$ƎDދECE\$Lt$P|$Tl$X\ÍFD$$/uT$|BD$$qT$ 1 rD$(D$,GD$ xD$0$~ $D$$D$pT$ T$|l$t$D$4D$xT$$D$8$D$<%D$ L D$GD$K $K Wt&'LD$ttvHD$ D$ЃT$8D$8D$xL$[uًl$D$$|$ËD$$诜C< C< &D$\) u!D$t}D$$UCt&L t8L  D$t8D$$C l$fD$tD$$Cl$D\$,D$@K t$0|$4l$8<\; \$L$t$Pt$d|$T|$xl$XD; D$; D$4$1҅u;; ; t,T$Wt'|$,$ D$7O $D$pt$$xD$x%$D$N $D$1 {LD$$ 袚D$(t.1CBtSDT$1҃{L$‰T$*{LpF,eD$PxCp$eD$PCDT$`D$LD$@D$lD$HT$t$D$XD$@D$ CL$\~Sp҉T$,qT$,$]T$h\$1t$$Dt/$3u# $ D$fD$ܰ D$$A|[^_]Ðt&HH<-\$4D$`$D$PD$dT$h PT$dT$hDT$`$D$D$P X D$8T$,D$D$`$T$< T$`$D$D$dT$h PT$dT$hD|$d|$D$BO $辎D$Ԯ|$dv  $T$SAD$PD$D$lD$ D$DD$t$$&F$ |$D$D$ D$h$ӓf$ 萖&D$zdt&F$VcB&CBD$8t&D$4\$<4T$0T$d9T$0< t1111ɉ\$4v1<@;T$0< tvt<@1<:ÉEō\$<&룍t&t$$ &t$$1\$4`+ \$\$ t$|$`4$-Z,u.CPtC@tQ4$!R\$t$|$Ít&ǃ4$Q1t$\$|$É$ tC@ t{LttWt34$T$Ћ D$T$ PT$@$n $ D$)/D$ $耋fUWVS<$褉T$@9 @ u 9v @ uN9v)^@ u &9v@ ut$19FӉP}AxEƒ,[^_]f9l1t&돍t&S\$ $CD$ [&'S\$ $ʊC$迊K\$ D$$[g&UWVS\D$e$L1҉L$(D$ Z $>D$\$LfD$D$$D$贈|$L#D$<D$@D$DD$Hڋ !%tDJDD$()څw҉t |K P RT$($萉,$|T$(KT$Z@ tt& @ uT$$豋L$@؍T$<$*D$DtL$HT$D$t$@T$D|$HT$ T$e$,1T$$\4$T$փJ)Gl$,=1~!t&@ t߃ 9uT$\$$? t@P 9t${1ۅtI$XuY$`t!t$`D$T$T$$0$,e3<[^_]Í&Gt$XD$4$T$$`t뇉$`wT$$T$U E v$X1D$4$T$gN$XGt]1+bUWVS,B(B@ B(%=uC$ՅWD#ƉЉT$fkeʃ@!9u(l$l$|$$\tW@8u,[^_]Ë\$tb1ul$|$4$z?uJfKC2l$1|$$D$ IT$J,Mz,C1t&VSDt$PD$KC; R T$DD$ D$R D$4$iiǃ;"SЃB@Cu1ɅɺS  Dt$$ pD$)F D$4$hSDž=kt$$ oC8D$ D$] D$4$h_vt$$ o|$/t*D$(@t t$ D$D$$R n<[^_]fD$S D$4$$hD$R D$4$hQD$(@t$ D$ D$$R nt&; R t&; 8E׉D$T$ D$ D$4$gCuˋEfɺR R DS\$ L$u7D$u$1S hL[Ív$S TL[Í&D$$S 8L[Ív$Xt$t$ t@1$t$Ðt&Xt(~,X$JB1t$Í&Bu"BZL$ ڋt$$3 fB 돐,|$(ljȃ\$ Ӊt$$t2Ot%CS@S 4$\$ t$$|$(,fBu:u WtCu v$T 7J&$lU CROS 4$u뙍v1҅K uS 1\$ t$$|$(,ÅC [ 1U3=5/7-'<$it$<$D$A$HZ1&Ct GC ډ$D$\$<$St&1ɅS u  1XCet GVD$ډ$¸[D$D$D$$S9vtC S 1#t&tC S !1 vCt GD$ډ$¸D${ D$D$D$ $fT$1:CS_S 4$cCt GC ډ$TC 1>D$D$vD$D$v1~fC S 1C S uC S 1t&UWVS,D$L$IL$9j\$1ۍr$f$< 9l> DڋuD$@ tyT$B@ t&2@ uL$t$ $XXNjD$p>DD$pD$|$$S<$d,[^_]f\$1L${EL$AD$,[^_]`뽉'҉L$tT$$yS FÐD$$S FÍUWVST$0l$@|$D!19rtftD$4zBD$8D$8BD$t$<$>$\$@t$D|$HL$bt&D$$ =뱍t&'D$ D$S D$D$ ` $dXD$(D$D$$$t&SD$$\$ tHT$$T$D$ $ZT$$:uGuS 1[Í& 9}fL$(D ΐ)(MvCS_S $q[ÍSD$ X D$$D$$!1[Ð&SD$$\$ T$(t,D$D$$x S 1[Ít&Ҹ) uˋC fCSDU D$ [t&L$ D$ɋP uxvt!~-1Ít&1Í&x1Ít&Ґɐ&<\$0\$DeD$,1|$8|$@t$4t{t$t$$u=4$#tIW $T$)1T$,e3uD\$0t$4|$8<Ív\$$S h;΍\$$S P;붸\fD$|$ P 1Ív'WVS\$t$t#t!1 $8t9ىu[^_11ɐD$f$9ˉvދ8ҍ:xzxzx z xzxzxzxzx z 8u[1^_ÐD$T$Ít&L\$t  :u)L$|$ u/t>;tSC:uÀ;uv$,e3D$<[^_]ËL$D$4$L$ut$4$x4$*G~|*/t4l$t$<$MKnD$ D$U <$D$ tu11?fD$D$<$T$(D$L$,BD$(D$,D9t0< tP^vD$D$U <$葾9uЉ<$D$蛵D$(T$, PT$(T$,D|$$V /<$臶<[^_]Í&D$U $舴t$CD$U $hD$D$U <$H$V >L&S(T$D$D$ D$D$$ |@=w[XU  0 V  ڃV  ¸ ([$TV B"fD$ $2 Ð&,l$(l$8t$ t$4|$$|$0\$t\$t$<$ 6~)u\$t$ |$$l$(,fu$V !f$V !+V  D$ D$D$+V $MÉ'+V D$ D$D$+V $}É'D$$T$(0D$ D$D$ $Ít&D$$T$(D$ D$D$ $Ít&,|$(|$0T$eD$1\$ \$4t$$D$d|]tC;t$8sfډ1ɉ3T$e3u$\$ t$$|$(,Ð1ɺ+V BT$T$$|V  t$$V D$,D$V $_u3D$,1Ҁ8t‰SD$:$H8ps<1[^_]Ít&D$,D$V $tt$,D$%4$8C벍vT$Թ 9w9\$ CCC C̹ D@09v.Թ D$,$}-̹ ډ\$ȹ 둣Թ C fUWVSÃ,fD$ $<79t|$<;>tk9une$Le3J\[^_]Ít&9tx@ u,1|9wt&\$<\$<$+)T$,T$LT$D$LD$ $m/D$ D$D$0D$L$-D$4t`T$,1|$T$D$R D$ l$D$MW 4$V\[^_]ÍD$<<$+t9rt&9vC@ u)D$(D$D$FW 4$轥D$(1L$( 9m";wҀ@Y t݋D$(T$@1$D$@D$DD$D$HtD$@$D$T$DD$Ht$D$$蹎CS PSSDF>.u<.uF<.t1뗋C19D$$s=K|1L$,-|$,vLp-w ;D$$uT$D$$%D$$O G4L$,+T$,W8D$D$$+D$,OG<@D$$贍CS-PSSD[D$$1Pt&S(D$0D$D$D$tt4T$4\$D$@fD$$T$ L$T([Í&ع u鍶'$$\$$$߉$$P1$$ҋ$l$$D$(FD$|E,D$0t+T$T$|Y T$D$T$us$\$ D${4$D$l1ɉD$$D$0;E,t$$$$$ĜÍT$,$LD$0xvUWVS,t$\$Hl$L|$PD$P4$yT$DD$R 4$D$T$DD$$D$蔋,$l$$D$贐D$TL$T$$D$$NCS PSSDD$X~T$TD$ X $T$t<$6|$$D$:|$@t4$ ,[^_]Ív$D$ЊCS PSSD4$Ћ,[^_]ËD$$D$蘊D$$D$D$D$t&'UWVS,l$D|$Ht&u1ۍv< uE&D@ tuu|$@T$L<$DD$D$Lt=T$LD$ T$GG$D$LGtm9WG\$t$<$D$<$蕉GW PWWD1ۉE2,[^_]ÉD$D$<$FD$t \$\$t$t$8tt$\$D$t$ Jv'UWVSl$$B,$D$XRT$@$D$\D$$xl$XD$,t D$,D$Xŋ$ET$0҃$T$(D$OuuT$@umȅD$@t^111t& Lօt3t1à LօuD$@T$\D$$T$8$R T$<$T$D$T$4t&1 t&D< uDD$X$\W" u0E룍vt$$$B$t0ҍ&@uk2T$$$$r$|$0ND$$$D$D$W $|$Dl$H$\$$($SvD$D$S ,$aXtЉ|$$au뾍D$$F <F  u |$4l$X$l$\$$Al$X\$t$RD$X|$0D$Xr$\$XrT$(\$T$ $T$$$$$詇$D$$b$|$OBыR PQQDt$9rf$B!D$,$vl[^_]f$CPD$$T$8ED$ $W T$T$D$$[}KSL$(L$D$(0 KKDtD$t$0$ t;D$$|KSL$(L$D$(0 KKDtT$t$0$c L$$L$$g&D$ 8D$(ptD$ |$$D$赁tD$ t$ D$<$D$1 19|$,tS|$Tl$ l$$uCt(D$$)|CS"PSSDtt$$" <[^_]UWVS,\$@t$DD$9sED$${CS'PSSDt^1<'t)"o1ɉt(<"t$<\t Ff"t\t ÄuL$t$<$xS<"tM<\t)t[97Go(,[^_]Ít&CsPȀTw$ Z t&L$H1tʋL$H,[^_]D$<$s둍t&D$ t&D$<$r_WD$CGGDD$C/37*S/70ŀ B sL$D$vD$lD$ bD$ XD$ ND$ D&WVS|$ t$$$'|$tC$'tۉ$|$t\u݉|$$\iЍv|$$D$ '[^_MWVS|$ t$$$'|$.t( tS\t6't1ۉ$|$u؉|$$D$ '[^_|$$\뽍|$$\|$$nyt&'WVS|$ t$$$"|$~ftG"tiW   t|t&ۉ$|$5u|$$D$ "[^_]#[}$u|$$\뮍{t}u|$$\댍t&|$ D$D$$% +v|$ D$D$$% v|$ D$D$$Z v t3 |$ D$D$$ Z Vt&|$ D$D$$Z ,{WV4eD$,1t$GDt$D$ $rG1҅x,(҉ЋT$,e3u4^_Y'||$teD$\1B\$lt$pl$x%==t]=@@t)T$\e3\$lt$p|$tl$x|fG@%=uÉՃ 밐z0B,|~ $& D$\$4 GDD$4D$8D$ TuD$%=@/DȄu6D$(%=@t!18$t$|$l$ Í&/8Ѹrϐ&$\$l$ l$$t$t$|$|$ 9NՉ9(uB9t>\$ u\$@/Dˋ\$ t&/tF)А$t$|$l$ Ðt&\$(@t/tƍ&/u뽍'l$ l$$\$ t$t$|$|$9ӉN9(u/9ڸ|&T$ 01ɸ09M$t$|$l$ Ít&UWV1SD$$x s9~ID$$(>DP(DD$D$,T$ D$D$($ t}9~ ߍvÍӃ[^_]Ív',\$\$0t$ t$4|$$l$(,<$|$譬S1O( C 9։Ss")T$ōTT$,$\$t$ |$$l$(,Ív'UWVSl$1ۋ}ut/1 9J(tJ(u9uE ][^_]Í&'UWVS|$4\$0<$e|$$D$i|$1ƋC$H;ss7,t&t$$9sv(|$D$Wt׃1[^_]Í't$t$ \$|$|$$^(uC$W(uC$19t\$t$|$ÐDD9ۋ\$t$|$ÍS(\$0C(%=uC$'D$D$4D\$D$D$ $_([Ív'L$A.t/tu*1Ðt&Q/t~-guyit>ft/u빐t&ft.u։Q/tu1Àytuv⍴&'@tQ>f' ‰V(Q@%=u$T$$T$$NDT$ $D$T$04t$$3RV(@uC$T$$T$$Fl$($T$Jl$,*ˉ$ J J =CUERul$,\$,$T$(B;T$0v\$(l$;Gw9T$$D$$T$o(xg&@uC$4Hl$$ËȉGȉCGȉCG ȉC GȉCGȉCGȉCGȉCG ȉC G$ȉC$O,K(O0K,O4K0O8K4Wt`ffS>S@%=uC<$T$aT$D$D$$D$$ٍ$,$0$b9t$1$B$TD$DŽ$TDŽ$XDŽ$\t$[,$XEERT$$$A$X$\$$$}$]C$B$TD$DŽ$TDŽ$XDŽ$\t$g$XCUER$$$$X$\$$$q$B5  $D$,$9$|$D$ $90l[^_]ÐuC$HFDŽ$HDIRC1l[^_]Í$Bu$tG$o(mt&$~ t$l$$t $t$D$ $9$CAl[^_]ÍD$,D$$$D$D$t1ۋ$BD$xBl[^_]Ct&UWVSt$0\$4~ u0n~<>1ҍ& A%=t6Ft/;Aw*C4$D$t/\$0[^_]7,&9u\$0[^_],\$0[^_]+&UW1VS,\$@$kk11f;C 4F(0tND $L$$Ǎ@LD$西L$|$L$PDʼn$T$t GE(FED$l$$T$u.|$T$$;CQ,[^_]ÐL$$] L$,[^lj_]Ã\$\$(t$t$ |$|$$t 1|/)É\$|$4$1҅xЋ\$t$|$Ðt&в;Fs4F(%=uC$9úuD9럐L\$@t$DƉ|$HeD$<1D$$4$ջ\$D$ 4$JK t(T$ovSD$$@t4P@k8BX4$\$D$D$ $:[Ð&VS4D$@Pr\$$JT$HD$$k8qD$(T$D$D$,tD$ $T$DF4u:D$F(D$_ $D$ D$,D$$64[^Ðt&D$ D$,D$& $D$ːSu ؋$u[Ít&' =, t0 t=- t4 t4 0 - ,  É'UWVS<…D$,D$$T$11D$ D$&D$L$$؋9L$$ЅډÉL$~qt?t$t7B-D$(D$L$(T$-D$ $T$|\trfD$L$L$tL$D؅D$؉ӃD$ ۉ\$6Ћl$몐t&<|$rL$(T$$c L$ΡT$l$2$'D$L$GfD$؉ӃD$ ۉbD$ d$$9D$,t&D$ ҉D$,dD$ D$ d$$9D$,uڃ|$,uӉЃ<[^_]ËD$($_ D$ \$Ӊt$pR)\$4$D$ V4$)Eډ\$赱\$t$É'-$Ӊ뢍l$$ ` T$f,\$\$ D$$L$$(D$D$$D$Q D$ټ't$Ɖ\$|$D$c  $Rgǡ( Vu{tC\$t$|$ÐD$ Z <$4C1tS/4$SCC\$t$|$$c , e녍t&'UWVSe$1  fC-D$4$þu$c uel$8D$$@ D$D$,yt&to{-|$4$otC$|$D$Od D$ dD$D$dD$,$P=dw{D$D$,l$$9u$@ t&1$e3uLĬ[^_]$c d\$$t$$T` 봉|$$c 虺'UWVSÁ $$e$1T$ =$T$D$t$ډ$T$膷D$$T$t$,D$t$$@<$D$4T$Ku&tD+@ uD,1l$4$t[U 8u@D$0L$0@ t@ u$T$,$D$Nj$e3ļ[^_]fpackBed-rBefs$D$ Z гtnT$($D$(D$t=tRC-t$$迻uS1US US USU CED$VF;pt& L$(T$$D$$D$ l Ív   Ðt&UWVS|$0<$贵t|/t |7/uu[^_]ÉŐ$Gl$|$݉$E/.gifEt$ΐt2$|<$4ƍ$t$|$É$´D$8VL$43/D3$D$$"[^_]ÍUWVS$$$e $1ɅD$(T$,tE$D$$$D$ D$(D$N D$$D$ d_T$~4$v.Te ǹָDv@uv[^_f@,$9<ty uOT$,$T$$Ta T$D$;u$3T$D$($Tc D$jZDŽ$$DŽ$(DŽ$,DŽ$0DŽ$4t&D$($e D$ljD$($$D$$<$f\$$`  jvl$$|e j릋D$($e D$i됉\$$e iorUWVS$$$$Ne D$8$T$H$D$<$ T$@e$1҉D$D$D$4D$D$D$,$DD$TD$|$$$$T$4 &|T$4D$D$|$T$D$ D$$v<$訉$9ӉT$0׽GD$(D$$< tw1 t&G< t <>D9r$D$ D$$r;$~v1)9s)Gl$(|$$< uW9s>G< t6s<>t>< ft8؋L$0>t* t%9uD$,$ f D$f1;\$0t؀8 tݍ$T$D$ $跆D$ D$D$ $$蔆t$8$t$D$$4ut$8X|$HtT$0T$Ht$4$t$t$$~ix _$D$BT$$D$ $艂T$$D$,-$8 H-t +H@ H@ H@ @@ B$D$ D$$%$z :$D$D$,T$$|$T$D$ $4$RD$T$(B1$,$$e3[^_]Ðt&${T$4T$$D$uv9T$d$|J9t$`rBD$t$$8uB$D$ \$,$xt&$?,$@$ݾ- $ D$(D$D$ D$$D$D$ $iÐt&L$; T$&'VSD$0\$$t$4D$D$,$D$;P tJT$ $T$T$(T$1҅x [^Ít&uT\$$Pf `ِt&ttG[^f\$$6f ``[^Ívủ\$$Pf K_v\$$6f 8_&VS\$ t$$u t&tC@t$$菄u[^Í&UWVSl$e$\1T$4T  1҅t.1t&$~ډT Ƌ u$oT T$8D$0X 1T$zl$t$$D$j~1L$9L$D$t$+t$9ƉЉ8D$L$D$* $uPlj$+|$T$yL$+t$)Lȉ$_jL$@L$|$$L$ut$L$@\$)+t$t$$uT$T$T$@24$y\$,t$0|$4l$8<Ét$$f XL$$f L$X&UWVSÃ<$L$(xD$D$D$$D$ D$,t&~@<$xD$ |$$gt,;l$t;l$tD$ <$tu8D$t$ 6uT$ tPT$ D$(T$T$$D$$<[^_]ÍvD$ <$(tD$$t$,D$$D$,D$(T$,D$$<[^_]Ív\$Ét$֋P@ 9|OD@09}6C D$C$iSC4t$S\$ÍBC ŋC؍v,\$Ét$ p @l$(Չ|$$9|_D@09}FCD$C$9is C<o,$wl$(|$$s \$t$ ,ÐFC뵋Cȍt&'\$Ét$֋P@9|OD@09}6CD$C $hSC 4t$S\$ÍBCŋC ؍v\$Ét$֋P,@09|OD@09}6C0D$C$$AhS,C$4t$S,\$ÍBC0ŋC$؍v\$Ét$֋P<@@9|OD@09}6C@D$C4$gSxT$u |=u/;t$t5uƋ$T$D$yT$tы4,[^_]fD$\$\f ơ 9}+ 4 u[$c,[^_]fD@09}O D$ $Fe 4  t|$$d,[^_]ÍvB 묍UWVSÃ, D$~x1 9(|$$T$l$vT$u |=u/;t$t5uƋ$T$D$wT$tы4,[^_]f 9D$|5D@09D$ D$ $5d D$ $d ơ 4 uX$hb$q $brefs@/hea@ds/D$C $Hr^,[^_]Í&|$$Lc뢋D$ >&LD$P\$$k {@@@ @$@(D$\t$D$4,T$(L$`D$t$) D$hD$D$\D$LD$PD$Tt@D$ D$$躠D$ $ t$LD$ D$ 4$\L$ $tkD$) 4$ZD$ 4$Bt.D$ 4$.tD$4 4$_f) ?CD$,$!|$Ɖ$9u֋D$D$;11獶UWVS,\$@u2t&ST$ֹC4S<BRkSPUPUP U @EC0X ȨC0D${T$ ЈC0T$Hu<wC4p,[^_]Í&t$XtL$ $2u&D$C0됍vL$DkLt&D$,$D$uD$C0SUWVS$e$1$$D$C@$D$ D$l$$/o,$D$[D$ D$l$C$4,$"9D$$T@l$0D$(D$,i D$4 D$8$J,$l$PD$TD$nID$DŽ$|...$D$)D$$$9ID$,$MD$(D$ l$D$$-,$赠,$t t],$誰uD$$D$D$$D$f$e3D$u[^_]ÐI&'VS4\$@D$,D$D$(t$DD$$1҅u 4[^Ðt&C@D$$T$,L$(tD|N ; EˉT$ D$4$L$D$i p4[^ÍvN ; EӉT$D$4$L$ D$i 44[^Í&T$L$ D$D$,j 4$%v',D$D$D$D$D$$ AyD$,ÐUWVSGEt/L$, B(0twzD9t$Tl$Tl$Tt&D$T<[^_]Ít&T$(L$$D$\$ T$TT T$$QD$<$D$SL$$SL$($l L$ 59s|$D$Etl$Tl$TU'UWVS,|$@l$D_~Otw11 ;_sf4F(%=uC$X?DD$D$ D$t$,$tt\$<$Ã;_r,[^_]Ã$Ét$$|$ljl$ Չ1tftЋ|$C+l$   ω t$ ȃƒ ЈC$Íxf#mff[&S \$ $\$?CD$CD$C$[ÍSD$$$Gl D$D$ D$gC; t9 $;Ë@x$A?Cx$2?$8$ C&'UWVSÃCD$L$I/4$tUt)D$<un߉t$<$)\$$>/tg؋t$0\$,|$4l$8<Ð#X$)D$l$É$)륐t&D$@|$$D$(y&s)tR$(,$ljD$G$D$(|$l$$D$,T$u;|$ ;vt% $p#4$1$X#4$1tt8/tb$N!$9!|$,D$<$#$ !$ o $@ $ / a"D${A $n \$$n $(q |$$n $n D$$n D$\$$n {t&'UWVS<$(o ËD$Pt D$PD$$"D$(!%tDQET$(\$(l$(${A $D$ t?L$PT$(ct \$PtL$P ɉ B<[^_]É\$$qD$$q D$,1Ʌ11t$ \$(t$,|$$ύt&$/ $Ņ,$l c9}a/utU 3T$$3D$ e$U qƃD$$Xo |$P$T|$P1&/ ^.D$ / T$PD$ q$7B i9\$(tD$ 8/t$L$ D$ $L$PT$(D$ mD$,$D$1Ҹ L$L$ƉET$P $7B 9\$( t\$$$$uiL$PT$(m1\f 9\$(tD$ $KD$ D$ $$t$ o &-I9\$(  tq$p$0$9Lƀ(1t$P$$D$P1l$ 1Y$ @t$ / t D$ $19\$(  L$(Ɓ/ƁƃD$$q x$Xq D$ ED$/ $q O$@o cvuD$$'UWVSÃ<1L$$t>21׃< < TF FuՋL$$<[^_]ÉT$,$8ƍ@< $L$$l$Pl$|$D$ s D$D$$L$$T$,12^'$$T$L$$É$։$$<$D$ / D$D$ED$$$;E|$D$D$$$+;D$$t$\$$;D$$D$$$;$$$$ĜÍ'UWVSÃHDDD҉T$~?1ҽ$  ;T$t$<$Ɖ8u݃[^_]Ðt&$@ ޹18Dƒ[^_]UWVSӃ,D$@D$D$@ D$tA1ҽ\$ ;T$t$t$8u܃,[^_]Ít&\$T$DD$D$$T$щB RSPSPS P SPA,[^_]Í&$$$$D$$:D$tD$xD$|tƸu}D$D$\$$ uD$$%=uoD$@|$t\$<$D$NJuWD$|8/uND$$u:<$~D$$.$$$Čf|$t<$~ɍ&UWVS|$<$t_l$D$/4$uCCs$_CED$$X} ȉl$D$$v ~CS D$ D$C,T$$!ЃtoC,$D$t$$:u7S(S184l$$w sl$$dw ^l$$@w I$v} cv$$$e$1$$T$,$DŽ$infoDŽ$/altDŽ$ernaDŽ$tesD$|$D$ A D$D$$D$8D$l$$ZD$h\$d |~ $& QD$D$l$D$ D$\$$,$D$, <$D$X\$4$$e3u.$$$$Ð,$5'UWVSL\$`T$ L$(\$0\$d\$49Љlj\$<#‰;D$(uL$ t$( f99u/t D$4E)T$$L$$l$$+?/D$8L$,t!D$0tD$0$l$$PT$,ՋD$,T$$T$?/D$t$0L$0rD$t$$L$pD$L$$D0/T$T$L$|$$KT$L$,D* BD$D* /D D*$%-l\$$T$։x98u݋D$\$$$Y9\$ v%;D$(u6T$ L$( t&9u!9uL[^_]f9r9\$ f#L[^_]f|$(#tT$ L$(&9t9u9|$ 뙍v\$$t$9|$8T$$$D$T$t$q1҅ƒ[ÍvWVS|$ t$$lu t t$$ׅt[^_Í$Ɖ$׉$$$D$ D$l$$|$PD$L}hD$D$l$D$ D$D$$BÉ,$t؋$$$$ĜÍv~$& bf1뼍t&vlu $tCCx1ۍvst&'VSt$ ^t=Cuw09v,ڃցu܋T$<2[^_]Í$~ l1[^_]øύt&'L\$<Ét$@ֺ8|$Dljl$H8D1tftD$P3kC D$TCN>xD$(D$ D$,D$l$4$¸tjL$,M t])Չ3k$ID$,t$($ ot$D$/ D$ D$D$D$TD$D$P$C1\$19^v~$t\$t$Ív[t$\$f4$`1uɋV뭍vSD$L$ Px$t0PR\ȅx1[ÐB[ʋ@Í&I1ҋ[ÍUWVSL-l |$`T$d|$,T$8zhT$8B$0w|$0|$,t$D$Xt hD$X$\$\T$0$D$L$L$4$D$8HD$PT$Tl$$$T$D$D$\$l$ D$D$8T$$$$L$\$D$0L$,5@DT$<ׁ@$GT$(t0$hL$(GG5@D+w@$@$Bt$,;5 h 5@Dvld u!bf5@D95 [sOd {u݋Ct։$CC+s95 5@DB[r&$T$4L$&'L\$<Ít$@ƉL$,@$F|$Dl$Ht9^ t;L$PT$$L$L$TL$ L$,L$\$ |$ D$D$(D$D$,$$21뀍t&D$4$D$t$D$l$ \$D$<$10t$$| 4&Ϲ$5t$$ D$Sv몍&臹$t$$ D$轟&S\$$D$ D$ \$$ v$;PACKuC1=t1=TR[Ít&'\$\$ t$t$$D$$x9u$\$t$É$A$ D$4$y@$t$$ D$VSD$Y $/uEt`7tKX1t$ٽt$D$$-[^Í&D$Y 4$.t1$H \$ PD$$\$t$t$ $eCt<t5<t1\$t$ÍvD$,$D$1\$t$f4$$$t$D$ft륍v'UWVSÃl8!L$,D$T|$4D$\$<$脻\$,1t*l$Tfl$$:[uvD$,4D$,D$$Xʼn$SBtϋE,1D$S $D$D$ D$D$<$u,$CCFCFC F CF<$ʶD$,$r\$T1tD$$֒[uD$T$Cl[^_]Í,$ĹvD$\D$D$XD$ D$$@1cx!uZ\$$U v'UWVST$De$1҃|$D(L$HT$D; DŽ$DŽ$DŽ$DŽ$DŽ$D$PxxxxD$TxxxxD$XxxxxD$\xxxxD$`xxxxD$dxxxxD$hxxxxD$lxxxxD$pxxxxD$txxxxD$<1ҋt$D,t&K\PDˉ9|$Pt(KЀ vύKvčKKɃ 볉T$<|$@TlL$xT$@T$D$ p D$(D$ $讽TD$4ۉ\$8D$<D$0t&\$8T$@D$ u D$D$T$C$U؃$|$4ÅD$,txt&D$,$踸tNk,$&uދL$0|$R9u΋t$4t$z&D$4륐t&|$4ËD$,$@T$8ۋT$8t&|$4pT$,\$,1҅$D$LD$8L$(v\$,1$蚲S҉T$0u[t&k9sCL$,\T$$\$ $t$(T$$(Ƀt 9r9\$0T$,T$,toT$8u5L$L$A$A$A $A$\$4 $e3 [^_]ÐT$,\$$l$<$\$ D$0 &87zqw\$ tA2B\$\$,$q$u ,t&ȉ8 uZHwt:@2Bt/L$8t$L|$0uD$8\$4 CD$zED$~E$E $E$E$E$E$E $E$D$4f$D$0D$LS1D$4|$4~0$E\$@T$D${ \$T$H9T$4tDҍ$$DL$HPQPQP Q @A1$$k$L$H$A$A$A $A1z$1ۍL$xD$ $iÉ\$48\$P\$@i$諴ƍ@3$rt$|$ãT@$1D3CD3/軶t&EƉ$_T$@@t{T$4$8D$G@$0T$ƋD$d8D$d)@@4$误L$dt$ $D$&4$ӭL[^_]Ét$$ -kD$D$$2!L$dD$ vD$$!L$dT$ Vԍt& LD$dT$dD$$D$(pD$\$\$$$D$,t)D$%L$d\$A$"x]L$dtxT$d)BBD$($D$M D$(L$dD$D$, $D$q%$I!L[^_]ËT$dtE9D$dp@0D$ $D$dj&D$$L$d룐&,|$(|$\$ É|$t$$D$D$D$t$19uD$D$<$= ‹D$Ћ\$ t$$|$(,ÐUWVS$$D$0$T$4$D$XT$HT$$D$&D$X%=T$,|$,$]T$4ET$0EBEBE B EB |$,t&D$8$ЩD$,$e3u8[^_]Ðt&|$,؋T$,v |$,b菭vUWVS1ہl$$D$0$T$4$D$}u+9w'}f<{u9s {^+9v|$,(D$TD$,D$81D$4L$0D$T1ۋT$4D$ ,$L$T$i.T$8T:-T$(HT$811Tאt&TJЀ L$(D$dt$ $ÍD$d$D$%$W\$d<D$`L$0D$D$\D$D$XD$D$TD$L$ \$|$$t@D$\D$D$D$X$T$4l$$ T$D$ ZD$T1$踥Pf9t$,ƒ)9sW1ېt&<9\{ut;ɉL$huDL$|e3 Č[^_]Ít&1ۉ;T$(ÄɍL$htPu|$h<$o$xG$u xv@tnuL$0BRPQPQP Q @AO|$h<$}T$,1T$4D$4U1T./'$D$4L$8D$HD$HD$LD$PtD$ $%L$0D$TD$ D$$ L$=D$4;D$42L1T$,T$8&|@Tu|{u\$,D$8T$-tD$D$ D$  D$D$$Ct$(\$$D$0,t&\$$t$(,Í&UWVS$$$$ ,$T$8L$0e$1҉D$HB|$01tftL$0ډǁ0L$8JtDE<:tl1҄u2f<:t<{tBt<})uf$e3[^_]Í&뫍v~Eyu1ۉ<$ [^_Ív24$eálD$D$C$]uD$TD /SD0B)l1x띐D$<$XD$}&UWVS|$ND$$1ۉD$ v9^~x,UB4%=uE@4%=u͋B$PVD$u}GD$t+E@$]d$PVD$냍v|[^_]É<$D$ $eD$D$$7 D$_$!([Í,l$(l$0\$\$4t$ |$$E%E;au{lu{lu{u E1K  t85 t8g u2\$t$ |$$l$(,Ít& Eލ EΉ\$$ &QSD$$\$ $ VD$t0@$0VD$t@\$ D$$[t&[Ít&',\$\$4l$(l$0t$ |$$\$,$Y]1҅tt.U  u%Ћ\$t$ |$$l$(,Ív\$l$$_ EPt&L\$<\$Pl$Hl$Tt$@|$D $D$$D$(D$,t>pPs ֹT$BPy ֹT$. 4K  t>5 t.}aD}l:}l0}&t$$D$\$4$D$,$0VD$(@$m4$;,$_C1\$D$8D$$X>v D$$D$4XiD$x ÍUWVS$$e$1DŽ$DŽ$DŽ$ DŽ$ DŽ$D$4$¬$Z$VD$ t$$$$D$舱4$|$t&4$ttX$th<$RL$PDŽ$0 <$Wxm|$ D$; l$$v<$<$v'[u4$uv$$c$e3u#[^_]$ :E$} .Eg'UWVS$$eD$ BDGD$$Wk 1t&DD9u V  7  T D$8D$|$1D$ $\$8D$PB D$T 4t$,1T$(\$$t&;5$ D$dtD$ptD$|tDD$p$tC$D$dT$(D$LT$,D$|D$8$1DD$D$T$\$D$h$,$;5$q\$$$aD$$PV(D$Č[^_]Ð$ ̍j$] HB$|$ D$m $T$Q^#T$$@Vtd@% iv|$$PVU D D$x c똉'UWVSl$t$T$D$D6 D$H D$LD$PD$TD$XD$\tl$D$, 4$D$\$<DD$\$(D$T4D$\D$XD$ D$|$1D$DD$ D$ D$8B D$< D$,l$4$%D$,1D$4$D$|$\?Tt&uIuAD$ <$T$\T$t%)~ǀ??u€?utD$,$aD$ $.u]4$,l[^_]fD$L v4$1l[^_]Ít&D$4$|$Th$ ?$ ? l\$\\$|t$`|$dl$hl$pECECEC E CEt$xXD$(8tމt$uD$(\$\t$`|$dl$hlÐt&D$t?T$x$'$'D$H$ $'D$L|$HD$|$4$;t(T$LT$T$,D$4$:T$,T$tD$ $ T$B?D$( t&D$tD$ $ D$?&D$tD$ņ $ D$>D$(&D$HD$T$$P:uuD$LD$|$$4:D$LL$HT$t$D$<D$tD$( $ D$`>D$D$[D$(2$EAEAEA E AED$(ECECEC E CED$(tPD$tD$ $ D$=L$<_11ۍvT$D@4;\$Wt9<>u19v4: Jt9tp< u19vD$ D$$`RE D$t&\$${ 3Et&D$$$4E|1Tv<1\$0\$@t$4|$8t\$0t$4|$8<ÍD$,D${D$(D$ D$<$~to|$(t0$P<$蠐$ D$`2\$0t$4|$8<ËD$,t$$D$L4$D$OD$\$0t$4|$8<Ít&<$@$_" D$25t&'UWVS1ۃl$4uBZt&D$ʉ 4$(tA)߉|$D$ 4$Ut)x9vt$0D$ މ4$u[^_]Ðtpvu!8\tK t6t u\AruvÐt&\AnÍt&\A\1É'L\$<Ét$@l$HՉ|$D$ML1tAt:0tJD$% 4$L$,"QL$,1t1u,~u&\$D$8D$D$44$D$D$0D$4$D$ED$4$0D$T$ PT$T$DD$D$ ` $D$D$D$J4$ T$Y$N$[^fD$ $I1t t 0u zuÍvD$% $MÍt&,\$$\$0t$(D$D$D$t$t<$t$<D$84$D$D$4D$t$$4$1\$$t$(,Ðt&D$(D$D$$D$D$ $aÍ'D$$D$D$ $ D$1Í',$ $0e$1$$$($ u7$e3$ $$$(,Í&|$D$<$NKƸ DDK\D$$ $ D$=D$8 $ D$D$M $ D$D$] $ D$wL$ Q*,t$ ֋P\$É|$$l$(t-xl$ D$t$<$tDt'|\$t$ |$$l$(,ÐC⍴&$8Cuʍ&D$0뷍UWVS\y T$$\$pAt@f@EQ{D$$)T$ L$T$ Ft%=@t}D$CT$ T$$l$D$4$D$t9}C{8\[^_]fD$$Ѝt&@巁LfD$LD$D$H$D$ D$uT$ D$,|$HFt+D$CT$ T$$l$D$4$D$D$$DCS/PSSDD$LT$4$D$D$,D$l$Dtp1D$(-fT$$L$4$!T$4$%L$Dt5uыT$(D$8D$\$$T$ yt|t먍vD$,$EuP$芆$ D$Z'v'D$EvD$T$T$D$VDUWVS,$$@D$ $D$H$LD$ D$4$uD$$D$ D$ $D$VuD$ $$$$D$D$D$1$4$D$D$ D$l$ |$t$$?D$$uEt =t*D$$DD$ $DD$$,[^_]Ívfx4uƋ$$D$D$D$$4$D$D$ D$zT$4$D$(L$LAD$hDŽ$D$@E$D$XD$4D$$$T$4$kD$4D$ |$t$$kT$4$$$`CDž~y1ӉT$,ōv;G t4$24s{ DC[^_f$ t&l$ ͋L$9T$$Ét$Oʉ|$9ɉ(u +D$u$t$|$l$ Ðt&~ ݐt&;T$}9҉މu1|/D뱐L$ D$T$ɉHuÐvVS$\$4D$tKD$D$ D$ $D$at*D$D$D$0t$$$[^Ít&11ډ$q$ D$fSD$ PH+9r )مɉHu [Í&[$ [t&'UWVSÃD$ $T$T/UWVS<8D$,&tbtÉD$,$"%+uD$PuPD$4$蝗FVPVVDuD$,84$D$I<[^_]ÐD$4$MFV PVVDHG1ɉD$(1\$TZЀ wIL ЃuL$ D$4$FVL$ PVVDt&ZwL fZwL f!\$|$(fD$1҅~@ ҃-t&+t!1Ƀ.Ҹu T$!Ív\$\$ t$1|$tD$/$c 9tktgx:t\$t$|$Í&x/uS9tڍxf9sω t&9s)D$19$#uߍ&1뛍t&됉'VS$\$0D$:D$D$$D$t9Ér!L$1ҍD$0$C$[^Ðt&t)؉D$D$\$$^t$0뿐&, D$0L$D$D$D$t$,Ð&,v D$0L$D$D$D$t$,Ð&t$t$$\$\$ 4$"t$$D$襙Ct"S|/tD$D$Y $|\$t$Ã,D$0\$$\$4t$(t$4$D$D$D$D$te$W 4$D$軔t$(\$$,ÐVS4e$,1$H\$,$@D$ D$D$$DD$$D$$` \$t$ D$ D$$$,e3u 4[^#t&D$$$ D$D$ D$AÍ'D$$$' D$D$ D$Í'D$$$Gl D$D$ D$$Q&t&D$$$/ D$D$ D$$!&t&D$ ÍD$$D$D$ $'D$ $N D$'D$$D$D$ $ &VS4e$,1$@Y$1 &t,w$%,ru݁t Ƅ4,%rƄ,$,\$\$,D$D$& D$ D$D$$#$DD$$ 'D$$D$D$ $ÃD$$D$D$ $ÐUWV1S,ĆD$̆҉T$~5t&;D$l$\$<$D$ #uuGnt&t$$L GPF st t$\$$ (9 Ct t$\$κN &tt$$G 5 1҅t$\$뀍t&S\$ $,‰[vVS$Іt$0t^1ۅD$tHD$D$D$4$`u,D$ =i t=Y  t1ۅt $~Ã$[^Ít&$3 T^І돐VSÃT$$KCCt$D$ $]st9v(Cs0[^Ít&D$$D$  D$&D$t $} & D$(T$$\$t$|$l$q3$T$$t)1KCF #%)#_*#Ovw ?0T+?`v} vrvdЃOvGt{vD$$1\$t$|$l$ ùz1&P9 ;4D w;4@ Hؐt&3*IvST$€gS$€QST$€:hM|$? ? <$? kƀ? >&1ST$€cS$€MtHtSu |$|<$? ?  ƀuu|$ƀ4$o&VSt$ t.1ۀ>u /fÀ:t&D$ D$$T$ u݉4$Ã[^ÍvD$ tJwD$ uf tD$ D$$WD$ u1É'UWVSD$ $T$fT$ D$D$>D$ T$$dD$>D$ $Ɖ׉T$e C4$|$D$>D$ dD$>D$ $Ɖ׉T$~e C4$|$D$>D$ HdD$>D$ $Ɖ׉T$8e C4$D$>D$ |$dD$>D$ $Ɖ׉T$d CD$>D$ 4$|$cD$>D$ $T$dT$X CT$D$,$* <[^_]ÍE<[^_]Í&<[^_]Ð&D$$D$D$D$ $1Í'D$$D$D$D$ $Í'<\$,\$Dt$0t$@|$4|$Hl$8l$L$ - |$D$A D$ D$\$D‰D$4$7 9v'l$D\$,t$@|$4t$0l$8wGd$ D$l D  L$KD$t&,$ l$T$$ a$ @S(ԆD$D$D$D$0D$$@ u D$=i t"=Y tkt $ƒ([Í?D 1 @ H uu  u뿍t&$= >Ԇ[f?랍vVS$\$0D$D$D$t%@=@E@t$t$D$OD$D$H 4$gqÀt$D$D$D$^ 4$>qt$D$D$D$y 4$qt \$uPD$ D$k 4$p4$D$l$[^fD$D$4 4$p+vD$D$)F 4$p떍D$D$)F 4$p%vD$D$)F 4$`p.vt$D$D$4 4$D$0< D$4@ D$<T$l1\$81D$ T$$T$l\$$?T$(T$lT$,'v uSۉt+T$ 9T$(F9t4 uӅT$,D$ 9uӍ&\$8D$ D$lD$(t ;L$ L$(D$l11|$$|$(?D$ 9D$D$$hSD$KBCCD1҃9tG.< u;T$ uD$$KhCS PSSD19ut&ҋ|$$t8jt&D$$hCS PSSDu+|$(t$(|$t$$ mD$4D$0KtD$ptT$pL[^_]ÍD>@ uD$<1l$<덉D$ ,&D$<D$4D$0ǍT$ D$lxtD$ 1St$$|$(D$ D$l׃?At&D$D$$fSD$KBCCD9l$ T$$*< u&D$$fCS PSSDC1)u멐D$$XfCS PSSDvD$$(fCS PSSDLvt$$|$(+|$ t$ D$0D$<l$D$0< 1D$lD$4t!D>D$<D$0D$<1UWVSLT$d|$p҉~L$`| L$`D$ $ ҉D$,11$97oD$0D$ D$,D$D$݉D$,$uE ur97~nD$8T$`L0\4)9\$lN\$lۉ~(D@ uD@ tu1ɋD$hL$T$$1vD$,$L[^_]Ðt&t| tBt&UWVSÃu"Ht&)hCt$l$$)t(|$D$ 4$u͋C|$t$$[^_]Í'UWVS,D$H\$D|$Lۋ@T$D$tU1$|$\.KŋUUT$ UU T$)H)ыSH)HыT$L$$T$]u,1[^_]Ít&'UWVSD$8t$0~O\$41nfL$T$,$ h;|$8t&K| u؋F u);|$8uڋN ug1[^_]Ðt&L$T$,$gN VkFtFF 념t&D$,$PbFut&V&^tFF 1[^_]ÍFD$$bNu볍UWVSD$,tlD$  [^_]ÍvPJЀ gp1ɉ҃ LJZЀ v9?T$ /VB< %^1ލ&҃DBJЀ v9T$ Vt&UWVSLT$`L$dZD$0‹I\$4\$(ʼnD$8D$lL$|$u7D$C\$,t$0|$4l$8<Ðt&$; ,CЉ,$y)$֡ D$I'@T$$D$@F‰D$D$ $oÍ&UWVS,t$@\$DF б $$FD$t0ڹt$ t< uu$ŋD$hD$1 h^D$ $T$T$l$1;!E t9tz1;!1Åt)؉$D$‰ËD$HT$\$,$D$T$u&$[D$D$$9d,[^_]É\$$L \$$$ t&UWVSl$0U tF}~11ېG$$9G$<$E E[^_]Ã,T$0\$D$4t$ |$$ l$(֋l$88uUtu t1lL ue 1\$t$ |$$l$(,Ð ݍt&l$8\$D$4t$ T$0|$$l$(,T$$ |T$D$$x hS\$ D$8D$6 $\tCt7U  DЋC T$$ DD$[Ív8 ʐS\$ $|tCl $֢ D‰D$[Ív't$D$$t$ \$D$4$Í@v7! F L$$F D‰D$Q؋t$\$Ív$X  뿐$/ 4t& 말 럐UWVSd D$`@ɉL$bʉ|$(<$3|$3|$ ݋\$Dl$ |$\|$<3|$41ߋ\$1lj|$4t$4|$\3bʋ\$,4$3\$813t$$|$$t$ t$H11É\$8\$ t$8\$$3bʉt$$t$1t$$3\$\\$$\$\\$\\$@3\$<3\$X3\$(Íbʋt$$l$\13l$ l$b΋L$$3L$ 3L$<L$@L$T3L$Lt$<1ыT$@1ً\$  bӋT$$13T$,ڋ\$,T$ T$D3T$P1‹D$ 1l$$bʉl$$ʼn13D$@ŋD$@D$@D$H3D$T3D$(1bʋt$ NjD$@13D$ |$@D$,D$X3D$D3D$41ȋL$,bD$@11ȉl$D$(D$03D$H3D$8=bʋ\$(1Љ͋T$,13l$,ËD$`X\$`D$(t$ D$T$L$C SKsd[^_]É'D$@@#Eg@ @ܺ@vT2@Ít&'U1WVS,\$@l$HL$D3{L$?StG@)9FS2T$|$L$$?T$t ,[^_]Ð)|$[?v/t$؃@@A?wL$E?L@L$tL$l$H\$@L$D,[^_]t&<\$,\$D|$4l$8t$0t$@;kD$ $ȉD$ȉD$7)?D$D$D$D$$1Tʉu\$,t$0|$4l$8<Ð,|$$|$4\$t$ t$8l$(l$0<$tF9Ct$|$,$%D5؋t$ \$|$$l$(,Ð|D$D$$$D$1҅uD$ 1%=@‰Ѓ| UWVSe$1$$DŽ$ 9; D$\$$=} D$$$ 1tC$u$$D$$ $ D$$W5 tI4$<$D=t|/t/|$$T<$D$,D$t$$utD$<%=ud D$D$ $2= ) l$  $uf $e3Ĝ[^_]Í& D$/$tF$@ǡ O$$]t\$$% mt&$ǡ V$H E $ D$ $ D$|$t$$٣ D$$ ^\$D$<$m 躭v'VS$;/D$$ $C tD$ $  !%tDJDA  \$D$ D$D$ D$D$$=[^ÐD$ D$D$ $$D$t$$/$$3T$$3D$ $$3T$|3D$x D$t$$ / Dt&D$\$$x=\$D$<$m իt&$p WVd* S\$ C18D1 <$D$tu1[^_ÍD$$4$ $D$1[^_Í D$ ҉D$t $ $̥ ,D$ ` L$D$T$D$P D$$,Ð&VS$(u$$`趻$$P,(u<uG1҃9rtft[^Ðt&Htvf묍vVS04u0$00P 84u<uG1҃9rtft[^Ðt&Htvf묍vWS<@u<$V¡<ף<B00D@u4u<1tft[_Íz/tf뷍t&'WSHLuH$覹¡HףHB$$PLu4u<1tft[_Íz#tf뷍t&'WSTXuT$¡TףTB00\Xu4u<1tft[_Íz/tf뷍t&' ,!  R 48s  D"  R Pq   S8-t9&9t4QӀv_tQЀ vQvكAvѸ[f1[Ít&UWVS@$UtW11U4Ft31ېTi ttY tw t$;^rЃ4$;}r,$[^_]Í&'U1WVS,҉D$T$D$t<Ӎ& 19uЉ)‰T$T$`t@D$ft29ku|$s 98uڀ| uӃ,[^_]ÐT$1ۋD$iuD$ $VL$T$L$T$Í@ $T$L$k`D `dCdD$h$5ShЉ@w ,[^_]Í&UWVSӃlD$ $D$.D$4$(T$8D$</BD$8D$E*JFdl$DL$$D$,$D$DD$\$t$ |$D$> $E&L$$T$DD$$L$"t& $L$$L$$l$D,$<L$$t$t $T$,t$ |$$ T$D$̋&+rT$4\[^_]ÍD$D$`T$,\$t$$Ĩ T$ 耊t$t$$\$\$ 4$衪t$D$ ؋\$&UWVSLD$Zt$ l$4XZXZ X ZXJ1ۉHBD$B4$D$vl$4$xt#D$<%=@t'l$4$xu݋D$L[^_]ÍD$4$Tnt5D$8T$D$D$$T$3sf$D$nT$빍UWVS<D$ED$,T$ D$$u ]t&D$$T$ B:uT$ t$(D$$N|$ D$ t$<$ÉD$,,\$(9D$ t$$ ;\$(D$$T$  tD$$T$  uދ\$,T$ D$$3x4 KJKJK J KRS\$,D$ l$$GCD$$ C ~U1"D$,T$t$$iT$9t/T$$t$ D$ ~uȍD$,$L<1[^_]fD$,9xuT$ L$T$$U<[^_]$H 肇fUWVS\$0|$4u.)$~D$/<$苣u<$Wsk $xI<D$~C $\S CD$DD$$k[^_]VS1ۃt$ tGxAF$0t2F~)0&9^~ F $u1ۃ[^f[^ÍvUWVSuktl$ D$N D$$ǜlj\$,t$0|$4l$8<ÍvL$T$ D$N D$$茜L$wt&D$ 3 D$N D$$\n'UWVS\T$tD$W T$T$p$詣\$tT$pt$tD$4D$UM E$Pk] څU$t kE D$E$kCE kE @뛍&<\$,á< t$0։|$4|$Dl$8l$@D @ ,$L$Bl$$< D$B $&\$$< D$& L$t$D$ $< L$薌<$|$$< D$ D \$,t$0|$4D$@l$8<5L$D$$< p< L$+D$ D$&D$t $} t&'UWXVSe5$|1$D$@T$PƉ$\$`l$`D$|󦋕p|ۉ$(x8 _6 D E‹tD$tb6 \$pE‰D$x$D$@P D$|$XD$dD$T$XT$TD$hD$89T$Ts$D$T1ۉ1Ҁ8 ƒ9u\$8\$htD$T| t\$h\$8\$h\$8D$\$4$ʃt$T1ҋL$hD$Lp $@@9v싴$X\$T9\$TsED$T19v3x ukl$LH+M 9|$8Mvkl$LD 9wͅt%D$T|0 tD$8T$TkD$L+P PD$T$LD$$HD$4D$P$T$L\$Pt$8B1؃A49s|$PD$X}\$8D$@D$4\$\D$H$\$41t$4T$4|$@)\ t$D\$<t&;D$4Gt$1Ҩ¨l\$0 kt$@؋$8 $$<΍t&$0D$TDŽ$D$ D$; T$T$,$^2L$T $|$$T$(D$0T$DT$(D$ T$HT$ B1;T$$$6uҡ,Ep4$yT$ ;Buz9uET$ L$H+L$D0\ S s XZXZX Z @BT$$L$ R4Q(@ A$t&T$ ҉T$ T$ Bۀ|$O$@ $q$@@@  $@D$$||$0tD$0؋$Pvu[^_]Ë\$0t"Ct$@؋$8}uދ$@ $@D$$|q'UWVS,\$@$m@1҉Ƌ@$tf@u$1&hv$t6t&>O:yzyzy z IJvuыT$Hl$$D$T$T$DT$ ,[^_]ÐP6 w$ t&vÍf6 1ttڃtӡ6 DÍv1Ðt&6 SÃt1C SSS[Í$ $( ӹ$08 ¹$> 豹$9 蠹D$$2 }jRvUWVSÃD$u Lt&tD$;$C$uv.D ljuKC$r$t_:tut&D$[^_]Ít&tK$$t= $u$t" t-u붍D$[v$D$Kv$@UWVS1Ƀ 9rtftһu?Vf tct&wQwu>t F9sL uF9r#|t([^_]Í&FfFf< uƒF [n^_]ÍYf'f&ƒ i $t$|$t(0Y tt`( ְ8u$t$|$ Ít&ֿA $t$|$( ø볍&'VS=i tBt>=Y t7u v[t4$D$?xu[^Í&1ۃ[^Í4$1|$t>lu!~fu~u4$|$Ðt&( 4$|$Ít&'UWVS,D$@D$G D$D$DD$D$$UD$D$.$uoD$D$9D$l$|$)t(t&3|$l$4$"vu<>t<[uD$$d|$,$CcCfD$O tIV t,1[^_]Í&D$ \$@D$HD$D$D,[^_]%st&D$\$@D$HD$D$D,[^_]r'||$t$t$p1\$lÉl$x$D$TD$XD$\ttg1D(rD$D1L$HL$T$DD$(5 D$,D$4|$L\$P$oD$($?L$t&\$lt$p|$tl$x|fD$4\$TfL$$D$D$4$qulD$($0BuDt/t$TMUEut$XL$TT$Xut$\D$\u$dt&|$1$\ fPۍt&|$1$ NP뀍t&|$f1$ 5PTUWVS|$t$\D$hl$PD$lD$PC D$T4$D$XtD$D$\D$`D$dtD$@N D$DD$HD$LdD$dD$! D$DD$@D$ C,$D$4$t$D$X D$h1D$hD$$D$8@D$$4$D$(=3uYCD$D$D$$$cNjD$$$ouNxJ4$1D$lD$$@D$\|$T#ƋD$dxD$3D$,D$4tvt$,D$3i T$NT$D$<;Z$L$ L$k+D$! $L$D$t$$t$vL$D$$4$L$ph)D$D$t$)l$ $}t$|$v"D uC<$<:tJf댍t&D$3D$,D$4D$$1|$3Z$KfD$sD$$4$D$oy)ЃD$D$ 4$T$8ogD$8D$ $D$ot W9:D$ o)D$ vl$kL$D$D$  $R$$T$D$($D$+L$D$D$  $JfL$D$\$L$$D$<$ iT$|$3JZL$D$$t|$4|$4ED$$D$$D$1tD$$t~ tT$JZL$D$,T$L$D$D$($1 $e3 Ĭ[^_]ËFHD$$&D$$mvT$؍L$p D$xgT$|9[|$$:l$tDt&4$_늍$$$$$$D$t$<$t"؋$$$ČÍt&D$D$t$$|Yx,D$X<$D$xD$`D$|D$xD$H]H떻돐UWVS$D$lD$pD$t%D$@0uED$@҉D$@E‰D$<1ҍ,]s4ftl}|$04ft\@tNtF@t8t0KD$0L$DHT$,L$L$D $aT$,tvT$,$E$L$ll$ $T$,9F$}ZD$lD$pD$tČ[^_]Ív8uJC6t|$0G6t[T$,D$$T$,u؋]0`L$D19D$PuD$,1D$P 5D$($PF!t$XD$(_ t$\D$,gЋQ S\$L$ CQ9t)[ÐC+A[UWVS,e$11\$D$l$$ZR|$to4$D$/$dNtL|$tBD$\$0$Uu‹$e3u$,[^_]Ðt&9fR UWVSu Ĝ[^_]f@$BAǡ1ۉ~0^@@F 9D$ S D$ D$<$K5~1t& 9u<$NĜ[^_]Ë$D$$TLD$0D$\$$3SK|$`t$\|~$& 6/D$D$\$D$ D$t$$(T$D$$P|$$t$$1D$(Չ|$,D$$19sL&9s uP; t9u#t tt; vu>9rtP|$(u_|$,D&C9w܍&)L$$T$ ?T$ 륉=<$&?D$(3$OD$T$ D$D$$JC\$0t$4|$8<Ít&+t\$0t$4|$8<Ít&'$0\$|É$$f~4L$,6T$(4$t$ōD$TD$,$ sT$(f~4D$XT$(4$誽t$ǍD$\D$<$t$TL$\T$(D$`<D$l1D4rT$dT$,D$hD$4$D$ W D$8D$4D$D$lD$D$dD$ D$\D$D$T$_t$ht D$T$Jt T$\${J\$|$$$ČÐt&s1D$TD$Xf~4t$T11D$\D$`1tD$LD$ CD$D$@$D$H:D$LD$ D$D$@$D$KH1҅‰UWVS\e$L1|$ D$BD$@T$D$DD$HD$<$IT$?1B8BD$j 1ۅd<$E$ID$@D$DD$H$Le3\[^_]Ð4$x9~44$muًL$,$tōD$@t$$뻍v9~?$'t ލL$؉,$Pۍ 1ۡ$9L\$LD$ \$|$$K<$D\$$ O) UWVSLD$(l$`T$,D$$D$(P$X<11;uI&;D$8tbD$D$8D$ ~D$\$,$Eu D$<À;uD$($JL[^_]ÃL1[^_]Ít&{t҃듐t&1u‰))ʍ0tD$,T$t$ $D$T$$IT$$uD$ c D$D$% $8 E&'UW1VSӁ\,$e$L1HD$@D$DD$HD$؃D$19~&fx4uxCfx49څ~"1ېt&$u;|D$$ED$@D$DD$HA&Sfz4t$.qvL$<$t$Le3c\[^_]Í&1&SCfx4un$;52fx4t΋Sfz4t<$u‰<$L$L$D$C<$9D$u땍vL$<$tD$@\$$vs<$L$L$D$C<$9D$t&|$ D$l$<$D\$LD$ \$|$$G<$@\$$I d%t&D$ $@Gv'D$P8u @$1҉$ټ$$߬$$ t$0f$٬$ۜ$٬$$fl$PD$jU )x\$pl$|$$FD$tD$ _ D$ \$$/T$pD$t$|$8tfD$t$2|$@D$l!D$ D$2$ D$C$T$pD$t$.\$ D$ $fD$PD$ \$ D$,$躦D$ &D$,$萦fD$P|t&D$,$h[UWVS<|$Tt$P|$TbT$TD$@dvw 9rD$ d$ T$ T$,D$ $5D$( l$ D$$l$/T$ D$$/\$l$(D$$\$Pr|v1  3 u9L$$St8UT$,M!ʋL$(ы9}) 9\$Pwt$$랍l$9\$PUv\$ tc1t&,@vKT$(D$@)l$@1ҍv4*م~!t&@IVڍTqsYu̓;|$ u$/\$ T$4S4$3T$P,L$,0PT$TH L$ P1tCl$$l$(1DTtt&X Z@u;t$ uӋl$$)L$ 9D$Tu\D$($J/<[^_]ø/D$<1[^_]D$,D$ D$($.1D$ D$$D$ $Ȯ .v'.t&'T$1tfUWVS\\$xt$tME$D$K$ w |$KZD$0 L$0 $32D$4|$p1ɸWv|$4t&ЃȀwAl$4T vуɀ wL$4|$pl$p\$@D$|$D}9މ|$<r11ҋl$4 &w,߃D  3 9t$@w9t$@L$T$8$$D$D$(#L$L&|$JF|$p 1\$,D$, É3 #G |D9T$@ʼnt$$)T$ 9}9_ut$^8\ euً\$L$(|$L$(|$(l$(L$ L$(|$$l$L$,l$4B)ȉLD$4$v(D$4D$4\[^_]À|$KOD$8T$9$"D$KbL$8T$D$,D$$D$ D$iL$8T$ T$(l$ρT$$T$(T$,T$-L$(\$|$D$,D$$D$ D$L$(l$(|$NjD$(\$l$l$(%D$ D$(l$$%D$,D$4D$4\[^_]ÐWVSD$\$Ht'01҉1f;t9F׋Du[^_1vUWVS,D$HT$Hl$@89BsVD$H1ҋH;(t,9s2XuT$D(PD$H@,[1^_]Ã,[^_]Ðt&1뷋B\0\$$D$T$HBBtwD$|$D$l$ǐt&ot=D$H1ҋp;t"9w1ҍփxuT$HhBD$T$9T$ul$D$$%T$H:'UWVSD$08h1t011DtT$8$T$T$4x ƃ9u܉[^_]fS\$ C$I%CC[Ð1Í'WVS1ۃt&r 4$$t4uރf[^_É'\t$TƉ\$PeD$L1|$Xt t"T$Le3\$Pt$T|$X\Ð |$8|$ D$CD$C $^uSD$,$$^;$VT$D$D$ D$@D$> $zD$|$$ƜD$,FFC'UWV1SÃL$T$4L$<%ۉD$0ttD$48CQD$8*,vE9D$0T$4|*/ f{T$4|$4lv*t&/ujKfx^$P$D$,D$H:D$,@@SVSU9T$0wƋ\$0D$/)l$4\$,$( D$<D$l$\$ D$D$> 4$D$`D$4$D$;D$8L[^_]Í&D$4S8Px/S8Px/vi+T$49T$0Y8SM뻉ސD$ ں D$D$ $( !D$ ں D$D$ $<  D$ D$D$ $l  UWVSZu Dt&t$<$X(/uېt&{uߍC K$EDtۃ[^_]É]1[^_]Ít&'\$\$,t$t$ $t$ѩu t$$葨1\$t$Ív\$\$ t$t$,$Zu$%X1\$t$Í&'\$\$(t$t$,|$$"|/tE;wMuD$$ډ$<1҅‰Ћ\$t$|$Ívf@D$ ʺ D$D$ $3   WVSӃ$P`w]1Ʉۺt=t&YB/Z9uL?ȉD$$![^_D$ D$"D$ $L fv'VSD$ \$$04$ t$$D$ɗ$D$yCS PSSD1[^É'\\$Lt$P։|$TXD$l$XD$,D$0D$4t18u\$Lt$P|$Tl$X\Í&D$8D$D$D$,$$le3uN|[^_]1D$  D$D$ $e $Y$ D$lUWVSكLD$(|$dT$,D$`L$3\$4u 9\$,D$$D$8؃@D$ D$3D$19rtft[tf뵍UxWVSZ9}=3L$ ‹l$RL$H|$3|$$1 t;L$~9|$\ 1<[^_]fjrT$Dm$L$y$D$ C~dt$NItT$ 1|$, \$(vBB 9˅y݋qΉZ2Ӆ~'T$ 1BB 9uߋT$ Dmt$ FV AD$ QD$ D$ l$$[\$ s\$(|$,$8 &'WVS5t4= ~fD$9u<$[^_Ð $` $$$$`Ít&'S\$ $[k\$ [&'W 1T$ L$ D$T$ D$T$$<Ĩ_Ð&1T$ t$t t3u 1ÍcuxauxtuxDאuD$$pu$x ju( 뙍v$]$YtT |@@D`Dh$~  ts@ $`ut Ðt&hD$$$u;h$"$ *j$ YfxH 끍t&hD$$?뮐 @tf$ H1tT$$ dUWVS,D$D$D$D$D$D$D$$=D$$, \\$LË@l$XՉt$P|$TtZ1t6Cu,CD$CC\$Lt$P|$Tl$X\fST$t$,!+sL$(+K ;)сkw\$G)ڍDT$t$$>"t&D@0D$$떐t& |$|$ \$t$tetrD$ ` T$4$D$0x,4uΉ<$*$ D$v\$t$|$Ít&D$$p DGkUWVS$$$;$Q$K}E;$}<4949$$9~4949;$uK$19$J R~$9u1Ĭ[^_]Ël$<$;$$)t$h+$)\$|$+$D$x$DŽ$)ރ\$l$$t$hDŽ$D$tl$D,t$l$|$pt$X$t$Tt$hD$ct$P\$P9\$xt$\$|$\9|$|\$PD$|$\DD$\9D$P$$$D$<\\$@D$Lt$dl$@]Es9MƉƉ+t$<9;D$d,9,D$Hu2D$Hl$df9}9u 9|D$Hl$d)ʼnl$H$D$H9EMl$LD$@l$Ll$T9l$D$Hl$XD$Tl$D|$p$|$$l$$T$8L$$$D$ t$|$ L$$\$,$L$@T$8$$$T$ $L$$$|$$t$$l$\$<$t$T$L$ Ĭ[^_]Ë$\$<$T$H$:D$Ls$$t$0|$4$$t$@zl$D1ҋ|$p$$l$D1|$p$$$L$DP t9t$ 3DP t9넍t&|$ ;|$4}05L$0t$ t$4v9DB &9ut$ 9f3DB t9u19[^_]Í&3D$ :T$ L$4ߋt$09‰Ǹ8[^_]D$@7T$0t$49} 8 u9|vUWVS,l$HL$@|$D1u69r19t < uL$@؉1,[^_]Ív9s tވT$ T$ L$l$L$\$Őt&DE #HD]  ЍP9w܋\$\$L$t|9tBL$&19uL$&D$D$1T$9vQP @\$&\$ Ʌhƍ&L$L$t$ 뫋\$t&'L$v"09v ҃vDÍ&'UWVST$ō.$L$$l$. h.1E‹T$ J`D$D$ $)L[^_]Ðt&`L$.D$|$L$q|$0l$. .L$ Q0D$ L$ no longer supported.cannot simplify commit %s (because of %s)cannot simplify commit %s (invalid %s)bad tree compare for commit %sreflog of '%s' references pruned commitsInvalid symmetric difference expression %s...%soptions not supported in --stdin modecannot combine --reverse with --walk-reflogscannot combine --parents and --childrencannot combine --reverse with --graphcannot combine --walk-reflogs with --graph--ancestry-path given but there are no bottom commitsFailed to traverse parents of commit %sFailed to simplify parents of commit %s%s:%shttp.sslverifyhttp.sslcerthttp.sslkeyhttp.sslcapathhttp.sslcainfohttp.sslcertpasswordprotectedhttp.minsessionshttp.maxrequestshttp.lowspeedlimithttp.lowspeedtimehttp.noepsvhttp.proxyhttp.postbufferhttp.useragentgit/1.7.5.4Pragma: no-cachePragma:GIT_HTTP_MAX_REQUESTSGIT_SSL_NO_VERIFYGIT_SSL_CERTGIT_SSL_KEYGIT_SSL_CAPATHGIT_SSL_CAINFOGIT_HTTP_USER_AGENTGIT_HTTP_LOW_SPEED_LIMITGIT_HTTP_LOW_SPEED_TIMEGIT_CURL_FTP_NO_EPSVhttps://Certificate Password: GIT_CURL_VERBOSERange: bytes=%ld-strbuf.hlen < sb->allocUsername: objects/%.*s/%s while accessing %s ref: %%%02xobjects/info/packs pack-.pack Getting index for pack %s objects/pack/pack-%s.idx%s.tempUnable to open local file %sUnable to get pack index %s index-pack-oobjects/pack/pack-%s.pack%s.prevfd leakage in start: %dError creating curl multi handle. GIT_SSL_CERT_PASSWORD_PROTECTEDReceived DONE message for unknown request! Unknown CURL message received: %d Unable to start HTTP request for %sUnable to open local file %s for packResuming fetch of pack %s at byte %ld Couldn't create temporary file %s: %sCouldn't truncate temporary file %s: %sResuming fetch of object %s at byte %ld requested range invalid; we may already have all the data.strbuf_setlen.multistatus.response.propstat.prop.supportedlock.lockentry.multistatus.response.propstat.prop.supportedlock.lockentry.locktype.write.multistatus.response.propstat.prop.supportedlock.lockentry.lockscope.exclusive.prop.lockdiscovery.activelock.owner.href.prop.lockdiscovery.activelock.timeout.prop.lockdiscovery.activelock.locktoken.hrefCouldn't get %s for remote symref %s Unable to start PROPFIND request Parsed path '%s' does not match url: '%s' .multistatus.response.propstat.prop.resourcetype.collectionUnable to fetch ref %s from %s Unable to parse object %s for remote ref %s Unable to create branch path %s Unable to start MKCOL request mailto:%s Unable to refresh lock for %s MKCOL %s failed, aborting (%d/%ld) PUT %s failed, aborting (%d/%ld) MOVE %s failed, aborting (%d/%ld) Unable to fetch %s, will not be able to update server info refs Unable to start UNLOCK request More than one remote branch matches %sRemote branch %s is the current HEADRemote HEAD resolves to object %s which does not exist locally, perhaps you need to fetch?Unable to resolve remote branch %sRemote branch %s resolves to object %s which does not exist locally, perhaps you need to fetch?DELETE request failed (%d/%ld) Unable to start DELETE requestThe branch '%s' is not an ancestor of your current HEAD. If you are sure you want to delete it, run: 'git http-push -D %s %s'You must specify only one branch name when deleting a remote branch Cannot access URL %s, return code %dUnable to start PROPFIND request on %scannot lock existing info/refsUnable to delete remote branch %s No refs in common and none specified; doing nothing. remote '%s' is not an ancestor of local '%s'. Maybe you are not up-to-date and need to pull first?Unable to lock remote branch %s unknown pending object %s (%s)PUT error: curl result=%d, HTTP code=%ld Second-bad tree object %sDepth: 1Content-Type: text/xmlPROPFINDXML error: %s .multistatus.response.multistatus.response.href%s %s %s %s^{} %s %lu1.2.3.4Destination: PUTUnable to start GET request MKCOL"<>&"<>&Timeout: Second-%ldUnable to start LOCK request If: (<%s>)Lock-Token: <%s> fetch %s for %s MOVEOverwrite: T sent %s Fetching pack %s which contains %s Unable to get pack file %s %sUNLOCKUNLOCK HTTP error %ld Removing remote locks... No remote branch matches %sRemote HEAD is not a symrefRemote HEAD symrefs too deepUnable to resolve remote HEADRemoving remote branch '%s' DELETEok--force--dry-run--helper-status--verboseDepth: 0no DAV locking support on %sinfo/refsGetting pack list Fetching remote heads... error %s cannot remove error null no matchCould not remove %sok %s '%s': up-to-date ok %s up to date error %s non-fast forward updating '%s' using '%s' from %s to %s error %s lock error ^%srevision walk setup failed sending %d objects Unable to start PUT request done Updating remote server info Unable to update server info git http-push [--all] [--dry-run] [--force] [--verbose] [...] 0123456789abcdefstrbuf_setlenObject %s is a %s, not a blobObject %s is a %s, not a commitbad graft data: %sduplicate graft data: %sshallow %stree bogus commit object %sbad tree pointer in commit %sbad parents in commit %sparent Could not read %sObject %s not a commitnot yettree %s parent %s author %s committer %s encoding %s Warning: commit message does not conform to UTF-8. You may want to amend it after fixing the message, or set the config variable i18n.commitencoding to the encoding your project uses. bad config value for '%s' in %sbogus format in GIT_CONFIG_PARAMETERSkey does not contain a section: %skey does not contain variable name: %scould not lock config file %s: %scould not commit config file %sfailed to write new configuration file %sFailed to expand user dir in: '%s'core.autocrlf=input conflicts with core.eol=crlfInvalid mode for object creation: %sMust be one of nothing, matching, tracking or current.bad config value for '%s'%s has multiple valuestoo many matches for %syesfalseoff[%.*s ""] [%.*s] %.*s = %s\n\tGIT_CONFIG_PARAMETERSbogus config parameter: %sbad config file line %d in %s/etc/gitconfigGIT_CONFIG_NOSYSTEMHOME%s/.gitconfiginvalid key: %sinvalid key (newline): %sopening %s: %sinvalid pattern: %sinvalid config file %sCannot handle files this bigcould not lock config file %srbMissing value for '%s'core.core.filemodecore.trustctimecore.quotepathcore.symlinkscore.ignorecasecore.barecore.ignorestatcore.prefersymlinkrefscore.logallrefupdatescore.warnambiguousrefscore.abbrevcore.loosecompressionbad zlib compression level %dcore.compressioncore.packedgitwindowsizecore.bigfilethresholdcore.packedgitlimitcore.deltabasecachelimitcore.autocrlfinputcore.safecrlfwarncore.eolnativecore.notesrefcore.pagercore.editorcore.askpasscore.excludesfilecore.whitespacecore.fsyncobjectfilescore.preloadindexcore.createobjectrenamecore.sparsecheckoutuser.user.nameuser.emaili18n.i18n.commitencodingi18n.logoutputencodingbranch.branch.autosetupmergebranch.autosetuprebaseneverlocalMalformed value for %spush.push.defaultnothingmatchingupstreamtrackingcurrentMalformed value for %s: %smailmap.mailmap.fileadvice.pager.colorcolor.pagerstrbuf_setlencore.gitproxy for ERR remote error: %s.have-P-pgit+sshssh+gitI don't handle protocol '%s'GIT_PROXY_COMMAND9418cannot start proxy %sLooking up %s ... %s[%d: %s]: errno=%s done. %s %s%chost=%s%ccommand line too longGIT_SSHtortoiseplink-batchunable to forkGIT_ASKPASSSSH_ASKPASSCould not read passwordprotocol error: expected sha/ref, got '%s'No path specified. See 'man git-pull' for valid url syntaxUnable to look up %s (port %s) (%s)done. Connecting to %s (port %s) ... unable to connect a socket (%s)failed to read password from %s strbuf_setlen%lu %c%02d%02dyesterdaysecondslastmonthsyearsin the future%lu seconds ago%lu minutes ago%lu hours ago%lu days ago%lu weeks ago%lu months ago%lu year%s, %lu month%s ago%lu years ago%lu %+05d%04d-%02d-%02dPMAMiso8601rfc2822shortunknown date format %sJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberSundaysMondaysTuesdaysWednesdaysThursdaysFridaysSaturdaysIDLWCATHSTHDTYSTYDTPSTPDTMSTMDTCSTCDTEDTWATGMTUTCWETBSTCETMETMEWTMESTCESTMESZFWTFSTEETEESTWASTWADTCCTJSTEASTEADTGSTNZTNZSTNZDTIDLEnoonmidnightteanowminuteshoursweekszerotwothreefourfivesixseveneightnineten%04d-%02d-%02d %02d:%02d:%02d %+05d%.3s, %d %.3s %d %02d:%02d:%02d %+05d%.3s %.3s %d %02d:%02d:%02d %d%c%+05d- - . .  . . . . !. +. 3. <. E. M. U. ^. i. s. {. ;Zx0N.  . . . . . . . . . . . . . / / . . . . . . . . . . . . . . . . . / /  /  /  /  /  /  /  $/  )/  , ./ 03/  %06o%ccannot hash %s%sdelta %lu %sliteral %lu @@ -XXXXXX_unable to create temp-fileunable to write temp-file => %s %s (%d%%) %s%s--- %s%s%s %s%s+++ %s%s%s ~ diff.renamelimitdiff.color.color.diff.plainmetafragnewfuncdiff.suppressblankemptydiff.suppress-blank-emptysubmodule.diff.colorcolor.diffdiff.renamescopydiff.autorefreshindexdiff.mnemonicprefixdiff.noprefixdiff.externaldiff.wordregexdiff.ignoresubmodulestextconv/%s-dirtySubproject commit %s%s unable to read %sstat(%s)readlink(%s)cannot read data blob for %sunable to read files to diffa/b/--patchunified--raw--patch-with-raw--numstat--shortstatdirstat--cumulativedirstat-by-file--check--summary--patch-with-stat--name-only--name-status--stat-name-width-B--break-rewrites=--break-rewritesinvalid argument to -B: %s-M--find-renames=--find-renamesinvalid argument to -M: %s-C--find-copies=--find-copiesinvalid argument to -C: %s--no-renames--relative--relative=--ignore-all-space--ignore-space-change--ignore-space-at-eol--patience--binary--full-index--text--find-copies-harder--follow--color--color=--no-color--color-words--color-words=--word-diff--word-diff=bad --word-diff argument: %sword-diff-regex--exit-code--quiet--ext-diff--no-ext-diff--textconv--no-textconv--ignore-submodules--ignore-submodules=--submodule--submodule=--pickaxe-all--pickaxe-regexdiff-filtersrc-prefixdst-prefix--no-prefixinter-hunk-contextCould not open '%s'%s%.*s%s...internal diff status error%s%ssimilarity index %d%%%s %s%scopy from %s %s%scopy to %s %s%srename from %s %s%srename to %s%sindex %s..%s%sdiff --git %s %s%s %s%snew file mode %06o%s %s%sdeleted file mode %06o%s %s%sold mode %06o%s %s%snew mode %06o%s + @@%s %sGIT binary patch GIT_DIFF_OPTS--unified=-u* Unmerged path %s GIT_EXTERNAL_DIFF:%06o %06o %s %c%03d%c%c%c- - %llu %llu %s%-*s | Bin %s%llu%s -> Unmerged %5llu%sdeletecreate%s rewrite Could not open /dev/null{++}[--]%s%s:%d: leftover conflict marker internal error in diff-resolve-rename-copyinternal error: asking to populate invalid file.error while reading from stdin %sBUG: diff is failing to clean up its tempfiles--name-only, --name-status, --check and -s are mutually exclusiveOption '--%s' requires a valueOption '--stat-width' requires a valueOption '--stat-name-width' requires a valueoption `color' expects "always", "auto", or "never"diff--gita/%.*sb/%.*snewfilemode%06o---/dev/null+++b/%.*sdiff--gita/%.*sb/%.*sdeletedfilemode%06o---a/%.*s+++/dev/nulldiff--gita/%.*sb/%.*s---a/%.*s+++b/%.*sfeeding unmodified %s to diffcoreerror reading from textconv command '%s'%s%sdissimilarity index %d%%%s external diff died, stopping at %s. %s%s--- %s%s%s %s%s+++ %s%s%s %s%s@@ -%sBinary files %s and %s differ Invalid regular expression: %s %d files changed, %d insertions(+), %d deletions(-) ------------only found copies from modified paths due to too many files.inexact rename detection was skipped due to too many files.you may want to set your %s variable to at least %d and retry the command.emit_line_0strbuf_setlen@@diff_words_showfn_out_diff_words_aux`jG*?[{\oops in prep_exclude.gitignoreinfo/excludecannot use %s as an exclude filecan't find the current directorystrbuf_setlenGIT_DIRGIT_OBJECT_DIRECTORY%s/objectsGIT_INDEX_FILE%s/indexGIT_GRAFT_FILEinfo/graftsGIT_NO_REPLACE_OBJECTS%s/%s%s/pack/pack-%s.keepCould not set GIT_DIR to '%s'UTF-8GIT_CONFIGGIT_WORK_TREEinternal error: work tree has already been set Current worktree: %s New worktree: %sGIT_ALTERNATE_OBJECT_DIRECTORIESB ,B % A {A 7B A A A /usrGIT_EXEC_PATH/usr/lib/git-core/usr/bin:/bintrace: exec:trace: exec failed: %s too many args to run %s%*sgraph.cgraph->num_parents >= 3graph->revs->boundarypar_columntarget * 2 <= igraph->new_mapping[i] == -1graph->new_mapping[i - 2] < 00 <= graph->expansion_row && graph->expansion_row < num_expansion_rowsgraph->new_mapping[i - 1] > targetgraph->new_mapping[i - 3] == targetr÷ӳdiff_output_prefix_callbackstrbuf_setlengraph_next_linegraph_output_pre_commit_linegraph_output_commit_chargraph_output_post_merge_linegraph_output_collapsing_linegrep.cregexp returned nonsenseNot a valid grep expressionunmatched parenthesisnot a pattern expression %sIn '%s' at %d, %s, %s'%s': %sBinary file matches bug: unknown header field %dbug: malformed header exprauthor committer p->field < (sizeof(header_field)/sizeof(header_field[0]))Unexpected node type (internal error) %d--not not followed by pattern expression--not followed by non pattern expression--and not followed by pattern expressionbug: unknown binary handling modebug: a non-header pattern in grep header list.incomplete pattern expression: %sH(pmatch_one_patternF F    0123456789abcdefYou don't exist. Go away!Your sysadmin must hate you!/etc/mailname(none)invalid date format: %s <GIT_AUTHOR_DATEGIT_AUTHOR_EMAILGIT_AUTHOR_NAMEGIT_COMMITTER_NAMEGIT_COMMITTER_EMAILGIT_COMMITTER_DATEunable to read /etc/mailname: %s empty ident %s <%s> not allowedImpossibly long personal identifierYour parents must have hated you! *** Please tell me who you are. Run git config --global user.email "you@example.com" git config --global user.name "Your Name" to set your account's default identity. Omit --global to set the identity only in this repository. bad tree objectbad blob objectstrbuf_setlenll-merge.coptsAmerge.defaultmerge.%s: lacks valuedriverrecursiveconflict-marker-sizebuilt-in binary mergebuilt-in 3-way text mergeunionbuilt-in union mergecustom merge driver %s lacks command line.Cannot merge binary files: %s (%s vs. %s) ll_union_mergell_xdl_mergell_binary_mergell_ext_mergeUnable to create '%s.lock': %s. If no other git process is currently running, this probably means a git process crashed in this repository earlier. Make sure no other git process is running and remove the file manually to continue.Unable to create '%s.lock': %scannot fix permission bits on %s%s: symlink too longcannot open '%s' for copyingrefs/headsrefs/remotesrefs/tagsrefs/stashremoteBranch ( %stag: %04d-%fSubject: References: attachmentinlineSubject: [%s %0*d/%d] Subject: [%s] Message-Id: <%s> In-Reply-To: <%s> %s<%s> commit (from %s)log size %i stdoutobject namesFrom %s Mon Sep 17 00:00:00 2001 %sMIME-Version: 1.0 Content-Type: multipart/mixed; boundary="%s%s" This is a multi-part message in MIME format. --%s%s Content-Type: text/plain; charset=UTF-8; format=fixed Content-Transfer-Encoding: 8bit --%s%s Content-Type: text/x-patch; name="%s" Content-Transfer-Encoding: 8bit Content-Disposition: %s; filename="%s" strbuf_setlenSigned-off-by: .mailmap# repo-abbrev:refs/notes/%supdate notes cacheinvalid object type "%s"sha1 mismatch %s object %s has unknown type id %d " s ! q packfile %s index not opened%s SHA1 checksum mismatchpacked %s from %s is corruptPackfile index for %s SHA1 mismatch%s SHA1 does not match its indexinternal error pack-check nth-packed-objectindex CRC mismatch for object %s from %s at offset %llucannot unpack %s from %s at offset %llu no-[=<%s>][<%s>][%s][=%s]cat <<\EOF usage: %s or: %s -%c--%s%s-NUM%*s%s switch `%c' %soption `no-%s' %soption `%s' %stakes no valueisn't availableexpects a numerical valueBUG: option '%s' %sBUG: switch '%c' %sshould not accept an argumenthelp-allhelpunknown switch `%c'%s malformed object name %sno such commit %sshould not happen, someone must be hit on the foreheadSTOP_AT_NON_OPTION and KEEP_UNKNOWN don't go togetheruses incompatible flags LASTARG_DEFAULT and OPTARGuses feature not supported for dashless optionsdid you mean `--%s` (with two dashes ?)Ambiguous option: %s (could be --%s%s or --%s%s)expects "always", "auto", or "never"x<`<;;;;<;; ;ref:.git/.gitstrbuf_setlenU . / ; read errorpacket: %12s%c PACKPACK ...\%o0123456789abcdefwrite error (disk full?)write error0000The remote end hung up unexpectedlyprotocol error: impossibly long lineprotocol error: bad line length character: %.4sprotocol error: bad line length %dGIT_TRACE_PACKET0123456789abcdefpretty.tformat:?= =?%s?q?=%02X?=mediumfullerfullinvalid --pretty format: %sFrom: %s: %.*s%.*s Date: %s %sDate: %s encoding --pretty formatredgreenblueresetbad parent line in commitMerge:AuthorCommitinvalid --pretty format: '%s' references an alias which points to itselfMIME-Version: 1.0 Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit e-}-}-}-}-}w-}1-}-}-}(-}-}-}-}-}-}-}-}-}-}-}-}-}-}-}-}-}Ƀׁ-}-}-}-}>-}-}-}-}-}zUTF-8strbuf_setlen../'\Too many or long arguments\f\r\viooooi¤̤֤/abtnvfr"\strbuf_setleninternal error: ce_mode is %oInvalid path '%s'unable to index file %sunable to add %s to indexadd '%s' unable to stat '%s'M %s U %s %s: needs update %s: needs merge index file open failedcannot stat the open indexunable to map index filebad signaturebad index versionbad index file sha1 signatureignoring %.4s extension index file corrupt%s: cannot drop to stage #0'%s' appears as both a file and as a directory%s: can only add regular files, symbolic links or git-directoriescannot create an empty blob in the object databaseWill not add file alias '%s' ('%s' already exists in index)index file smaller than expectedUnknown index entry format %08xindex uses %.4s extension, which we do not understand⛲CK)wZSrefs/%sCannot walk reflogs for %sNo current branch%s@{Reflog: %s (%s) Reflog message: %sDuplicated ref, and SHA1s don't match: %s%s does not point to a valid object!'%s' exists; cannot create '%s'cannot delete '%s' from packed refsthere are still refs under '%s'unable to resolve reference %s: %sunable to create directory for %sRef %s is at %s but expected %sThere are still logs under '%s'Trying to write ref %s with nonexistant object %sTrying to write non-commit object %s to branch %srefname %s is a symbolic ref, renaming it is not supportedunable to save current sha1 in %sunable to move logfile logs/%s to logs/refs/.tmp-renamed-log: %sunable to move logfile logs/refs/.tmp-renamed-log to logs/%s: %sunable to write current sha1 into %sunable to lock %s for rollbackunable to restore logfile %s from %s: %sunable to restore logfile %s from logs/refs/.tmp-renamed-log: %sno symlink - falling back to symbolic ref Unable to fix permissions on %sLog %s unexpectedly ended on %s.invalid rule in ref_rev_parse_rules: %sDuplicated ref: %s peeled packed-refstoo long a refname '%s'bad ref for %srefs/replace/Can't verify ref %sUnable to append to %s: %s%s %s %s Unable to append to %sCouldn't write %sCouldn't set %sreflog for %s is a symlinkrefname %s not foundunable to lock %slogs/refs/.tmp-renamed-logunable to delete old %sDirectory not empty: %sunable to delete existing %sDirectory not empty: logs/%sunable to lock %s for updateref: %s refname too long: %s%s.lockUnable to open %s for writingUnable to write to %sUnable to create %sUnable to read log '%s'Log %s is empty.Log %s is corrupt.Log %s has gap after %s.Cannot lock the ref '%s'.Cannot update the ref '%s'.refs/%.*srefs/heads/%.*srefs/tags/%.*srefs/remotes/%.*srefs/remotes/%.*s/HEAD# pack-refs with:RENAMED-REFKey '%s' of pattern had no '*'Value '%s' of pattern has no '*'Config remote shorthand cannot begin with '/': %smore than one receivepack given, using the firstmore than one uploadpack given, using the firstfind_tracking: need either src or dstsrc refspec %s does not match any.src refspec %s matches more than one.%s cannot be resolved to branch.unable to push to unqualified destination: %s The destination refspec neither matches an existing ref on the remote nor begins with refs/, and we are unable to guess a prefix based on the source ref.dst refspec %s matches more than one.dst ref %s receives from more than one src.Didn't think it matches any more* Ignoring funny ref '%s' locallyYour branch is ahead of '%s' by %d commit%s. Your branch is behind '%s' by %d commit%s, and can be fast-forwarded. Your branch and '%s' have diverged, and have %d and %d different commit(s) each, respectively. .remote.mergeurl..insteadof.pushinsteadofremote..mirror.skipdefaultupdate.skipfetchall.url.pushurl.push.fetch.receivepack.uploadpack.tagopt--no-tags.vcsInvalid refspec '%s'originURL:Push:Pull:branches/%.*s:refs/heads/%sHEAD::refs/heads/masterremotes/%s%s tracks both %s and %s(delete)Couldn't find remote ref %srefs/tags/*strbuf_setlen%o%ccannot unmerge '%s'Index records invalid resolve-undo informationfatal: waitpid is confused (%s)%s died of signal %dcannot run %s: %swaitpid for %s failed: %scannot create pipe for %s: %strace: run_command:exec '%s': cd to '%s' failed|&;<>()$`\"' *?[#~=%-c%s "$@"cannot exec '%s'cannot fork() for %s: %sBUG: shell command is emptycannot create pipe: %scannot create thread: %spthread_join failedhooks/%sGIT_INDEX_FILE=%sToo long path: %.*s%s/configPlease upgrade Gitfailed to stat '%s%s%s''%s' is outside repositoryfailed to stat '%s'Error opening '%s'Error reading %sgitdir: Invalid gitfile format: %sNo path in gitfile: %sNot a git repository: %s'$%s' too bigNot a git repository: '%s'Could not chdir to '%s'Could not get directory '%s'Could not come back to cwdGIT_CEILING_DIRECTORIESCannot come back to cwdCannot change to '%s/..'umaskgroupworldeverybodycore.repositoryformatversioncore.sharedrepositorycore.worktreeExpected git repo version <= %d, found %dbad flag '%s' used after filenameambiguous argument '%s': unknown revision or path not in the working tree. Use '--' to separate paths from revisionsambiguous argument '%s': both revision and filename Use '--' to separate filenames from revisionsThis operation must be run in a work treecore.bare and core.worktree do not make senseUnable to read current working directoryGIT_DISCOVERY_ACROSS_FILESYSTEMNot a git repository (or any of the parent directories): %sNot a git repository (or any parent up to mount parent %s) Stopping at filesystem boundary (GIT_DISCOVERY_ACROSS_FILESYSTEM not set).Problem with core.sharedRepository filemode value (0%.3o). The owner of files must always have read and write permissions.BUG: assertion failed in binary searchcannot happen -- lo and hi are identicalofs %u lov %x, hiv %x, kyv %x assertion failure lo %u mi %u hi %u %sGIT_DEBUG_LOOKUPsha1-lookup.clov < hivlo %u hi %u rg %u mi %u sha1_entry_pos%s/pack/pack-1234567890123456789012345678901234567890.%sinsanely long object directory %spack_report: getpagesize() = %10llu pack_report: core.packedGitWindowSize = %10llu pack_report: core.packedGitLimit = %10llu pack_report: pack_used_ctr = %10u pack_report: pack_mmap_calls = %10u pack_report: pack_open_windows = %10u / %10u pack_report: pack_mapped = %10llu / %10llu index file %s is version %u and is not supported by this binary (try upgrading GIT to a newer version)wrong index v1 file size in %swrong index v2 file size in %spackfile %s not a regular filecannot determine file descriptor flagsfile %s is far too short to be a packfilepackfile %s is version %u and not supported (try upgrading GIT to a newer version)packfile %s claims to have %u objects while index indicates %u objectsend of packfile %s is unavailablepackfile %s signature is unavailablepackfile %s does not match index%s: ignoring alternate object stores, nesting too deep.%s: ignoring relative alternate object store %sobject directory %s does not exist; check .git/objects/info/alternates.could not close alternates filepack '%s' still has open windows to itpackfile %s cannot be accessedoffset beyond end of packfile (truncated pack?)packfile %s cannot be mapped: %sunable to open object pack directory: %s: %sgarbage at end of loose object '%s'delta data unpack-initial failed%02x%02x%02x... lo %u hi %u nr %u failed to validate delta base reference at offset %llu from %sfailed to read delta base object %s at offset %llu from %sfailed to unpack compressed delta at offset %llu from %sunknown object type %i at offset %llu in %sfailed to read object %s at offset %llu from %spack %s contains unknown object type %dpack %s contains bad delta base reference of type %sreplacement %s not found for %sloose object %s (stored in %s) is corruptpacked object %s (stored in %s) is corruptunable to write sha1 filename %s: %s unable to set permission to '%s'insufficient permission for adding an object to repository database %s unable to create temporary sha1 filename %s: %s unable to deflate new object %s (%d)deflateEnd on object %s failed (%d)confused by unstable object source data for %s%s: failed to insert into databaseOut of memory? mmap failedindex file %s is too smallnon-monotonic index %spackfile %s index unavailablecannot get RLIMIT_NOFILEpackfile %s size changedcannot set FD_CLOEXECfile %s is not a GIT packfileobjects/info/alternates%s/objects %s/packbad object headercorrupt loose object '%s'GIT_USE_LOOKUPlo %u hi %u rg %u mi %u I am totally screwedbad packed object CRC for %sfailed to apply deltaunable to find %sunable to unpack %s headerunable to parse %s headerfailed to read object %sobject file write error (%s)unable to write sha1 fileerror when closing sha1 filefailed utime() on %s: %scannot read sha1_file for %scorrupt commitcorrupt tagshort read %sopen("%s"): %sreadlink("%s"): %s%s: unsupported file type%s is not a valid object%s is not a valid '%s' object0123456789abcdef0123456789abcdefInvalid search pattern: %s%.2s%.2s/short SHA1 %.*s is ambiguous.checkout: moving from @{upstream}@{u}ignoring dangling symref %s.refname '%.*s' is ambiguous.Invalid object name '%s'.BUG: startup_info struct is not initialized.relative path syntax can't be used outside working tree.No upstream branch found for '%s'Log for '%.*s' only goes back to %s.Log for '%.*s' only has %d entries.%.*s: expected %s type, but the object dereferences to %s typePath '%s' is in the index, but not at stage %d. Did you mean ':%d:%s'?Path '%s' is in the index, but not '%s'. Did you mean ':%d:%s' aka ':%d:./%s'?Path '%s' exists on disk, but not in the index.Path '%s' does not exist (neither on disk nor in the index).Path '%s' exists on disk, but not in '%s'.Path '%s' exists, but not '%s'. Did you mean '%s:%s' aka '%s:./%s'?Path '%s' does not exist in '%s'strbuf_setlenshallowbad shallow line: %sinvalid commitBUG: signal out of range: %dyou want to use way too much memory`pos' is too far after the end of the buffer`pos + len' is too far after the end of the bufferBUG: your vsnprintf is broken (returned %d)BUG: your vsnprintf is broken (insatiable)strbuf_setlen%s:%p %h: %m %srev-list%s/.git/objects//.gitmodulesuntrackedon-demandbad %s argument: %s.path.fetchrecursesubmodules.ignorefetch.recursesubmodules(submodule deleted)(not checked out)(new submodule)(commits not present)(revision walker failed) (rewind)Submodule %s %s..%s: --recurse-submodules-default--submodule-prefix%s%s/Fetching submodule %s%s --porcelain-unogit status --porcelain failednot checked outcommits not presentnot fast-forwardmultiple merges foundbad --ignore-submodules argument: %sInvalid parameter "%s" for config option "submodule.%s.ignore"Submodule %s contains untracked content Submodule %s contains modified content Could not run git status --porcelainFailed to merge submodule %s (%s)commits don't follow merge-basemerge following commits not foundFound a possible merge resolution for the submodule: If this is correct simply add it to the index for example by using: git update-index --cacheinfo 160000 %s "%s" which will accept this suggestion. strbuf_setlen %m %smissing object referenced by '%.*s'Object %s is a %s, not a tagtype Unknown type %stag tagger Object %s not a tag-----BEGIN PGP SIGNATURE----------BEGIN PGP MESSAGE-----What does '%s' for %s mean? GIT_TRACE(null)GIT_TRACE_SETUPsetup: git_dir: %s setup: worktree: %s setup: cwd: %s setup: prefix: %s Could not open '%s' for tracing: %s Defaulting to tracing on stderr... If you want to trace into a file, then please set %s to an absolute pathname (starting with /). Unable to get current working directoryCould not trace into fd given by GIT_TRACE environment variablecorrupt tree sha %sunable to read root tree (%s)unable to read source tree (%s)unable to read destination tree (%s)unable to set up diff options to follow renamesstrbuf_setlenObject %s is a %s, not a treeObject %s not a treeCommit %s in submodule path %s not foundInvalid commit %s in submodule path %scorrupt tree fileunable to read tree %sstrbuf_setlen&=warning: error: usage: xfuncnameautocommandcachetextconvfortranhtml^[ ]*(<[Hh][1-6][ ].*>.*)$javaobjcpascalperlphppython^[ ]*((class|def)[ ].*)$rubybibtexcppcsharpdiff=true!diff!^([C*]|[ ]*!) !^[ ]*MODULE[ ]+PROCEDURE[ ] ^[ ]*((END[ ]+)?(PROGRAM|MODULE|BLOCK[ ]+DATA|([^'" ]+[ ]+)*(SUBROUTINE|FUNCTION))[ ]+[A-Z].*)$[a-zA-Z][a-zA-Z0-9_]*|\.([Ee][Qq]|[Nn][Ee]|[Gg][TtEe]|[Ll][TtEe]|[Tt][Rr][Uu][Ee]|[Ff][Aa][Ll][Ss][Ee]|[Aa][Nn][Dd]|[Oo][Rr]|[Nn]?[Ee][Qq][Vv]|[Nn][Oo][Tt])\.|[-+]?[0-9.]+([AaIiDdEeFfLlTtXx][Ss]?[-+]?[0-9.]*)?(_[a-zA-Z0-9][a-zA-Z0-9_]*)?|//|\*\*|::|[/<>=]=|[^[:space:]]|[-][-]+[^<>= ]+|[^[:space:]]|[-][-]+!^[ ]*(catch|do|for|if|instanceof|new|return|switch|throw|while) ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>>?=?|&&|\|\||[^[:space:]]|[-][-]+!^[ ]*(do|for|if|else|return|switch|while) ^[ ]*([-+][ ]*\([ ]*[A-Za-z_][A-Za-z_0-9* ]*\)[ ]*[A-Za-z_].*)$ ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$ ^(@(implementation|interface|protocol)[ ].*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>=?|&&|\|\||::|->|[^[:space:]]|[-][-]+^(((class[ ]+)?(procedure|function)|constructor|destructor|interface|implementation|initialization|finalization)[ ]*.*)$ ^(.*=[ ]*(class|record).*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|<>|<=|>=|:=|\.\.|[^[:space:]]|[-][-]+^[ ]*package .*; ^[ ]*sub .* \{ ^[A-Z]+ \{ ^=head[0-9] [[:alpha:]_'][[:alnum:]_']*|0[xb]?[0-9a-fA-F_]*|[0-9a-fA-F_]+(\.[0-9a-fA-F_]+)?([eE][-+]?[0-9_]+)?|=>|-[rwxoRWXOezsfdlpSugkbctTBMAC>]|~~|::|&&=|\|\|=|//=|\*\*=|&&|\|\||//|\+\+|--|\*\*|\.\.\.?|[-+*/%.^&<>=!|]=|=~|!~|<<|<>|<=>|>>|[^[:space:]]|[-][-]+^[ ]*(((public|protected|private|static)[ ]+)*function.*)$ ^[ ]*(class.*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|[-+*/<>%&^|=!.]=|--|\+\+|<<=?|>>=?|===|&&|\|\||::|->|[^[:space:]]|[-][-]+[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[jJlL]?|0[xX]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|//=?|<<=?|>>=?|\*\*=?|[^[:space:]]|[-][-]+^[ ]*((class|module|def)[ ].*)$(@|@@|\$)?[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|\?(\\C-)?(\\M-)?.|//=?|[-+*/<>%&^|=!]=|<<=?|>>=?|===|\.{1,3}|::|[!=]~|[^[:space:]]|[-][-]+(@[a-zA-Z]{1,}[ ]*\{{0,1}[ ]*[^ "@',\#}{~%]*).*$[={}"]|[^={}" ]+|[^[:space:]]|[-][-]+^(\\((sub)*section|chapter|part)\*{0,1}\{.*)$\\[a-zA-Z@]+|\\.|[a-zA-Z0-9-]+|[^[:space:]]|[-][-]+!^[ ]*[A-Za-z_][A-Za-z_0-9]*:.*$ ^([A-Za-z_][A-Za-z_0-9]*([ ]+[A-Za-z_][A-Za-z_0-9]*([ ]*::[ ]*[^[:space:]]+)?){1,}[ ]*\([^;]*)$ ^((struct|class|enum)[^;]*)$!^[ ]*(do|while|for|if|else|instanceof|new|return|switch|case|throw|catch|using) ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[<>@._[:alnum:]]+[ ]*\(.*\))[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[@._[:alnum:]]+)[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|unsafe|sealed|abstract|partial)[ ]+)*(class|enum|interface|struct)[ ]+.*)$ ^[ ]*(namespace[ ]+.*)$utf-8utf8W]oKXpp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY`24RSrs   "'(229;  * . ` c j o *0/000 #gis strbuf_setlenunable to %s %s: %sOut of memory, strdup failedOut of memory, realloc failedOut of memory, calloc failedOut of memory? fdopen failed/tmpTMPDIRXXXXXXunlinkrmdirOut of memory, malloc failed (tried to allocate %lu bytes)Data too large to fit into virtual memory space.Unable to create temporary file '%s'abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789GIT_FLUSHwrite failure on '%s'fsync error on '%s'%s: write error (%s) , tabwidth=tabwidth %.*s out of rangetrailing whitespacenew blank line at EOFspace before tab in indentindent with spacestrailing-spacespace-before-tabindent-with-non-tabcr-at-eolblank-at-eolblank-at-eoftab-in-indentcannot enforce both tab-in-indent and indent-with-non-tab @   ʠ @נ  malformed diff output: %s @@Could not stat %sCould not open %sunable to read blob object %smerge.conflictstyle'%s' is not a booleandiff3Last expression must not be negated: %sInvalid regexp to look for hunk header: %sunknown style '%s' given for '%s'strbuf_setlenwrong versionno messageinflateInit: %s (%s)inflateEnd: %sneeds dictionarydata stream errorstream consistency errorunknown errorinflate: out of memoryinflate: %s (%s) о      Ⱦ Could not switch to '%s'Too long path name: '%s/%s'Invalid symlink '%s'symbolic link too long: %sCould not change back to '%s'PWDCould not get current working directoryCannot determine the current working directorypushnonfastforwardstatushintscommitbeforemergeresolveconflictimplicitidentitydetachedhead'%s' is not possible because you have unmerged files. Please, fix them up in the work tree, and then use 'git add/rm ' as appropriate to mark resolution and make a commit, or use 'git commit -a'.'%s' is not possible because you have unmerged files. ,  (  $ Ф      %10s: %8u (%llu kB) [attr]%s not allowed: %s:%d core.attributesfile/etc/gitattributesGIT_ATTR_NOSYSTEM[builtin].gitattributesinfo/attributes[attr]binary -diff -text%.*s is not a valid attribute name: %s:%d BUG: non-INDEX attr direction in a bare repo(builtin)false(builtin)true(builtin)unknown strbuf_setleninvalid base85 alphabet %cinvalid base85 sequence %.5s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!#$%&()*+-;<=>?@^_`{|}~%c%d %d %o %.*s%ccache-tree: internal error%s: unmerged (%s) %s: not added yet You have both %s and %s fatal - unsorted cache subtreecache-tree.c: '%.*s' in '%s' not foundinvalid object %06o %s for '%.*s'38;5;%d48;5;%dTERMdumbcolor.uinormalblackyellowmagentacyanwhitebolddimulblinkbad color value '%.*s' for variable '%s'1 8 W W > W E M R X ] a d n %.*s%s%s %s%06oSubproject commit %s object '%s' is not a blob!diff --cc diff --combined ,readlink(%s): %sread error '%s'early EOF '%s'%sindex ..%s%s %snew file mode %06o--- %sdeleted file mode ..%06o+++ -%lu,%lu +%lu,%lu %s%s %s%s::::::::::::::::::::::::::::::::strbuf_setlen. . . . x. . strbuf_setlenidentIdfilter.smudgecleanexternal filter %s failedexternal filter %s failed %dId: $ Id:read from external filter %s failedcannot fork to run external filter %scannot feed the input to external filter %sCRLF will be replaced by LF in %s. The file will have its original line endings in your working directory.CRLF would be replaced by LF in %s.LF will be replaced by CRLF in %s. The file will have its original line endings in your working directory.LF would be replaced by CRLF in %scopy-fd: read returned %scopy-fd: write returned 0copy-fd: write returned %s%s: close error: %sinternal error in merge #1internal error in merge #2internal error in merge #3internal error in merge #4invalid log-grep regex: %sdiffcore-pickaxe.cdata[sz] == '\0'invalid pickaxe regex: %scontainsinternal error: dst already matched.Performing inexact rename detectiondiff-delta.cpacked_entry - (struct index_entry *)mem == entriesѴYiVsg?Df7P*~ {'ZYA n\uT*NN'CMcqH$(~Qڿ80B i6:I_DV<1y UHg=[72waN.ʂ=SGܖ 6k.o; 㐵 mdIP)-_^˵i9/q`ˬymx%!tsC G#cu0׭PycͯE5#egwz3#zo;9 kbѷi>eM? ] {SRЦ-w:ᆑ4}@4m3+]ހ.(uw,܌A!]OJqj&'ȒE R)TZ,m"2TkKةҊs^>*pWGLXY40J}oC9L|Ja%FW$}=ds@`[qFl/:_!j5FH9<`[`=x6(T!fZlG03%Htl߇"Vwra .$b6xޣoӭ~.|܅p ~KP8(zN]{ Lq[(t ?0Q"iQ܃hڬfWfVĻ媍E\P/9YC7?k^f+IvB~'2LO%AA!?CVYRX| e%1_Dž =DdUx-O#[X+j hRd8ޓ 4nomţ2rxud,64JbEvݝE& )p@Hz N#v;'R;*&bU;|b5,]\zcreate_delta_index ~3VԆ(G]>J}y Q/|pENOXHn&B wq_3!uULbׁJڡ4[(VreMA3υ0lY;DT:ՒزkfCF==895GGo>t>ry@ChcJP7p;I}ap 0-N:f76$ %)[k8sK c5"n\6t %w+UaD}lxI,XR&zz+ps}P %c[7t:n }"]]\n}N,5+8U3zrǔ,!RloaU/9uG+"h&ܗ>(@`a;)S7$IF^ffnm0cNH>JE4$bc)MC3ėɷeƄkDˤ: pXPlUC=J-fG kTKVYk[(h~Q6e/VyX'&%p_!VX [x*w1L<<'2dvAK{a5*cB[/Vm-ikP I.Xxj4UWg)f^ h'$ev)Y鮜'/z"Zq `u S#"]N^rC _m$ZL{lL/-AS"|1 *ŤTi,w?WARާn_*8 !F9gPP1]cOd`Dn6]HAw?LA3_W=)LvmgD Ejd;notes.c!tws->nextnote_path_len <= 40 + 19fanout < 20notesubtreeprefix_len * 2 >= npath_len < 40 + 19tree && parent!*pnotes ref %s is invalidnotes.displayrefrefs/notes/commitsGIT_NOTES_REF!t->initialized!display_notes_treesGIT_NOTES_DISPLAY_REF Notes: Notes (%s): tws->path[0] == '\0' && tws->path[1] == '\0'memchr(path + 3 * n, '/', path_len - (3 * n)) == ((void *)0)Could not read %s for notes-indexFailed to load %s %s into notes tree from %s((uintptr_t) (entry) & 3) == 0i == n && parent_stack[i] == tree((void *) ((uintptr_t) (parent->a[index]) & ~3)) == tree((uintptr_t) (*p) & 3) == 2 || ((uintptr_t) (*p) & 3) == 3Failed to read notes tree referenced by %s (%s)strbuf_setleninit_notesload_subtreenote_tree_insertnote_tree_removenote_tree_consolidateinit_display_notesadd_noteremove_noteget_notefor_each_notefor_each_note_helperconstruct_path_with_fanoutwrite_notes_treewrite_each_notetree_write_stack_init_subtreewrite_each_note_helperprune_notesutf-8format_display_notesinternal error: pack revindex fubarbad offset for revindexGIT_PAGERLESSGIT_PAGER_IN_USELESS=FRSXunexpected delta opcode 0delta replay has gone wild, %u.%2.2u GiB, %u.%2.2u MiB, %u.%2.2u KiB, %u bytes | %u.%2.2u MiB/s | %u KiB/s %s: %3u%% (%u/%u)%s%s%s: %u%s%s%s... , %s. donebad replace ref name: %sduplicate replace ref: %sreplace depth too high for object %s \ No newline at end of file 0123456789;($7K4A|4G4 >tD>>>?X?4|???@T@T@@@HAThATAAA4B0BpBBBLCtxCCCTCDDXDxDDDtDDdEhETEEEFD4F`FtFFtHG`GGG$GHDXHDHTHHtI$ DI pI IT I I I J J (J HJD lJ J JTJtKDLKxK$K LD!L"DL#hLd#L#Ld$ M%`M%M%M&Md&M&N&0N'DN'N(ND*OT,PO,pO/OT0O0OT2DPt3P46P8Q9$Q49xQD:Q:Q;Q<4R=`R>R@RTASdC4SCpSESGStJ@T4KpTKTTTVs?t$@ t@Dt@dtdAtBtCuC uD4udDXuTEutEudFuFuFuGvTG?$?H?`AAAȞA$BtBB@CX4CpdCCCCП$DEE0FHDF`GDHĠHH8IXTIxtLСLtM,NXdPDSآVD\DD_Tdȣg g$h8h4ikll8Dm`mmtop<p`qqdrԦr$tdtuԧv,}TāԨT\4|$ĩDةDTdt(ԍ|tL`ԐԬė8D,tt$$pT4ԣ 8x4ذTT4t$(T@`̲Dt8dĺ|TT ľD4p4̴t0Pp$DDDd|<d`и<dh8dd Ld$TDd|н$,@`tt d$XT0dddX4t 4 `$PD|4$ dDD !0!\T$t%'d) )0D*T*d+D-4L4x5: :D$=>GHPTIxIQDR R(tTTTUWX$YHtYY4ZZ[T[8[X[xd\\]d]]@^l4_t__4a a<chDc$dd$Te`4fggthtiii$jxkklDll lHdmtndnn$oohoDprs4utDvwdwwzH4{xdtX44DXt4t0p$4$<x$td84XdpԝtԠ0DXdt4tԫHTxԬtdTL4ԳT<PԵD4H|4X$d4TttDt$$8DLl4T$,DL|dt$$dTTd@T4x$t$(PDxd0Lh$0H4`d$Lh$$DHldD8$x$D\ D4p$0d4t 4 tdt dPT dP 4!!"(d#|'d)D4*$++,4,8d,X,p.234x45t607\T888$9 =d=>@tAXACD4DF@DF`FG4KtK<tLdMtMMMNtOTPQRTVDjDkptq8qLrpst4u,uduTwx zDt($P44,ltԔĖ8ėx44t4$dTTt<4hԴ0Էt PDt  L t 4  < 4\     DX T t  D l     D Dd   4l$$HD(4T$T$4@$dd,dDpdT,tDX 0D pt d Lp$$DDX|$T$48$ <!P!D"$$$$%\t%**$++X,xT0D;MAA AC` A AAA @ @BAA AAFA= AA AAE  F,4 FUAA AC C AAE ,L HAA C   AAH | H AC VA0 HCZw D q G Q$ $ItC0HTGM |IcAE | AE $ IC0HPKD `J/AC iA$d pJ%C@HWH F ( xKFNNb B ,  AA AAF L*TAE J AG (p*D CFSV F 8*(vAA AAC0jAA AA<*lAA AAEp AA AAB 4+QAC AE0 A AAD TP+cAA ACE` AA AAH W AA AAA ,+,C@FJ] H X H a$+CPFIFLX,TAF FAC3 AA AAH  AA AAE D\,C@QMH H ? E w E [<,PC@MQH B  I k E ,0,<) -XC0JKn B (0-C0HO E $\-AA  AD (-FNN[} F ,- FMIIK D $- lC KF\ H s,.L AC O AD X AG 8. `AC d AG \. 'AC aA(|. JCKJFs G (.5AC T AG OA0.0AF  AF O AH 4/uAC AC  C AAH (@/dC@HFHH\ C Pl/AF ACE(r AA AAB MAA AA0/͖_AC AC0SA AA$/0CPPOn H 0!PAC ` AC @0"PC HSq(`0D"C0HHHV E (0#rC@HHHH C 0$*AC `A,0 %C0HHIb B S E $1%C@JN F @01T&AA AAF AA AAE @t1 *LAF AC p A AAB CF AA(1,*oAA C g AA(1p*vC LHS F q G 2*-C i<(2*AA AAC`  AA AAD $h2<0C HHU H i(20_AA C W AA(20@CKKP, C p22AA CAF AA AAC  AA AAE  AA AAH (\3xKCpIFH  E T3MAA AAFD AA AAF L AA AAH 3h%AE ZD4h 4hLC FMuH84hZAC CC@ A AAC AF AA4i1C m4P'C (4ihFIIeK H 4Xj%4tj-5j,5jHAF w AA FA<H5jAA AACP> AA AAG h5l$AA AACPh AA AAE O AA AAE OAA AAT5`nAA AAC@ AA AAH V AA AAF (L6oKAA C C AAlx6oqAA AAF CA AAH h CA AAB P CA AAB 6qTAC0~ AA T 7rAA AACP AA AAB  AA AAE Td7seAA AAC`5 CA AAA C FA AAA (7uC0LHWv D <7lvUAC AAEpX AA AAA @(8y1AA CAH  AA AAF @l8z~AA AAH  AA AAA T8|`AA AAC0a AA AAD  AA AAA <9}AA FAE0 CA AAA H9l~.CgT`9~AA C ^  AAC T  AAA C  DAA K  CAA 9~XF L A (9 _AC C q  CAD @:TOAA AAF AA AAA 8D:`~AA C M  AAD T  AAB 0:AA AC zA AAT:AA AAC@b CA AAA  CA AAA  ;ȂAC YA,;ȂC0 C H;<\;Hp;DCL A M(;DC Vk D j A ;;CL A M,;C0HHHT A T, <DC0LHGc G kP<ԅCL A Mp<ԅCL A M(<ԅEAC h CA SA< <,<AA E0R  AAE =PZAC0TA,8=\AA C M  CAB h=(C d=Ԇ3C L A ,=AA C0  AAG (=lAF C _ AA =܇cAC XF(>(pAKI AB VATH>lAA AAC  AA AAF a AA AAC >s'C >Ј)C e(>AAE _ DG OA(> =AC Eo CA$$? MCFI_ G P(L?HC0FPFFl G 8x?AA ACE@AA AA?,?AA C   AAF h?wAA AACP? AA AAF R AA AAB JAA AAd@< AA AACP^ CA AAA  CA AAA p AA AAA H CA AAA ,@XAC | FB w FA Aؙ00AԙAA AC0A AA dApfAC0`A AyAC0f AE 4AAA C0  FAF C CAhAЛeAA AAC@ AA AAE f AA AAA \AA AA(PBԜC@FFFJ F T|BhAA AAE`v AA AAE Z CA AAA (B CPHFFHL E Ct,C h0C]AE \ AE S AD [A0LCC FFx A R F f A (C$C FJS J  A (C}C FD^ E @ A ,CܢC FHS D Q A (DAC S AH \A( T8kC@HLHPO B ,8T|AA CP  AAA hT,&AC `AT<2 ThlC HJVT+C g8TAA AAC@AA AA(U`gC T[ F ] C 8@UAA AAC`AD AA(|UHFNg D @UAA AAF5 AA AAE <UAC AAEP FA AAC 0,V]AC g AD O AH SA0`VC FHY F h H a G ,V@kC0FKFk C w A TV7AA AAC@ CA AAC b AF AAE Wh4C [ B S<AC xAW -C $ X CPLHH A 4Xp <C (HX AC y CH JAtX (AC `C(X lAC t CE fAXd X$X C@HTHM D X8 8YD AF Ap  AAA Z CALY (`Y CPFVP B 8YAF C L  CAF K  AAK Y?AC wCY Y Z+AF bA04Z CPFJP B U$hZC0LHB G aZD%AC ]C$ZT\AK I AA ZkAC0cC$ZC@P@ E ($[`CPHJlg H @P[AA AAF  AA AAF ([@&C@Ho E T[DAA AAC0 CA AAE  CA AAE (\YF^Rg C <D\0AA AAC0 CA AAG $\AA l AA <\_AA AAF  AA AAA D\AA AC  A AAJ CC AA,4]Ar E I A F A Od]$x]`AC e AF ]$;AE [ AA T]@AC ACEPS AA AAD  AA AAH ^AC0 CA @^C T(X^ tC0HHHHr C ^`7C s^7C s^,C h^,C h$^C0MXFX B ( _ C@HMHt D 8_,!JAHT_`!2(h_!8CpFIFL G _"NC FKFs_h'C T_"AA AACP\ CA AAG  CA AAE P$``$AF AAE@U CA AAG YAA AATx`$@AA CAEP AA AAA S AA AAA <`&AA AAH AA AAE TaD+)AA AAFt AA AAF  AA AAE ha.B|aX.AA AACp AA AAG  AA AAF  AA AAB z AA AAB <b1AC AAC` CA AAF T@bD3AF AAC@B CA AAD B CA AAH @b3 AC AAC AA AAG b8AcAC0K AH (cAFWINS G T,cxBuAA AAC@ AA AAD s AA AAA <cC:AF AAC@ AA AAA cD6CHH^XcD`AA AAC AA AAC n AA AAA h@dJAA AAC | CA AAG C AA AAA [ AA AAA ,dXKwAD | AF mAdc'C TdKAA AAE@y CA AAH  CA AAH <HeLpAC CAEP\CA AA<eP~AA AAC@ AA AAL 4e\QAA AC  A AAH <fQAA AAC0w AA AAA @f4R PTf0RAC AAC@ CA AAA KFC AAfR"<fRC0HHHHs J c E  fT^C HLc F ( gTTC@HLHJI F Lg(UcAC0]A,pgtUAA C0  AAE TgVAA AAC@ AA AAE s AA AAA 0g|WAA AC qA AA4,hWAA AC Y A AAF 4dh@XAA AC z A AAE ,hYcAC C@T  AAA (hYCFky C Ph[AC AAC@ AA AAG [CA AA Lih\^C0HLe D $pi\C IZ H (i^SAC E0G AAiP^h4i^C HHHHB C Y G jD_~C LHWO(4j_FILIR D (`jdaCOHKJa H (jaCGHHHp F $jbCHGHHi8jbvAA ACC$fCA AA$k8cC0HHQa4DkcRAA AAJA AA8|kcAA AAC0uCA AA(kdC HL_ B ^ kdVAC0PAld0lHe\C@LH_ E d L (Pltf^CpHHHLS F @|lkAA AAC AA AAA l$tlCKHE A 8lpt AA AAC@AA AA@ mDuAA AAC% AA AAH <dmwAA AAFO AA AAC mP}C XmX}# mt}cAC ]A m}GA} B Fn}AA AAFF CA AAB V HA AAG  CA AAA D CA AAA dn4AA AAC0Y AA AAL N AA AAF GAA AAPolAA CAC@ CA AAB WAA EA$\o(C HHHw F $o_CPJ_N F (oC0HHHP F o!C ]<oĆAA AAC` AA AAG d0pAA AAC0| AA AAA S AA AAA JAA AA(p-C0PHO A pHAC BA,pAA C@  AAF q%AC _A8q̋WCS<PqAA AACP AA AAA qԍGC FGv(qC@HNJFp G 0qC0HHPHg F iPrAA ACE@ AA AAC [CA AAdr`aC0HFO$rC@MFH@rHCAC AAF  AA AAG ,rTC HN} B G A @ ssAA ACF! AA AAA @ds AA ACHS AA AAC s-C isCWPsAF AAC0r CA AAA CA AA@,tȖyAA AAF# AA AAF @pt$AA AAH AA AAH @t7AA AAH+ AA AAE (t]AEd AE kA<$u IAA ACC@ CA AAG $du0CPFUF@ D uC@YH\ H ut0C l<uAA AACP AA AAE vv0v.C jHv " \v(MC HHHm$vTYC0HHHHqv#C _v+C gv#C _vԣ+C gw#C _ w+C g8w.C j,Pw4}AA C@  CAB w+C gw.C jw3C0o4wܥAC AE . C AAC (x4iAC ` DH qGP,xxjAA AAC0R AA AAC CCA AAx,AC dCx,AC dCx9AC oATxԧAA AAC` CA AAG  AA AAB (8ybC HHHn G Q,dyAA F }  AAA (y@CPJSO A <y$C0PQm G C E L L <zĭAC AAH a AA AAE <@zdAA AAC` AA AAF (z!FU^h A <zAA AAF AA AAD @zAA AAF AA AAA @0{aAA AAF AA AAF t{+C g{H{AA C J  CAE l  HAC S  HAD ({h9AA C o CA@||AA AAF!K AA AAG \|C FHFr|d"AE ZA$|tC@IJHc8|HAC AAE0xAA AA}5AE mA($}C@QFLG A PP} AA ACEP AA AAD @AA AA }@mC FFJ G (}C0FGIHU B }mC FFJ G ~4XAA C {  CAL C CA<T[AA AACP' CA AAD DlAC AC T A AAA CF AA(܅C@NKB B <JAA AAC@ AA AAH @H"AA AAF  AA AAB HAA C@i  CAF [  HAD o  HAH ؆/C0kTAA AACPv AA AAG _ AA AAE (HLAA C@ AA(tC0HLTb C <dAA AAC0 AA AAB <NAA AACP AA AAE  $HC HGu<@TsAA AACP AA AAE 8AA AAC@AA AA(CGIFF A 4AC nArAC h$0-AA ACEPj CA AAE a AA AAC d AA AAA $C ` AA F Tȉ AA CACp CA AAA ] CA AAE  4(4@-AC S AH GA`D$ACP^AT4ACPnA(tCPHO A ̊:C0v@@AA CAF!t AA AAA ,(-AA H   AAC ,X AC F   AAB , iCFJk A (x dC@HHPS B ؋ aC HHM8 AA CW  CAH C  FAA 4` CPHHy A <X AA AAC0g AA AAF < &C L A UL &C L A U ،\ KAC P AC ( C RK H  A T(AA AAF AA AAB F CA AAA (F IPa C < AA AACP AA AAA (XZC@HPB C ,C QMw H [H\CJ`dC Ohxl|AA AAC@ AA AAH C CA AAG C FA AAD lAA AAC` AA AAA N AA ACA C CA AAA (T?AC Cu AA <Au B C IAE AA<ȏAA AAC@ AA AAA ,uAD H @  CAG (8,AC C0  AAH <dAA AAEPC AA AAA (@ FNQINPА AA AAEE AA AAF cAA AAP$ !AA AAE@N AA AAE TAA AA$x!FNY C T"AA AACy AA AAD x FA AAA  #9C Of,,#xAA C [  FAA H|#\#p#C@(<$5AA Gi AAP$C W(̒X$C@LHHPx A T$(AA AAH AA AAH v AA AAF $P&pC0JKK E G@x 'AA AAH AA AAG (*F!NIw B l+7AA AAC` AA AAC a AA AAC  AA AAE $X.C [ A (t/pAC L AG PC4/`AA C J  AAG C CA/=AE sC00:AA AC pA AA(8 05FIIQ D ,d 1fAA C K  AAA `1l1*AC dA<ȕ|1AA AACP AA AAF P4+AC AAF AA AAH ^AA AA(\5Ff6 F @L7AA AAF ` AA AAB $̖8C HKe E 9D9;AA AC L A AAC  A AAA P:CRTh:AA AAC0f AA AAG O CA AAA (d:CPHFKF B @;AA CAFA% AA AAC 04=xC@FFK]@T=zAF AAF> AA AAG 0>^AA CC RA AAD̘>AA AC w A AAH CA AA(@?mC HHi D U C $@?TAm B I O ITh?AA AAC`G CC AAB  AA AAF <4BAC AACP AA AAD TC;AA ACC`g EA AAH  IA AAA @X|DrAA AACS CA AAH (ICPFIn| D (Ț|JCFFXDQ D (0KCPFFFD| C < KAA AAC` AA AAE (`M6AA E j CA(MFN]PM B (LOC`FJFaD B (PC@HLGH B <$RRAA AAC` AA AAH 4PDSC OHFo A k E k@S^AA AAF" AA AAF ̜YOCPF A ,LYjAA C@]  AAA $YC`HRFk B @dZ6CoXZ5C@i A tZJAC@ AA (ZCpHL\H A (ĝ[dFNIu H (]C@HHHH} H (^C`PHM C (H`CPHHHH\ A tPbUAC MC buC HHc A ,bAC C O  AAH (HcC Pi D ] C p)'C @,cAA ACEZ AA AAG @p4eAA AAF AA AAB (kC@HHS B 4TlAA AC@ A AAA lmAA AAC` CA AAB l CA AAA 7 CA AAA \qoC0HFLQ@q-AA AAF! AA AAF @sAA AAH!@ AA AAH @4tAC AAF AA AAE <x}8AA AACp AA AAF $~\C HL{ F $~yC0HHK J P@,AA AAF AA AAH $L؆{AF m AA t0cF W A (CpHTS A (hAA C ` AA4\AA AFr A AAB < AA CCCP AA AAA (`C0HX\ A hsC TD A Č]AC WAԣ$'C ,KAC s AH IA( eC HLq H T$DPC0LMw E l؍-7AE mC.AC hA$CAC }A,TAA C q  AAH 6At(,؎aAA C Y AA(XAAA C u AA @ZCRMw(|%C@JUHT G ԥ3C0o3C0o,АiAA C H  AAA <4FAA AAC@8CA AA,t qAA C J  AAG (p]C@HHHN C Ц#C _8AA AAC@AA AAd$`AA AAC0 CA AAD C CC AAE fCA AA8AA AAC@AA AA8ȧC0HHFE B _ A h H hAF AAC0i FA AAB W FA AAH P AA CAA hpAA AAC@V AA AAG o CA AAC S AA AAA <ܨxAA AAC0 AA AAH ,C PSi A i G (LXAA H I CAxPȗAC CFC@S CA AAG OCA AA(CPHHHUN B  #C _$$C0`<(:C0vTP7AC0oC8tpPAC AAC0BAA AA(AA C  AA0ܪAA AC A AA(T^AA C V AA$<C HHQ{ A d,C hP|dAA ACC@D CA AAE CCC AAЫ$#C \ <AEPxA 'C @ 8AA AAH  AA AAA 4diAA AC0 C AAD <AA AAC AA AAA ܬ8AC0~A(C0HHX` E (,8UAC A AJ CA(Xl{C0HHOz D (CPHHf C ,TC0HHSn D s@$AF AAK  AA AAH $ @8AA AAF [ AA AAA @|AA AAF AA AAB T4AA AAC CA AAC ] CA AAE (CpMPr F TDPAA ACEa CA AAF W CA AAA VAE NAl#AA ACHK CA AAA V AA AAF  AA AAA 06C0oH̷#C _`NC0@ E E7C0p<<AF AAC@k AA AAE ذ,mAA C E  AAD ȸC HGc C (@D CpHT\ E 4l(C@JMO G _ A s E 8wAA AAE0gCA AA$w(CPFJGa E $ 4rC0PLV C y4HAF C0r  AAB  AADLC i D Xt{C0H_P#C _ز#C _$?F Ndx H (C0FIL@ B D'C <X|VAA ACCp AA AAC  @TAA AAF AA AAD <AA AAC CA AAG $DCPL`v A l(3C o(PQCPFJo J ,CGZ| H W,CGZ| H W $C HGc C 4"$HC0HFIQ E @pTAA AAC? AA AAF 4AF E0  AAA y CA(qAC U CD MC4,|AA AE b A AAC d'C (x<CFMFKk F ,~AA C0R  CAE ,EAC c AH C AE P*AA CCEP AA AAE }AA AAl5C q( C@HHIGy D 0hAA AC \C AA< AA AAC` AA AAA @$AAA AAC AA AAH Th.AA AACPO AA AAF  AA AAE <nAC ACCP AA AAB O$@C HFHo H ,<xAA C0K  AAF l8C0t@8C0th`C HHLcC0LHK,ܹAA F   AAA  h#C _$#C _<+C P+C d xC C C AA F Ժ C \C W8AC ACC@AA AA(@$uC@FFWf D $lxC MHFD F AC OE,AA C0b  CAE ,PAC E @  AAE ( C$XJ A (@MAA C C CAlWC j C f<dAA AACP AA AAE (̼(UAA C0K CA\TC HIPAA ACCP CA AAF UCA AAlH$D[C0FNC| LAC S AH C HG_ G  -AC [ AA (,)AC cAHAA AAE$| AA AAG (PAA AAC0x AA AAA GAD AAl@MAA AAC0 AA AAA  AA AAH E AA AAA <d AA AAH@D AA AAD 2<AA AACP AA AAF L ZAA VA@ AA AAF4 AA AAF `$ XC0FIF|<` AA AAC0m CA AAF LAA HA@ AA AAF AA AAB (,8C@FR A (X/AC E a CA8AA AAC@CA AAd?C HGl<AAC CAC` AA ACF @  AA AFF CA AAC hd@ 6AA AAEP AA AAB p AA AAD M AA AAG !AAC0{A<D!0AC AAFR AA AAF $04'C@HHHH^$X'fC0HTV C $(C PHHz C @)uC HPL` A w A q G  F L} < \ oL L  tT o$oo  Ÿҟ"2BRbr Ҡ"2BRbr¡ҡ"2BRbr¢Ң"2BRbr£ң"2BRbr¤Ҥ"2BRbr¥ҥ"2BRbr¦Ҧ"2BRbr§ҧ"2BRbr¨Ҩ"2BRbr©ҩ"2BRbrªҪ! " t; S J4 S R S 4 ; ; < < ; ; S ; ; ; ; ; ; S tt D  D D D D %D +D 3D ;D CD KD SD 3 tJ A8 'L  =L WL ]L VO /bad-path/* m lf vf m lf f vf f f  k k k K]Bn`K֒I; d d q s ` \   d i   ď P  ؐ đ  P   L    ؔ   `    Ǎ  ؖ ʍ  4 ΍ p đ ҍ  đ Y ٍ  @  t .shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss TThh !$4oP> P FLLLNo[o$$0j TT s tt |<<0wll +LZ\ \ i  <( e ^ ^ _ _ _ _ cP ` `l4 Pl