ELFؿ4M4 (444  TTT<<>  (  ?  hhhDDPtd!  |(|(QtdRtd>  /lib/ld-linux.so.2GNUGNUa_&{io.d[u`p |(CEK8vqXfUa!c&g"/=Wl  xRT=\H. 94;] E3+V'QefJwip+ysMxTcD.Oh3L;x!zQ\ 66YCEn7 +Cf&q!?HEO@ < d  C $ NH ,  `P  libz.so.1__gmon_start___Jv_RegisterClassesdeflatedeflateBounddeflateInit2_inflateinflateInit_crc32inflateEnddeflateEnddeflateInit_libpthread.so.0pthread_selfwaitpidforkpthread_createpthread_joinconnectpthread_setspecificpthread_key_createraiselseek64pthread_getspecific__errno_locationfcntlpthread_exitsigactionfsynclibcurl-gnutls.so.4curl_easy_duphandlecurl_global_cleanupcurl_global_initcurl_multi_performcurl_slist_free_allcurl_easy_setoptcurl_multi_add_handlecurl_multi_info_readcurl_easy_cleanupcurl_easy_initcurl_multi_remove_handlecurl_multi_initcurl_easy_getinfocurl_multi_cleanupcurl_slist_appendcurl_easy_perform_finilibc.so.6_IO_stdin_usedstrcasestrsocket__xpg_basenamefflushstrcpy__rawmemchrgmtime_r__printf_chkfnmatch_IO_putcgai_strerrorstrncmpstrrchrregexecpipe__strdup__open64_2ftruncate64getpwuidmmap64closedirftellsignalstrncpyregfree__stack_chk_failunlinkputcharselectmkdirreallocstdingetpidstrspnchmod__assert_faillocaltime_rgmtimestrtolisattyfeofstrchrnulsymlinkfgetcfgetsgetpwnamcallocstrlenungetcsetitimersigemptysetgetaddrinfomemsetstrstrstrcspnrmdirfseekchdirmemcmpgetpagesizegetnameinfodup2unsetenv__fxstat64__fprintf_chkputenvstdoutfputcfputsregerrormemcpyfclose__vsnprintf_chkstrtoulmallocgetpassstrcatstrcasecmp__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfregcompstderrmunmapgethostbyname__snprintf_chkgetuidreadlinkexecvpstrncasecmpfilenogethostnamegetcwdfwritefreadiconv_closegettimeofdayrenamemkstemp64__memcpy_chklocaltimestrchrutime__vfprintf_chkmktimeiconvfdopenreaddir64qsorticonv_open__strcpy_chkfreeaddrinfogetrlimit64__sprintf_chkmemmovefopen64accessmemmem__strcat_chkstrcmp__libc_start_mainferrorsnprintf__cxa_atexit_edata__bss_start_endZLIB_1.2.0CURL_GNUTLS_3GLIBC_2.1GLIBC_2.2GLIBC_2.0GLIBC_2.1.1GLIBC_2.2.3GLIBC_2.4GLIBC_2.7GLIBC_2.3GLIBC_2.3.4GLIBC_2.1.3       ' TZ #= _@ii mii wii  qi si ii ii ii ii wii mti si ii   $ @           $  (  ,  0  4 8 < @ D H L P T X \ ` d h l p t x  | ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J$ K( L, M0 N4 O8 P< Q@ RD SH TL UP VT WX X\ Y` Zd [h \l ]p ^t _x `| a b c d e f g h i j k l m n o p q r s t u v w  x y z { | } ~           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                     US[à1tn!QX[5 % % h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% hD$ D$&D$ $  tT$D$$ XD$$; HD$  D$&D$ $ iD$ ` D$&D$ $ BD$ ; D$&D$ $ D$ < D$&D$ $ D$ L? D$&D$ $ D$ @ D$&D$ $ D$ tL D$&D$ $ UWVS1,*L$}-uD}8u8}t L$]%Bu|$$U L$,[^_]ÃD$ b D$&D$ $ WVS D$@D$-7ZT$-D$OY $WD$u)PT$P=D$BDD$Y $VD$u"P T$P tU =D$CDMD$Y $Vu9D$P T$P t" =D$MDB CMCt MtBuIt$4$肣1҃Bu!\$ t/u"C\$4$Z‹L$9u [^_ÃD$ c D$&D$ $ oD$ De D$&D$ $ HD$ 8u D$&D$ $ !D$ `~ D$&D$ $ D$ n D$&D$ $ D$ l D$&D$ $ UWVS] e$1uDŽ$DŽ$DŽ$$$$R^L $T ƒ ЃT C$/EX 5@ $D$\$4$\$4D$$U\ X $&&$ \$4D$ D$$;c $D$P $SC$R$$DŽ$1T$<$D$8p&|$HD$8T$$DŽ$L$4$ D$ $D${b$8OL$@D$P $R$T$H$T$D'AL$D\$ $)T$HB.< ] $pM HK‰HKH K HKHL$<;t$@D$<Dv0;t$@D$D$8T$(|$H$IT$(D$8Ct&W D$<@\$@@$ũD$Dg @r @ T |$D O |$DO t70 ڍ4=L ~L$D1 4 ZuD$D0 4P D$@\ ڋL$Dڋ|$D1؋\$81ɍ4Ӄ@ z@ ;L$H|ً|$D\$PT$<1D$DD$PW Ƅ$D$T4Ë$tD$$$D$D$|$`RD$D$D$@$ $$aLD$8$$ @ $$5$DŽ$$%$DŽ$&T$4D$$P$XD$ D$&D$ $ 9Ѓ/$Jz UD$ $: @DŽ$1DŽr퍼$DŽ$$DŽ$<$z $D$$D$D$D$ D$$x$$a$$ $\$HD$Htg\$H&S@T$ D$D$ $qt;C,uԍC$S@T$ D$p@ $D$:uɍt&$ @ $\$H$I$\$4D$$N$lt&PD$HT$DP @ tL\$D11D$0\$<1&< ;stcL$D< u;L$D$8?3"1$e3=We[^_]Ë$D$= $H$ D$ 4$tXD$E 4$D$ 4$!D$ $uD$O $]f%T $  T$DD$H@,$蚟 @r @  T j@ F t 7 =L ~  \ |$D1  9|1|$PT$H|$LD$PD$P t$TNj$tD$$$D$GD$|$H4$;D$HJq|$D1t&$9|$C$D$z $$  $ $* $ @ $3 D$D$$A D$ K% @ T @=L F~  \ |$D1t&  9D$4$豫4$D$H$D$ D$$$9:L @$ 芑0 7 )D$U 4$TD$[ 4$titTfu6D$$蚏8Í@ D$4$W7CCt&D$,$L$ $ t&l$$ ЁD$4$ 6L$8&CD$$D$(D$DD$HD$LD$D$$4$D$衱DT$t$<$8<$6|$8t}D$@D$<|$(l$,݋\$$&D$@D$<|$\$4$~%T$8uD$4$5D$8ul$,KcD$4$4L$8g΃|$8Bu D$T$ D$4$4T$ D$;D$8sD$4$dsơ $5  Zu-  D$D$@$ D$D$Q$D$D$3$D$D$k$t tD$D$)'$ D$D$*'$x tD$D$g'$c| tD$D$q'$F tD$D$Q'$)D$D$-$ ~75 ~-D$D$$ D$$D$D$D$4$D$D$$$ %tD$D$)$y  D$"'$D‰D$V d tD$D$'$+ ,[^_]Ðt&D$D$@$D$D$Q$v$ dD$ C $'u fD$D$U$;v  )G$[t$|$ţ $D$D$'$$D$D$.$ D$D$P$$[^$(w @@$u-t&ʋJ$uB$á $  UWVSÃLD$,D$0D$4ǍD$8GD$D$P$;3D$D$,$t$D$'$rD$D$+Nl$,$ܽD$D$D$ ,$$D$` T$4D$T$$\$D$'Ƌ$腽t$D$''$o<$u;\$$\ kG4$蟿,$? L[^_]Ðt&<$1D$8tȃ%T$<tutu &tu u$ b$su \fD$ D$ ,$#v4$耿D$D$+Nŋ$d~Pl$l$,D$ ,$'D$4$D$贽D$D$,t@D$4D$0w=D$l$,fD$D$,vD$,$D$,uD$ D$&D$ $ |t& tPu @$uf$ ِD$$\$\$ t$t$(|$|$,D$$Uft$ D$D$ $%t\$t$|$Ðt&|$t$(t$\$ \$D$$"l %'S(D$8\$$D$D$D$ D$4D$D$D$0D$0$D$`([Ít&'1ɉt$t$$|$|$ \$\$($t\$t$|$f\$ \$1ɋt$|$fS\$$tD$ D$$ D$wh[UWVSLD$`|$4t$dD$(D$,D$D$0D$4D$8D$<<$dV@…^@Et&Hv@HЃ v8/t3.t.-t)D$D$ <$"$…tIHwT$D$<$D$8T$L$<PT$8T$D$8\$$(T^0 HKHKH K HKHW @@ PV @$u !t&ыQ$uA$?[^_ *[^_ D$@D$VSP  ҉t tT$$Y R 9u 8t&9tËC$u4$Ӥ[^Ðt&F$C$4$躤[^ËF$4$ 褤[^Í\$Í@D$Ct$$tYC @ XC$gt\$t$Í&C4$a\$t$Ðt&Ct$\$Í'S1 u3[$t$SuC$tC[$u1[Í [ UWVSLT$`L$djT$$ $S ۉD$,l$(l$dt&[$Sֹuۋl$(k$?t(C t$L1[^_]ÍvCtu&C ${tS tT$ $T$ ǂ{/t] tO%t~=t$,D$ T$ L$ t$D$$ PT$ :kD$`@(T$ $ D$D$,D$OT$ Ɖ$@t$`\$8Eu-F ED$E$sEET$dD$$ituF E<$D$itUEGX$\T$L$8R<$<$D$ VD$ tnT$$Bnm #L$$t$dA4$P$) \$D$NL[^_]fl$(D$,$ D$NL1[^_]ÍG1$PD$ D$D$ $蜝L$d $xPD$ D$D$ $ofEt&ED$ D$D$ $49&$ M&D$$ D$M$1T$ $Ç$8 D$SMT$ qD$,T$ $s D$0MT$ N&8v$D$,T$ $ D$LT$ &\$\$ t$|$3xC $kC C %t`tS$ju.C u!C$ND$D D$$XM\$t$|$ÁuC@ t%CC $_؋t$\$|$yC n&bfUWVS\T$pT$DT$@T$pZT$@RT$HT$pRT$uCT$@BCt\[^_]ËC T$pB D$ D$D$$| T$pD$,R BT$4jB1҅L$,9ȉL$8v]t&\$,9 L$0ut&| Lt}9Ér9 L$0tmL$4SA9T$,L$,9ȉL$8wL$,˃%S3j&„T$@B\[^_]ÉL$0:/Dֿg T$,T$0T$<$v‹D$,9~E\$,\$0tg u"D$B u\$gRL$H@ 0@@fыQ uT$pL$HA R T$4W t$ D$k D$$辖끍t&UWVS|$0$ Q$,Q$QFʼn<$$QE|$F$y~/,$̚D8/uv8/t~GGG F3C(C C0CC$D$[^_]Ð,\$$Ӌ $t$(T$Y1҅uD t95 D$D$ D$\$$ޖ19‰Ћ\$$t$(,É', \$\$0l$(l$4t$ |$$sML<D$.1$ʖ); t&\$t$ |$$l$(,ft1u܉1t͋5 * $轙  1듍vD$.$8 )9t 1cv= 9uۡ 5 $T D$ $D$補   $ f 1 $    \$$U CD5 \$$l Dn&'t$5 \$ t(4$ t' tBu  ؋t$\$É4$ tt$$Oאt& t$؋\$ Í\$Ét$f18D$ f$.tjD$ $tVD$~ $tBD$O f1$t+D${ $ۗtD$ $Ǘ։\$t$Ív'\$Ét$|$׀8tKD$C ${tOD$Td $gtCD$W 1$Qu 'f\$t$|$Í' v'ۍvVSӃ$T$T$D$$T$D$ƋD$:1҅t t$3$[^ÍvUWVSÃ<5 D$.$D$$t$D$(D$,[)t$$l$|$ D$ 4$;- |Lv"tHT$D$4$D$(T$L$,PT$(T$,D9- ~</\uD$4$[D$(T$,\PT$(T$,D/놐D$D$ 4$`D$($1ۉD$D$,D$N4$;D$(<[^_]Ðt&t$t$$|$ D$ 4$몍v'UWVSÃL |<$ D$4D$8D$< D$,] t41f#t;uD$, u| ET$,T$,T$,|$ |$4D$D$ T$<$nMt&< < t|6D$<$D$8T$< PT$8T$tT$ tӋt$ 1ۅt$É؋\$Ív' $\$t$t$|$|$ox$t$|$ Ít$\$$|$|$ ,D$D$D$4D$D$0$q,Ðt&UWVS,\$DD$ $-D$N     D$D$t&tt80 1ۃ l$u u;#[toD$߃ \$ƈ { 1 É1ۃ-É t߃ v $ D$ D$ 7t&D$v t'D$$ 1 ,[^_]Í&D$v \$Ɔ t& t t =Lr11D$1CfT$ uCtC#t;u9D$+ tۍvu?ft .  9u\" 1땅t D$D$1\$_t&] 1É1ۃ-É u .0$t 9= t+T$T$1L$Ɔ  T$HD$$ T$T$@f&b f"\ t뀅\$fƆ .t$Ɔ w \$u> 4Z u"Ɔ .  "tm\u ufv1 @Jvntt  ]k t$ 3 Ít&'\$\$ t$t$$$Mt\$ t$D$$\$\$t$Ív'D$$ Í'< \$,\$@t$0t$Dl$8l$H|$4t t$H\$,D$Dt$0|$4l$8<81D$$' }t@D$$, aN$=D$$D$mT$$9tD$,$Et$$It,D$\$,t$0l$8E|$|$4<Ðt&l$Ӑ;D$$|$.ft$$D$6D$ t&t$l$$D$Wt&T$t$$T$D$&\$t$$% LÉD$D$$D$D$ $/ۉt$ \$t$ÍvUWVS,T$@D$.\$Dt$H$;D$@WOx*+D$@D$tt$@4$_$ <1ɉt$1D$Ӄt$Kf1 É1ۃ- 9D$tsus]t$@ t.t@t$t;D$ uϋT$@$J T$0$,[^_]D$뾍t 눍t$@$: t$0뱋E,1[^_]Ë\$@$ \$c0딋L$@$ L$H0v&' $$$$$$2:Ë$D$ D$ $t3$ہ$$$$ļÍ$D$$ ;D$\$D$$$5D$,D$$L>! $ 9D$t$ $蒁   D$\$$p l\$$ . $誀 t$i} $茀t&l$$D$$$7v $% H5t&t$$s  . $댍t& $ t$| $$ uu?&$uߍD$@D$l$$D$l|$pD$0$ k,v $c{t6${\$$d D$- $A$ ‹D$,#D$$$X  D$,J {$n{\$$ D$, $~D$0D$D$l$D$ D$D$$h,$趁=  1\$8D$4D$(|$<,D$0 Džu. 9 D$(< tʃ= tq|> DD$4;|$(D$4vD$(+|$(D$D$,|$$99w-D$4tD$,D$D$fp $9j\$8}O|$0&ɉ~7 u$t&]Dt t =u琀|\t9Hv OD$4\$8|$<$t@ u$D$,$$D$,TD$(9D$0v$l$0)D$D$,l$$89D$04$D$覂D$$$22\$$8 5*D$(f4$$D$,!뜍v'D$$D$ D$D$D$ $Ðt&UWVS\$p$te$L1D$L$(|$0$5D$8 n$3D$,D$,D$D$D$8$/D$$D$,D$ $z T1D$4t$LD$D$4$yLD$Lt*1 u+v tutE 릍<[u|L[t/<$k||$ÉD$D$$$6921뼐TM ]D$ \$D$ $^saD$ $Fs1D$ $.sD$ ,$sD$l ,$rudh 1l$H\$DD$@ l$H\$DD$@ܱ,$1#б{l$H\$DD$@Աl$$ D$$ ~l$Ht$0\$D|$4D$@ı\$,l$8<h 1 D$ 1$+rl$$l$1$wd l$1$_t$0\$É|$׀>[t.D$:4$ht\$t$|$fFD$]$}htp밍<\$,D$D\$@t$0|$4p l$8l$HD$u-,$k ҉tA1\$,t$0|$4l$8<ÍvD$l$Ht$0\$@|$4\$,D$Dl$8<D$D$D$~ $PmP$T$wkT$9Ɖx)D$D D$$L$moL$P9t | .A+\$5u%t$ (ӃD$\$$d" fD$$j뢉\$@t$0\$,|$4l$8<\,D$D$D$D$ D$` D$$mt` (unkd nownfh )` , <ɉ\$,l$8͉t$0|$4tZ0ۃ~S uCPupuHtֿ 8t 1ۃÍv؋t$0\$,|$4l$86;\$(ƒ|$,~~FD$4ƃ|$,D$8D$:$\`D$,t7oD$tD$ D$,$#bT$tl$,9tD$,D$$l$h$wD$,$$$c$,$L$D$oD$,$D$lT$p PT$lT$pDt$,$7F|$lG GD$$|$8‰PO@G  D$pB<$G $GA,$D$($al$4t4$aČ[^_]Ðt&|$,$$ ^\$$8 r M8DT$xD$t\$tD$x $á D$tCD$xC CD$$$@@ $G $GB$D$l$D$t$ L$D$B $;,$_D$47vT$ 4$T$ D$4fD$,$ ~ :H===t&T$tD$x\$xD$t _T$t  :E‰D$t1DH r$D$PD$TL$[$ $X_$Bw$i D$ \T$ D$0HD$y $@bT$ 1ɅD$0L$8JT$8t0D$q $L$$ bT$ L$$uB JD$,tT$8 Һ D‹T$,QQ &yD$,{YD$|@D$|L$$<$ZL$$ $Y$| D$ D$tD$T D$D$D$xD$ $ Z!D$|P@D$] D$D$ $Y<$Y D$D$$; D$ _ t$( t$(y6 D$,&SX $L$$XD$,D$|P@ T$,D$D$% D$T$D$D$xD$ $X$_L$$o JD$81e$S w$ k$ D$Y$i]$0 D$ D$tD$D$xD$1D$($ D$'1|$ f\$\$ t$1t$ t$K!Ƌ$Z$Z\$t$É'WVS@t$P$ XX;u4$kXl@[^_Ít&t$8t$1 D$4\$4D$<D$D$4$.   D$D$$ D$VD$$J]4$J  1u< tt< u tL9sB   @[^_Ðt&D$$ ̺= :aD$$ 褺 뙐t&$ &W$ #$`\$$ ,$ V |$ tk$ V $ V $  }V $& dVt 4 ,f$qz + t$[ k qz \& $Y $p D$  D$D$T$$ y]"t& $sY$  D$  D$D$T$$ )]t&$  f X 1t | 1Ðt& 1f t +  f \$D$ t$t/$A| \$$]u:\$t$Ív$ vA$\$t$| Ét$\$$ y'| Ív' t k  f,\$ \$0t$$t$4|$(|$8D$= D$ |$D$t$D$$ \D$$$x\$ t$$|$(,k|$t$$D$= D$ D$D$[$<t$$\$0|$(D$4$\$ ,&,D$8\$ \$0t$$t$4|$($}|$D$C D$ D$t$D$$2[D$D$$Zx\$ t$$|$(,Í$<t$$\$0|$(D$8\$ D$4,Z& t  f t  fS\$ D$$ \$h[u g1[É\$$X  [Ít&'tÐt&v Dáv DVSÃ$:/$tQA$Ut$$D$b$D$CS:PSSD$[^Ít&T$OUT$$T$D$믐S(D$0D$D$D$8/t0\$D$ D$H D$= $kD$$[([ÍVSt$ tB>tF4$Ts-9ލvw;/u)4$sD$6  [^Ð1t&D$ D$$M D$ YÐ& t$M lPt8u$[ ٍ'VS$$ t$3PD$D$D$t8u[ t:u\tc$S\$4$D$xD$D$$ D$X4$4$[^͉뚐t&uD$ D$m 4$뛍vVS\$ t0fu$   t10fL օu[^Ít&SD$ $D${ É$.\$$ RM$wM$ D$$P[Í'S$$\$ t3JLu tDD$$AĨ[Ð\$$ Ĩ[V1SL$ t$t&Q\Q   ةuu1[^Ðt&[^á 1VSt$  k2  ˃  LPPu@([^SKá uJf t=9Xux tPx $R  $C  uƍv[Ít&'S\$ $軮\$ [Q&'VSÃ$D$D$D$tD$lK$\$<t$ D$ $D$θ$D$辰$[^$$K$\$><t$ D$ $D$膸붍t&UWVSÁ,e$1l$D$l$$Rx3=D|$/uC=l$$<$FT$@9 u 9v uN9v)^ u &9v ut$19FӉP}AxEƒ,[^_]f9l1t&돍t&S\$ $FGCD$ [6G&'S\$ $GC$ GK\$ D$$ [[w&UWVS\D$e$L1҉L$(D$ $ED$\$LfD$D$$D$E|$L#D$<D$@D$DD$Hڋ !%tDJDD$()څw҉t |K < RT$($E,$LT$(KT$Z tt& uT$$GL$@؍T$<$*D$DtL$HT$D$t$@T$D|$HT$ T$Et 4$/ET$ <$T$蹶hQD$1ۉ$D$Le3\[^_]Ðl$$t$CT$$$G$C4$Gt&DKev1mGHfރfG& 3 $\$|$|$t$K ؉Ɖ$|$1t$ Í&'D$ H D$P[$ÐUWVS<$P$TD$>e$,1T$$\4$T$2@J)Gl$,=1~!t& t߃ 9uT$\$$Ot@P 9t$A1ۅtI$XuY$`t!t$`D$T$T$$+$,e3<[^_]Í&Gt$XD$4$T$5+$`t뇉$T$$T$eE v$X1D$4$T$FN$XGt]1+DT$ D$t$$J2P9}v$t$Ðt&~9Ѹ|9w1$t$f9r9Ѹ܉'UWVSLD$hT$ll$`t$pD$(|$tT$,D$D$$@Í&T$t  :u)L$|$ u/t>;tSC:uÀ;uv$,e3D$<[^_]ËL$D$4$L$t$4$x4$+~|*/t4l$t$<$/nD$ | D$ <$D$=tu11?fD$D$<$4T$(D$L$,BD$(D$,D9t0< tP^vD$D$ <$9uЉ<$D$ˇD$(T$, PT$(T$,D|$$ <$跈<[^_]Í&D$ $踆t$CD$ $蘆D$D$ <$x$ d#L&S(T$D$D$ D$D$$c $=w[X c 0c  c ڃ c ¸c ([$0 "fD$ $A| Ð&,l$(l$8t$ t$4|$$|$0\$t\$t$<$[~)u\$t$ |$$l$(,fu$ f$ )  D$ D$D$) $MÉ') D$ D$D$) $譊É'D$$T$(0D$c D$D$ $Ít&D$$T$(D$c D$D$ $HÍt&,|$(|$0T$eD$1\$ \$4t$$D$d|]tC;t$8sfډ1ɉ3T$e3u$\$ t$$|$(,Ð1ɺ) 'T$T$$X t$$ D$$+~KSL$(L$D$(0 KKDtD$t$0$ t;D$$}KSL$(L$D$(0 KKDtT$t$0$_ L$$L$$g&D$ 8D$(ptD$ |$$D$腂tD$ t$ D$<$D$=19|$,tS|$Tl$ l$$uCt(D$$|CS"PSSDtt$$"<[^_]UWVS,\$@t$DD$9sED$$|CS'PSSDt^1<'t)"o1ɉt(<"t$<\t Ff"t\t ÄuL$t$<$yS<"tM<\t)t[97Go(,[^_]Ít&CsPȀTw$ t&L$H1tʋL$H,[^_]D$<$s둍t&D$ t&D$<$s_WD$CGGDD$C/37*S/70ŀ B sL$D$vD$lD$ bD$ XD$ ND$ Dv&WVS|$ t$$$'|$tC$'tۉ$|$t\u݉|$$\eЍv|$$D$ '[^_IWVS|$ t$$$'|$*t( tS\t6't1ۉ$|$u؉|$$D$ '[^_|$$\뽍|$$\|$$nyt&'WVS|$ t$$$"|$zftG"tiW   t|t&ۉ$|$1u|$$D$ "[^_]#[}$u|$$\뮍{t}u|$$\댍t&|$ D$D$$ +v|$ D$D$$ v|$ D$D$$ v t3 |$ D$D$$ bt&|$ D$D$$ 8{Su ؋$u[Ít&' = i ti t= i ti ti i  i  i  É'UWVS<…D$,D$$T$11D$ D$&D$L$$؋9L$$ЅډÉL$~qt?t$t7B-D$(D$L$(T$-D$ $eT$|\trfD$L$L$tL$D؅D$؉ӃD$ ۉ\$6Ћl$몐t&<|$rL$(T$$P L$κT$l$2$ D$L$GfD$؉ӃD$ ۉbD$ d$$9D$,t&D$ ҉D$,dD$ D$ d$$9D$,uڃ|$,uӉЃ<[^_]ËD$($p D$ \$Ӊt$pR)\$4$D$ 4$)Eډ\$%\$t$É'-$Ӊ뢍l$$ T$f,\$\$ D$$L$$(D$D$$D$Q D$U 't$Ɖ\$|$D$l i $rǡi Vu{tC\$t$|$ÐD$ <$C1tS/4$CC\$t$|$$l  i 녍t&'UWVSe$1  fC-D$4$/ u$l l$8D$$ i D$yD$,yt&to{-|$4$ tC$|$D$p@ D$ dD$D$dD$,$ =dw{D$D$,l$$u$ i Gt&1$e3uLĬ[^_]$l \$$Dt$$ 봉|$$x 'UWVSÁ $$e$1T$=$T$D$t$ډ$T$D$$ T$t$,D$t$$<$D$T$Ku&tD+ uD,1l$4$t[t 8u@D$0L$0 t u$T$,$D$Nj$e3ļ[^_]fpackBed-rBefs$D$ \tnT$($D$(D$t=tRC-t$$+ uS1US US USU CED$VF;t&g L$(T$$D$$D$ lg Ív g g  Ðt&UWVS|$0<$@t|/t |7/uu[^_]ÉŐ$跹l$|$݉$E/.gifEt$nt2$<$ƍ$ht$|$É$ND$8VL$43/D3$D$$[^_]ÍUWVS$$$e $1ɅD$(T$,tE$D$$$D$ D$(D$"l D$$D$ T$~4$v.T\ ǹָDv@uv[^_f@,$Ct9<ty uOT$,$蓐T$$ T$D$;$3T$D9r$D$ D$$;$~v1)9s)Gl$(|$$< uW9s>G< t6s<>t>< ft8؋L$0>t* t%9uD$,$ D$1;\$0t؀8 tݍ$T$D$ $CD$ D$D$ $$ t$8$t$D$$Dut$8|$HtT$0T$Ht$4$t$Yt$$ $D$ \$,$<>$Rv؋$| uʉt$$~u$x( u)$T$$~u$xQ uRD$>$ix _$D$BT$$D$ $T$$D$,-$8 H-t +H H H @ B$D$ D$$$z :$D$D$,T$$|$T$D$ $4$RD$T$(B1$,$/$e3[^_]Ðt&$@T$4T$$D$huv9T$d$|J9t$`rBD$t$$uB$D$ \$,$;xt&$,$/@$ݾ-$ D$(D$D$ D$$D$D$ $iÐt&L$] T$&'VSD$0\$$t$4D$D$,$D$;0y tJT$ $T$T$(T$1҅x [^Ít&uT\$$ yِt&ttG[^f\$$ `y[^Ívủ\$$ Kxv\$$ 8x&VS\$ t$$u t&tC@t$$u[^Í&UWVSl$e$\1T$44y  1҅t.1t&$hډ4y Ƌ u$4y T$8D$08y 1T$&LD$P\$$ {@@@ @$@(D$\t$D$4,T$(L$`D$t$ D$hD$D$\D$LD$PD$T@D$ D$$躠D$ $ t$LD$ D$ 4$L$ $Ȣ4$D$D$D$D$4$'T$X[ƉD$`tC$ D$NCvt$D$4D$dD$ D$hD$D$\D$@$՟D$t#D$dD$ $D$\$ @D$#Mvt$`t L$D$`$ L$Mt$`iNtkD$ 4$D$ 4$t.D$ 4$~tD$ 4$j_f ?CD$,$|$Ɖ$9u֋D$D$;11獶UWVS,\$@u2t&ST$ֹC4S<BRkSPUPUP U @EC0 ȨC0D${T$ ЈC0T$Hu<wC4p,[^_]Í&t$tL$ $u&D$C0됍vL$DkLt&D$,$D$uD$C0SUWVS$e$1$$D$C@$D$ D$l$$/o,$D$[D$ D$l$C$4,$Ԯ"9D$$T@l$0D$(D$, D$4< D$8$ZD,$l$PD$TD$D$DŽ$|...$(DD$)D$$$ŖD$,$(D$(D$ l$D$$m-,$:,$Kt t],$JuD$$D$D$$D$f$e3D$u[^_]Ð&&'VS4\$@D$,D$D$(t$DD$$1҅u 4[^Ðt&C@D$$T$,L$(tD|#l ] EˉT$ D$4$L$D$ 4[^Ív#l ] EӉT$D$4$L$ D$ 4[^Í&T$L$ D$D$ 4$T%v',D$D$D$D$D$$yD$,ÐUWVS@L$(P=AT$(B=J>@b<߃AB=D$(H uCL$(A>D$ D$$苄T$(Xa$! 1D$ $T$$lT$$T$(B>L$( A>D$(H>T$(B>B>D$(ǀ\D$ D$$ǃT$(\$T! 0D$ $T$$訊T$$u6T$(B>L$( I? I=@A>ǁ\?D$ $T$$VT$$D$ $T$$6T$$uu$! /D$ $T$$耉T$$tND$ $T$$dT$$xD$ $T$$DT$$u$D$(H=D$(H=T$$D$  $T$$ ƃ-u({rq{N{m{D$, $T$$貈T$$u{vu {HD$1 $T$$~T$$D$: $T$$AD$D $T$$%D$N $T$$&T$$D$(HA0L$(A@IAȂA@$" -D$(H=@$T$(D]D$(H@ D$$ ;D$(HA3D$(D$(HA T$(BA BAD$( H@ HA@D$$};D$(H@ HA@D$$X;D$ t$$LtPD$,%=@t`=tًD$$$ytɋu щt$$uG$sG0[^_Í&D$$$$g$#$ D$&VSD$ p$tBu ‹C$t$C$謝u vu[^Ð&UWVS&>Ѓ  ‰G$h|$$D$vuɃ[^_]É'\$\$,t$t$ T$$ t$D$C$m1\$t$ UWVS1Ʌt/NPtYBRPSPSP S @C1ɉډ^t1ɀt4t&T$,e3ud<[^_]Ð1t&ot&X$tǍ& ȃ  t$T$,$c[uԹo<\$4\$t$8t$@eD$,1\$$ AtD$,e3u2\$4t$8<Ít&$tD$ D$4$Qo'WVS\$ t$$ 1tft\ 0K@@CHC<ǃ ǃPsaC<`ǃPǃTǃHǃLǃ\CLǃǃ$$t t[^_Ð4$k[^_Ðt&{t&fUWVSl$$D$ eT$\1҉4$D$ BmtA1.T$HŸ \/;T$D9EƉD$$$..D$ 4$lt xD$ 4$lt x1>^pD$0\$4D$D$ D$\$4$0u7$@$ډ1T$0$‹D$ 1҉ЋT$\e3l[^_]Ðt&D$4D$$@T$H$܂D$,D$4$̂D$(T$,$$D$,  ‹D$,D$(Ѓ $ ‹D$(D$,T$$D$D$ T$$lD$(\$D$D$ $T1t&ft&T$ t$B$9$D$ 1҅^$D$ ^ T$ .t$B$z9t&D$(D$D$D$,$‰NjD$ <$D$, $j"  D‰\$t$$ S\$$CSD$C $D$ M~)C[Ë$ D$DD$(D$D$,$UWVS$$$D$dD$8e$1ɉT$,L$HD$hD$lD$<tQT$<$n D$8:-.z-$zL$8T*t D$deD$| $D$DD$@D$LD$0v     <   D$TT$,L$0D$D$@t& tD$,D T$,tD $e3 D$| Ĭ[^_]Í&;$D$|D$DT$,\$TL$0D$<\$T$\L$TD$`5$pT$,L$0D$<\$T$\L$TD$`5$oW&D$TT$,L$0D$D$   t$0BD$dD$, T$0D$ \$D$\D$TT$TD$ $`55lT$H1tT$HL$,A %`x}p$@h-DT$,D$8$T$4v  tF  uXL$,a$I 2L$,A $ D$$ $# $# \\$$^ $p $ $<# $l# fUWVS$0CS CCT$,C D$ ՐMuL$(>|$$ t&F= $t6<C=tЅűFt$$D$뷍&|$$g l$  |$ pL$, $WC<C=@gC=b1tq ɉL$$tg\$ t&T$$*]$t;v;D$$L$ (ƉD$|$ $躾F[uȋT$$R҉T$$u1[^_]Ít&<|$$t]<t<< C= ‰C=tf4$4$3z<#C?t ~? ‰\$4${pD$] t$$WC<DŽ$ ҉$ ׍t$$2vu닔$ \$ tNDŽ$ J:$L$(UD$ #D$$L$($ u\$ u&0x$yU؉;0u+DŽ$${?MD$($D$ D$$tlP$$UPt;C v @$ډ$t@Tk tK9sG$uD$$}C=4@4$K=@|$$txt$4$T$$l$ $`F<$t9L$ 9J w@HttI@uD$$l$$F<tC?0y$T$ S>0tNt$ tFD$ t  ։1@tS> 1uuӋ$L$ L$(MT$ 1DŽ$ t'|$ $ t$$Rsu닄$ T$( Ru$ \$,T$$ft_1f1uQ$t:?uRu@uхt(D$$뿍& މ1@uԋD$ \$,t@D$ t&1u  ։1@uދD$ f"@uD$(t&"@u$ $JwL$( $>w$T$ C u9D$$vuC?t$ <.E u<9D$$t-T$@u 0ۅtF$1ۅth1ۅÍ؋t$ \$|$$l$(,fF$wuO<Őt&Bfnt&'L|$D|$Pl$Hl$T\$@u tˋu$E$D$\$}D$,(vC$tPuBu8t3t?G=@uՍD$,$ډy[t&FvD$덍t&vD$0{\$读(v'VSÃP0$Ktt$$g&C=@u&Pt;F wى$xJt$$|tt [^Ív4$=$H$ D$t&1[^Ã4$$ $ D$vUWVSÃ<@><u&H~Hu⋓LtLtS>Ћ{C>t$kostN1 f ;ss=t@t(uރ  у \$$j;srfC<$D$*sC><$rt<[^_]Ð1-P$tKՉL$(D$,\$$ut$H@ ‰D$$XH;XL$ ry1ɅtlD$ 1҉l$f0>u 9tl$ uD t$t&Íh  DÍ&A? ] (] DÍD$$D$D$ $i8uË@ $T$C@ D$ D$$]M$Ét$$|$ljl$ Չ1tftЋ|$C+l$   ω t$ ȃƒ ЈC$Íxf#mff[&S \$ $\$ICD$CD$C$[ÍSD$$$p$ D$D$ D$@#M; t9 $DË@x$-ICx$I$B$L&'UWVSÃ4$u>CPSpuԍ&{ t $$D S C@S21t& uT$$T$2D$!% ʼn4$ G4$D$BT$D$D$L$19L$tsE E8% \D$,t$$T$4$D$$D$D$(D$;% 4$D$T$D$E2 t!L$؍t4uDD${ ,$˾l$E$$A,$l?;8,$C% D$bfD$0$E^D$41CC"t&D$8$TEKD$81C Ct&D$@$E5D$@C}vD$4$BAC[D$$^ CD$Ɖ$p>4$A[vD$$^ |CD$lj$:><$@C$>D$ $D$BT$D$D$$BvD$<$l@D$D1ۉ$V@\[^_]Ít&D$0$<@Q&D$$|=o&D$0D$$\=D$0$?D$4$?CvD$DD$$$=D$@$?D$D$?Cv$?v$?vCCpC8CD$A+8D$$8D$$T% D$D$E 2$$m% 7ƉT$CLC L$ $8D$$$ D$T$CRC /Ct$K>&7T$|7ƋC T$b$>U6ƉL$C5ыD$0$=D$4$=D$@$=D$D$=jD$8$=D$<$=6D$0$=D$4$=D$8$o=D$<$c=D$0$R=D$4$F=$9=d$+=v$=vCD$$% D$D$H@S\$ $t [Í&\$ [vSHL$T\$T$P$H[ÍSHL$T\$T$PD$X$D$0D$\D$4qH[ÍL\$<\$Pt$@|$Dl$Hs{ T$ u SDЅl$, x7$T$D$=T$x$D$D$=T$x7T$D$,$=T$xD$D$,$e=T$kC1S\$ D$ \D$$JD$$  >$`\T$t&$4$% D$0CC G$u::D$ $T=|{ D$$CBD$($+=xD$(C &vu|CuD2$^3$% D$&$9NvC ~$9벍&D$ $9D$$$9vD$ $9D$$$9nD$($z9D$,$n93,D$D$D$0D$@$2t $% D$,ÍUW1VSl$$e$\1$% T$,t$D$$5D$`$$t$$% tfD&~9s0TR09B׍$T$(L$$D$L$$T$(É͉}M8VSÁ$$e$15ƍ@=\$\$D$$6$ 1$ 1D$$31҅u"/reffFsD$$31҅tЋ$e3uZ$[^f/HEAfFD$1҅ƍv/objFectsFD$$U31҅t딐#7\$D$<$% vVS4\$+e$,1҉D$D$% D$ D$D$$8\$D$$0辬~MD$D$$' t?$& }$,e3u4[^Ð1G6:v'|\$tÍD$t$x։D$\$$/uD$T$\$tt$x|Åi t\$ D$t$$& ] ߍ&/4$tU`3D$ un߉t$<$3\$$|>/tg؋t$0\$,|$4l$8<Ð$3D$l$É$3륐t&D$@|$$D$|2y&tR$2,$ljD$$D$2|$l$$D$6T$u;|$ ;vt% $4$(1$h4$(1tt8/tb$:+$%+|$,D$<$-$ *$6' y$P$U8 ?=,D$ $& !\$$& $P) |$$' $' D$$' D$\$$' t&'UWVS<$Q' %ËD$Pt D$PD$$ },D$(  !%tDQET$(\$(l$( $  %D$ t?L$PT$(cرt \$PtL$P ɉ B<[^_]É\$$ D$$) D$,I1Ʌ11t$ \$(t$,|$$ύt&$qz $Ņ,$X&U8 c9}a /ut  3T$$3D$ e$ (qƃ D$ $' |$P$ @(|$P1&qz ^.D$ qz T$PD$ q$ e#9\$(tD$ 8/t$$fD$ $ 'L$PT$(D$ mD$,$ %D$1ҸU8 L$L$ƉET$PU8 $ "9\$(U8 t\$$ $ 'uiL$PT$(m1\fX 9\$(tD$ $ D$ D$ $$ &t$6' /&-I9\$(  tq$ \&$ $ 9Lƀ 81t$P$ &D$P1l$U8 1Y$U8 Pt$ qz t D$ $19\$(  L$( Ɓ /Ɓ ƃ D$ $* $) D$ ED$qz $) $i' vuD$$ 'UWVSÃ<1L$$t>21׃~7 ~7 TF FuՋL$$<[^_]ÉT$,$4ƍ@< $L$$l$Pl$|$D$ + D$D$$!L$$T$,12^'$$T$L$$É$։$$<$D$ G4 D$D$l!ED$$$E|$D$D$$$+D$$t$\$$D$$D$$$$$$$ĜÍ'UWVSÃ( $ ҉T$~?1ҽ$  ;T$t$<$Ɖ8u݃[^_]Ðt&$ ޹18Dƒ[^_]UWVSӃ,D$@D$D$@ D$tA1ҽ\$ ;T$t$t$8u܃,[^_]Ít&\$T$DD$D$$T$щB RSPSPS P SPA,[^_]Í&$$$$D$$VD$tD$xD$|Ƹu}D$D$\$$uD$$%=uoD$@|$t\$<$D$臇uWD$|8/uND$$u:<${D$$$$$Čf|$t<$d{ɍ&UWVS|$<$t_l$D$/4$uCCsw09v,ڃցu܋T$<2[^_]Í$35 ܨ1[^_]øύt&'L\$<Ét$@ֺ8|$Dljl$H8D1tftD$P3kC D$TCN>xD$(D$ D$,D$l$4$¸tjL$,7 t])Չ3k$ID$,t$($t$D$G4 D$ D$D$D$TD$D$P$C1\$19^v~$t\$t$Ív[t$\$f4$`1uɋV뭍vSD$L$ Px$t0PR\ȅx1[ÐB[ʋ@Í&I1ҋ[ÍUWVSL-, |$`T$d|$,T$8zhT$8B$0w|$0|$,t$D$Xt hD$X$\$\T$0$D$L$L$4$D$8HD$PT$Tl$$$T$D$D$\$l$ D$D$8T$$趛$$L$\$D$0L$,5 T$<ׁ GT$(t0$dL$(GG5 +w  Bt$,;5@ ( 5 vl$ u!bf5 95@ [sO$ {u݋Ct։$CC+s95@ 5 B[r&$T$4L$$ 6 D$$f\l$XōD$T$$$bl$$3 D$afLeD$<1D$T$TD$D$L$XD$D$\$D$Pɺ1T$EƉ$ T$@@t{T$4$4D$G@$$T$ƋD$d8D$d)@@4$諾L$dt$ $D$o#4$ϼL[^_]Ét$$8 jkD$D$$L$dD$ vD$$L$dT$ Vԍt& LD$dT$dD$$D$(pD$\$\$$$D$,)D$"L$d\$A$"x]L$dtxT$d)BBD$($D$ D$(L$dD$D$, $D$1"$ L[^_]ËT$dtE9D$dp@0D$ $D$dj&D$$L$d룐&,|$(|$\$ É|$t$$D$D$D$$19uD$D$<$‹D$Ћ\$ t$$|$(,ÐUWVS$$D$0$T$4$D$}u+9w'}f<{u9s {^+9v|$,(D$TD$,D$81D$4L$0D$T1ۋT$4D$ ,$L$T$i.T$8T:-T$(HT$811Tאt&TJЀ L$(D$dt$ $nÍD$d$D$$S\$d<D$`L$0D$D$\D$D$XD$D$TD$L$ \$|$$t@D$\D$D$D$X$T$4l$$8 T$D$ bD$T1$贴Pf9t$,ƒ)9sW1ېt&<9\{ut;ɉL$huDL$|e3 Č[^_]Ít&1ۉ;T$(ÄɍL$htPu|$h<$n$|G$u xv@tnuL$0BRPQPQP Q @AO|$h<$t+uf^G$vt8tG<$tҍ 9\JC߻vWL$0WQW QWQ GAf9x {D$|$$̸u{}tb8 D$|$$詸u {}t D$|$$肸u {}C<}}T$,1T$4D$4U1T./'$D$4L$8D$HD$HD$LD$PD$ $%L$0D$TD$ D$$ L$=D$4;D$42L1T$,T$8&|@Tu|{u\$,D$8T$-tD$D$ D$  D$D$Ct$(\$$D$0,t&\$$t$(,Í&UWVS$$$$ ,$T$8L$0e$1҉D$H>|$01tftL$0ډǁ0L$8JtDE<:tl1҄u2f<:t<{tBt<})uf$e3[^_]Í&뫍v~EWt9<>u19v4: Jt9tp< u19vD$ D$$E D$t&\$$s< 3Et&D$$$脟E|1v<1\$0\$@t$4|$8t\$0t$4|$8<ÍD$,D${D$(D$ D$<$Mto|$(t0$萄<$4$< D$`2\$0t$4|$8<ËD$,t$$D$L4$D$HD$\$0t$4|$8<Ít&<$P4$< D$25t&'UWVS1ۃl$4uBZt&D$< 4$xtA)߉|$D$ 4$脉t)x9vt$0D$< މ4$7u[^_]Ðtp u!8\tK t6t u\Aru Ðt&\AnÍt&\A\1É'L\$<Ét$@l$HՉ|$D$1tAt:0tJD$O 4$L$,讅L$,1t1u,~u&\$ CD$C4$D$JFD$t̉4$2\$$t$(,Í&'V = S$T$D$D$D$D$}u$[^Ð$t$p8D$8D$D$44$D$(D$0D$4$D$gD$4$D$T$ PT$T$DD$D$ `> $D$D$D$TE4$\T$Y$0$[^fD$ $}1t t 0u zuÍvD$O $xÍt&,\$$\$0t$(D$D$D$$t<$t$=7D$84$D$D$4D$t$$4$\$$t$(,Ðt&D$(D$D$$D$D$ $aÍ'D$$D$D$ $ = D$1Í',$ $0e$1$$$($= u7$e3$ $$$(,Í&|$D$<$ 'Ƹ= DD&\D$.= $= D$=D$B= $= D$D$W= $= D$D$g= $= D$we$(> Q*,t$ ֋P\$É|$$l$(t-xl$ D$t$<$tDt'|\$t$ |$$l$(,ÐC⍴&$8Cuʍ&D$0뷍UWVS\y T$$\$pAt@f@EQ{D$$)T$ L$T$ Ft%=@t}D$CT$ T$$l$D$4$D$t9}C{8\[^_]fD$$0Ѝt&@巁LfD$LD$D$H$D$ D$@T$ D$,|$HFt+D$CT$ T$$l$D$4$D$D$$CS/PSSDD$LT$4$D$D$,D$l$Dtp1D$(-fT$$L$4$!T$4$%L$Dt5uыT$(D$8D$\$$T$ yt|t먍vD$,$zuƂ$*$> D$Z'v'D$ãvD$T$T$D$醢UWVS,$$@D$8 $D$H$LD$ D$4$D$$D$8 D$ $D$D$ $$$$D$D$D$1$4$D$D$ D$l$ |$t$$?D$$uEt =$t*D$$&yD$ $yD$$,[^_]Ívfx4uƋ$$D$D$D$$4$D$D$ D$zT$4$$D$(I#L$LAD$hDŽ$D$@E$D$XD$4D$$$T$4$$kD$4D$ |$t$$kT$4$@$$萡$Dž~y1ӉT$,ōv;G D$#4$'$> D$#$? #UWVSl$l$L$4$gxD$XD$\ǃNjC ˆD$,$i|$t$,$C% = tBt|$Xt$\$Iu*$PX,$pl1[^_]Í$Au*$غjV ,$ $$ _T$P$$T$

D$T$$D$ J(DT$L$ P(D$T$_Í'L\$<ËD$P|$DϋL$TT$$t$@D$D$XL$l$HD$(D$\D$,D$$1r$D$ ELD$*L$ʁƸtT$(FBōnD ЉF(D$$|$,$D$aqD$ <$D$D$D$FqV,SV0SV4S V8SVt4$hs{ DC[^_f$? t&l$ ͋L$9T$$Ét$Oʉ|$9ɉ(u +D$u$t$|$l$ Ðt&~ ݐt&;T$}9҉މu1|/D뱐L$ D$T$ɉHuÐvVS$\$4D$tKD$D$8 D$ $D$*t*D$D$D$0t$$$[^Ít&11ډ$$? D$fSD$ PH+9r )مɉHu [Í&[$? [t&'UWVSÃD$ $_T$TmaUWVS<8D$,&tbtÉD$,$V%+uD$PuPD$4$FVPVVDuD$,84$D$虺<[^_]ÐD$4$蝹FV PVVDHG1ɉD$(1\$TZЀ wIL ЃuL$ D$4$>FVL$ PVVDt&ZwL fZwL f!\$|$(fD$1҅~ ҃-t&+t!1Ƀ.Ҹu T$!Ív\$\$ t$1|$tD$/$T9tktgx:t\$t$|$Í&x/uS9tڍxf9sω t&9s)D$19$#uߍ&1뛍t&됉'VS$\$0D$:D$D$$D$GT9Ér!L$1ҍD$0$C$[^Ðt&t)؉D$D$\$$讼t$0뿐&,@ D$0L$D$D$D$$,Ð&,@ D$0L$D$D$D$$,Ð&t$t$$\$\$ 4$-Wt$$D$Ct"S|/tD$D$i $̻\$t$Ã,D$0\$$\$4t$(t$4$D$D$D$D$e$T4$D$ t$(\$$,ÐVS4e$,1$H\$,$@D$ D$D$$DD$$D$S \$t$ D${ D$${Q$,e3u 4[^Xt&D$$$@ D$D$ D$AÍ'D$$$)@ D$D$ D$Í'D$$$p$ D$D$ D$$Zt&D$$$1@ D$D$ D$$}Zt&D$< ÍD$$D$D$ $'D$ $"l D$'D$$D$D$ $< &VS4e$,1$@O$kO1 &t,w$%,ru݁t Ƅ4,%rƄ,$,\$\$,D$D$l D$ D$D$$EX$DD$$< 'D$$D$D$ $ÃD$$D$D$ $ÐD$$D$$ykt D$$ $w1Í\$Ét$։|$t1\$t$|$Í& Љ~<$p|u4 uƉ|$$S@ 4$D$@ @ 뚍vӃD$ @ t%D$(D$D$ D$$D$ $NÉ'UWV1S1ۍ&t%tD$$^gT$0?9u͋L$,A$:1t$(|$<\$4,t&$P‹D$,uI9\$T$($t‹L$( $.`tZ$@ D$t$01ft$b9$e3<Ĝ[^_]ÍT$($$L$, $D$D$$QT$$u*J JKJ KJK BC$mM$`MIv$I@ D$.A|$;Dދ(lj$%0/$D$ $T$T$B D$D$>D$ T$$ԊD$>D$ $Ɖ׉T$ċB C4$|$D$>D$ 莊D$>D$ $Ɖ׉T$~B C4$|$D$>D$ HD$>D$ $Ɖ׉T$8B C4$D$>D$ |$D$>D$ $Ɖ׉T$B CD$>D$ 4$|$載D$>D$ $T$谊T$XB CT$D$,$&E<[^_]ÍE<[^_]Í&C;<[^_]Ð&D$$D$D$D$ $1Í'D$$D$D$D$ $Í'<\$,\$Dt$0t$@|$4|$Hl$8l$L$A Yx؋t$\$Ðt&A d؋t$\$Ít$t$ \$4$@x؋t$\$Ðt&A ؋t$\$ÍD$T$%=T$tCvSx$;@ te$mwGd$ D$l DD  L$KD$t&,$5 l$T$$C $C S(@ D$D$D$D$0D$$5, u D$=iI t"=YI tkt $ƒ([Í?DD 1 @ HD uu  u뿍t&$=C 2@ [f?랍vVS$\$0D$D$D$%@=@E@t$t$D$OD$D$HC 4$GÀt$D$D$D$^C 4$t$D$D$D$yC 4$t \$uPD$ D$kC 4$И4$D$`$[^fD$D$4C 4$蠘+vD$D$Mf 4$耘떍D$D$Mf 4$`%vD$D$Mf 4$@.vt$D$D$4C 4$&D$D$Mf 4$vt$t$$$\$L$D$ t$t$ T$\$ $t$t$t$t${t&'L$(T$$D$ D$ D$D$$=É'SL$ T$~.0 ut& t9u[Í1[Ít&UWVSLD$l@\$`t$d|$hzD>D$0< D$4 D$<T$l1\$81D$ T$$T$l\$$?T$(T$lT$,'v uSۉt+T$ 9T$(F9t4 uӅT$,D$ 9uӍ&\$8D$ D$lD$(t ;L$ L$(D$l11|$$|$(?D$ 9D$D$$tSD$KBCCD1҃9tG.< u;T$ uD$$+CS PSSD19ut&ҋ|$$t8jt&D$$CS PSSDu+|$(t$(|$t$$D$4D$0KtD$ptT$pL[^_]ÍD> uD$<1l$<덉D$ ,&D$<D$4D$0ǍT$ D$lxtD$ 1St$$|$(D$ D$l׃?At&D$D$$輎SD$KBCCD9l$ T$$*< u&D$$pCS PSSDC1)u멐D$$8CS PSSDvD$$CS PSSDLvt$$|$(+|$ t$ D$0D$<l$D$0< 1D$lD$4t!D>D$<D$0D$<1S\$ D$8D$d $H0tCt7 D DЋCD T$$D DD$v[Ív$E ʐS\$ $(tC% $D D‰D$[Ív't$D$$t$ \$D$4$*Í@v7 E FD L$$2E D‰D$؋t$\$Ív$DE D 뿐$E t&D 말D 럐UWVSd D$`@ɉL$bʉ|$(<$3|$3|$ ݋\$Dl$ |$\|$<3|$41ߋ\$1lj|$4t$4|$\3bʋ\$,4$3\$813t$$|$$t$ t$H11É\$8\$ t$8\$$3bʉt$$t$1t$$3\$\\$$\$\\$\\$@3\$<3\$X3\$(Íbʋt$$l$\13l$ l$b΋L$$3L$ 3L$<L$@L$T3L$Lt$<1ыT$@1ً\$  bӋT$$13T$,ڋ\$,T$ T$D3T$P1‹D$ 1l$$bʉl$$ʼn13D$@ŋD$@D$@D$H3D$T3D$(1bʋt$ NjD$@13D$ |$@D$,D$X3D$D3D$41ȋL$,bD$@11ȉl$D$(D$03D$H3D$8=bʋ\$(1Љ͋T$,13l$,ËD$`X\$`D$(t$ D$T$L$C SKsd[^_]É'D$@@#Eg@ @ܺ@vT2@Ít&'U1WVS,\$@l$HL$D3{L$?StG@)9FS2T$|$L$$?T$t ,[^_]Ð)|$[?v/t$؃@@A?wL$E?L@L$tL$l$H\$@L$D,[^_] t&<\$,\$D|$4l$8t$0t$@;kD$E $ȉD$ȉD$7)?D$D$D$D$$1Tʉu\$,t$0|$4l$8<Ð,|$$|$4\$t$ t$8l$(l$0<$tF9Ct$|$,$!D5؋t$ \$|$$l$(,Ð|D$D$$$D$1҅uD$ 1%=@‰Ѓ| UWVSe$1$$DŽ$L 9;P D$\$$=}L D$$$L 1tC$u$$D$$uL $L D$$C5L tI4$<$D=t|/t/|$$P<$D$,D$t$$utD$<%=udP D$D$L $=P ) l$` L P $ufL $e3Ĝ[^_]Í&L D$/$tF$ ǡL O$$Yt\$$%F ݿt&$ǡL V$HF 赿L $ F D$耿L $E D$苿|$t$$E WD$$E gJ\$D$<$% *v'VS$;/D$$$$CF tD$$$$ !%tDJD= $\$D$$D$D$ D$D$$b=[^ÐD$ D$D$$$$D$t$$/$$3T$$3D$ $$3T$|3D$x D$t$$$$/ Dt&D$\$$x=\$D$<$% Et&$pF TWVB S\$ C18D1 H <$D$tu1[^_ÍD$$4$H $D$11[^_Í\ D$ ҉D$t $G 菼$G 胼,D$ L$D$T$D$PH D$$ ,Ð&VS44u4$`44P44u<uG1҃9rtft[^Ðt&Htvf묍vVS44u4$44P 44u<uG1҃9rtft[^Ðt&Htvf묍vWS44u4$6¡4ף4B0044u4u<1tft[_Íz/tf뷍t&'WS44u4$¡4ף4B$$44u4u<1tft[_Íz#tf뷍t&'WS44u4$¡4ף4B0044u4u<1tft[_Íz/tf뷍t&' 4I  R 44s?  4QK  R 4i<   S8-t9&9t4QӀv_tQЀ vQvكAvѸ[f1[Ít&UWVS@$ UtW11U4Ft31ېTiI ttYI twI t$ ;^rЃ4$ ;}r,$ [^_]Í&'U1WVS,҉D$T$D$t<Ӎ& 19uЉ)‰T$T$4t@D$ft29ku|$s 98uڀ| uӃ,[^_]ÐT$1ۋD$iuD$ $6L$T$L$T$Í@ $ T$L$k4D 48C8D$8$S8Љ@wI ,[^_]Í&UWVSӃlD$I $D${8t";t8@8tB=8t9$H 8@8[^ÐH D$$C88됐k'8@8D$$d&UWVSL8T8~ 81fDwI 9uD$`$T$`D$/$D$(=+D$`D$ D$,t$4D$4$`=8ۉ8t[ktT|$$|$ vkt<,$9|D$D$`,$D$t88u|$$4=84$_ 88=8ɉjt&W] E‹WɉD$$Z6.4 t& G,0}uًT$$L$$UD$/$T$,D$ L$JT$,1:/‹D$ 9D$(T$,|tT$`</tD$ T$$L$D$D$`T$$LL$HT$ D$ D$ҺDD$`T$,D$$L$ʉt&?tD$d~05811ۋT$h|$d@D=wI DÃB9uL1[^_]á8|$$l$`|$,@&D$<D$8|$l$4$aD$4$\T$8D$</BD$8D$E*JFdl$DL$$D$,$RD$DD$\$t$ |$D$I $ZL$$T$DD$$L$Wt& $L$$L$$l$D,$RL$$t$t $lT$,t$ |$$pJ T$D$ &rT$4\[^_]ÍD$D$fR`T$,\$t$$HJ T$ t$t$$\$\$ 4$mt$D$ ؋\$&UWVSLD$Zt$ l$4XZXZ X ZXJ1ۉHBD$B4$D$l$4$ t#D$<%=@t'l$4$u݋D$L[^_]ÍD$4$蔀t5D$8T$D$D$$T$3sf$D$T$빍UWVS<D$ED$,T$ D$$u ]t&D$$T$ B:uT$ t$(D$$N|$ D$ t$<$ÉD$,\$(9D$ t$$;\$(D$$T$  tD$$T$  uދ\$,T$ D$$3x4 KJKJK J KRS\$,D$ l$$GCD$$輧C ~U1"D$,T$t$$iT$9t/T$$t$ D$ ~uȍD$,$L<1[^_]fD$,9xuT$ L$T$$U<[^_]$I ™fUWVS\$0|$4u.)$~D$/<$gu<$#sk $xI<D$~C $(S CD$DD$$k[^_]VS1ۃt$ tGxAF$t2F~)0&9^~ F $u1ۃ[^f[^ÍvUWVSuD$$|8D/uD$,|$,  \$l$ D$ J D$$W;t$Xrt&D$,\$(uxD$`ڋL$XD$$] D$ D$\D$D$P1҅NЃ<[^_]Ðt& D$D$$^ D$ <[^_]ú붐t&D$] T$D$ 1T$:u T$D$ Ð<\$,\$@t$0|$4l$8l$HD$$qD$Ɖ$诟$@QD$DuzT-$tyT%P@BCBCB C BC1ۅx4$ߟ؋t$0\$,|$4l$8<Ð$Tu&D$DD$D$ DD$@D$T$E|$$@-4$讝D&TBRPSPSP S @C t&Tt&\$\$ t$t$$$`t$\$WVD$t$HD$VM1҅t~!6xEЃ^_Ðt&1҉^_ÐUWVS1ۃ -9D$vX9}L9$$t$ȹt9tV<>u19T$v:: J\$t9t4< u19L$vD$ D$$?E 1k1t&<\$0\$@t$4|$81t\$0t$4|$8<ÍD$,D${D$(D$ D$<$t|$(t0$<$8$AK D$\$0t$4|$8<ËD$,t$$D$4u| ts,`D$4$D$Ev<$ȋ$< D$x%'FF_$D$uG&[t9PtPuL$DT$T$$u2[u͍Gunt$u,[^_]Ív뙍D$$5YUWVSt F9sL uF9r#|t([^_]Í&FfFf< uƒF [n^_]ÍYf'f&ƒ iI $t$|$t(0YI tt`] ְ8u$t$|$ Ít&ֿL $t$|$( ø볍&'VS=iI tBt>=YI t7(9u v[t4$D$u[^Í&1ۃ[^Í4$1|$t>lu!~fu~u4$|$Ðt&l 4$|$Ít&'UWVS,D$@D$L D$D$DD$D$$)D$D$.$QD$D$9D$l$|$(9)t(t&3|$l$4$u<>t<[uD$$A|$,$$9C$9fD$L tIL t,1[^_]Í&D$ \$@D$HD$D$D,[^_]EQt&D$\$@D$HD$D$D,[^_]Q'||$t$t$p1\$lÉl$x$D$TD$XD$\tg1D(rD$D1L$HL$T$DD$(D$,D$4|$L\$P$D$($跎L$t&\$lt$p|$tl$x|fD$4\$TfL$$D$4D$4$ulD$($ uDt/t$TMUEut$XL$TT$Xut$\D$\u$a)dt&|$1$L tۍt&|$1$L t뀍t&|$f1$L tTUWVS|$t$\D$hl$PD$lD$PC D$T4$D$XD$D$\D$`D$dD$@2l D$DD$HD$L諪D$dD$ D$DD$@D$ C,$D$T04$t$X(D$X D$h1D$hD$$D$8@D$$4$D$(-uYCD$D$D$$$NjD$$$uNxJ4$1Ћu`,$' |[^_]fC$M D$s|[^_]Ðt&C$8M D$r4$ptD$C$L D$r뇐UWVSӁD$($t$He$1҉L$D$D$(t$D$$>D$lD$$@D$\|$T#ƋD$dxD$3D$,D$4tvt$,D$3iI T$NT$D$<;Z$L$ L$k+D$I $L$D$t$$t$#%vL$D$$4$L$ph)D$D$t$)l$ $*t$|$v"L uC<$<:tJf댍t&D$3D$,D$4D$$1|$3Z$KfD$sD$$4$D$y)ЃD$D$ 4$T$8gD$8D$ $D$at W9:D$ o)D$ vl$kL$D$D$L  $($$srT$D$($D$(L$D$D$L  $(JfL$D$\$L$$(D$<$T$|$3JZL$D$$t|$4|$4ED$$D$$D$1tD$$t~ tT$JZL$D$,T$L$D$D$($1 $e3 Ĭ[^_]ËFHD$$&D$$mvT$؍L$p D$xgT$|9[|$$:l$tD|$~|$~|$ ~ |$~|$~|$~|$~|$ ~ |$$~$|$(~(|$,|$DWO NvbSwz_t6T$H/ 19GFG F tWV\$0t$4|$8l$<@Ít&G랐t&tҋEGf%ÍCdGyll$hōD$pD$D$pt$`։|$d\$\L$D$ $ND$NjD$p86<-T$lj9uՍ$D$L$XD$,L$$VD$q)ڃ:.t$ t&t9s)Fl$L$$dt V9r[^_]ÍUWVSÃyT$gD$ D$X9D$  11S 1ۅ~1 ufᐅuDT$1+l$  nR11ۅ~1 uf1뾍t&u4)Ńn [^_]ÍFF [^_]f1΍UWVSLD$4l$dT$ ‹L$8D$<] tы $T$Ћ@D$R~:Ot a:LuZ9uD/ tED$D$C$DŽ$DŽ$DŽ$D$4$Z$1C$D$4$蔿K6C$x^ < $d $X D$$ t&$-@;$É$׉$t 5xK $^  1i8f4@; [G6t2D$$D$\$$\D$4%=9@;G6$r D$)D$F$_G4D$ D$ D$D$F-$a$$$$ĬÍvDž@;^ fF.fF-.$ $ ػ[<$9W8t\$$/X D$<$G4O|$D$G$$%D$P$DŽ$DŽ$DŽ$D$\$,$)xEG6tW4D$$$T$$,$%\$$8X G$EX D$}'fz4\$Ét$u"] @1\$t$Í&$D$X¸uҋFF$t$C1\$Ít&S\$ CZ $RD$TZ $RD$_Z $RD$hZ $Ru{au {ZD$uZ $lRBu {Ru{tuD$|Z $DRD$Z $,RD$Z $RuPMM4MMMMh D$Z $XD$Z $QD$Z $Qu7MExwMfM@XD$Z $ݪD$Z $Que}xExeD$\$$*t$_ D$Z $L D$ W $PD$Z $qPD${ $YPtSD$ $EPu/ExCMEx]t%\$$Z  ExExD$Tt$(t$$ [ D$t}xuExD$(EtD$[ $OD$%[ $}OD$-[ $eOD$8[ $MOD$F[ $5OD$Q[ $OD$_[ $OD$s[ $蕨"D$[ $NMMh$T$D$1Y BT$G <=tkuYT$TBtBT$,T$D$ $ IT$,R\$$Y 4H$d_ 1T$,D$, <$D$ D$HT$,D$,Y $舧uG<=tbuT$TBtGT$,T$D$ $XHT$,E(Mh$_ zD$,<$D$ D$HT$,J M]\CMh5M'D$[ $謦{ l{ o{g{MM\$,${eM MM@reaM PMD$ ,$yz/;-u{zu{uE0 T$TlMu&T$TSMt4D$(M8ED$(D$ D$$RFE@T$TG[Mu6D$[ $tKtTD$[ $`KuM8aD$(M8EQT$TOLtD$(E/M8!T$Tt$$[ T$Nu&D$ $Ju\ EXD$(ED$ $VuB D$ D$$?E` 9ЉEX|D(EX({D$Tt$$[ D$tD$(EQUXDT$Tt$$[ T$qu,D$[ $Ju$E] E] D$(EE 1҉$[ D$Tt$$ D$D$(D$X $tAtDž~D$($\ D$ S\$ CS9~L$$ S[fD@0CD$$Să\$\$ t$D$ $MۉƋD$$D$(Ft t$$n\$t$Ã,t$ t$4\$\$0|$$|$Dl$(%=kC\tS`D$<$T$>G<$<$ T$,\$ \$4t$$t$0|$((th\$4$}$@$I9}S9~V|$D$ \ D$)D$$;C;\$ t$$|$(,Ðt$0\$ t$$|$(,)D$ \$|$D$ \ D$)D$$;WC뗍'B$9G$G4%=T$ D$<$T$ t$D$T$ XGRO$$T$L$S/7L$(uT$$4$(t&|$(ֹD$$f9D$B6L$(A6ֹB$` D$C Xt&J0CRNƉJ0C \$\$ t$t$$CHD$CD$V D$C@u;C5t DD҉֩t\$t$Í&DDC5҉uʼn\$t$ÍVST$ \$$B\tR`D$$T$61u*$$t$$D$H [^Ð|t$p$\$l$|$tl$x/FD$ Ft C6'CD$Pl$ D$TD$X T$T$DD$LD$H1D$DD$<@D$ D$,,$CD$,|$PD$<$D$?1҅D$,T$$-3,$-T$贘D$\D$<$ԑ$Vt C6D$\\$lt$p|$tl$x|ff{4uI$1] ҍT$\T$\$$ܽ‹$҉D$\uVT$t&D$$(uNC$C$rD$$` D$t&<$8×$$bX fL$\D$\$$L$ 耽F$%UWVSL$tT$T$lL$P$pD$h~ ME D$Lk D$L1ҹ] D$X D$d] 1E!Ћ DEL$XT$\L$Xt,$T$Ћ@D$dD$,!$軏F t&$d$D$pI1$d$(a$d$$h$D$`~UD$df$h|$L$LB4\$ L$D$\ D$$$jD$lt4$%$t$$D$蟊EuL$` T$dI $E] !D$LD$lmEhc$$dD$pD$D$`T$$$h$T$TT$L$$D$d$$ $dU$dr8~  DŽ$4$1r$ D$h|$h1󫍄$L$P$E $%$E|$$tL$hT$TD$pB$ 1$DŽ$ED$H$Eh$4E$E $tFD$$D$貋T$LtBD$LD$S] $ւD$LD$ D$ $#$ExD$H$YƉ$Exn8F@Et $ @F&t$`t$8$\$dt$<$E|t&D$D$ $t&D$LD$^] $,||D$LD$ D$$ $QD$$$w$y$DŽ$ [$\$$$@ $$@$$@$$$P$u] D$(4;0;3{&F4fW4f1fG$oL$LT$Ht$\$l$D$(D$|ċ$($ D$pD$4@$pDŽ$ DŽ$DŽ$EP$E%$$D$81dv@6t$0uv1$$9$ T$@ȃt$8p$;-$WCP҉T$@% L$0L$0A6q$pBvL$0fy4fx4 L$0D$ $DŽ$LDŽ$H$蕰$Lp$+$HDt&%=@+vD$X $^ .$p7$$pDžv1ۉt&G|`9$Q4F tщPƃ|$0v L$011틴$(1L$8 v u-l$8t&;D$0 J uZRt֋\$0$pL$0D$t] t,$T$Ћ$ @D$t$p$p@lrpD$PPED$PD$P2D|$PD$PD$`T$d D$X D$\~*D$P^;\$PD$XT$\} t$Xl$\$ph P] @ D؉$ DE…ɉ\$x$$ 1D$hD$lD$8D$<G4VNFT$@VL$DNT$HL$L<$É9\$F  D$CD@09|7A$D$$ $$$ t&$ʍ&fx4D$$MCDŽ$HH$$$LST$0RT$@D$8$D$ ` D$D$$ $L$8$ $pD$$] m&o0l$0Ճ t'<$D$ҋT$@$qG4Cfkdټ$l$$$ۄ$5c  f$٬$\$٬$C D$] D$D$ $C L$,D$D$t$.L$,|$D$] D$L$L$HL$ $ D$ D$$] D$ $D$D$D$$w$<$@df$pL$t $D$e$L$|D$a D$l$$pL$L$0L$ $5$ L$0mL$011L$8$pt-ы $T$Ћ$pT$@$l$$pl$8|$D$a D$l$ $$ L$0D$0GXD$$ĻD$C@4D$@4D$] D$D$ $EGXD$C${D$] D$D$ $DŽ$DDŽr퍔$$DT$$L$$4$,DŽ$D$ D$T$ $_$$$4$$,c$,;D$$T$D$U D$D$ $"DŽ$$]0F$@$<@$<C@$@G`Ial$D$$<$lD$@D$hD$ll$h$D$`D$dD$P@苅$bX $^ T$($T$(,;SÃD$c $r<[Ít&'D$D$D$D$&\$ÍBt$|$׉$8ƍ@|$\$$D>\$t$|$Ít&UW1VSt=y1t2A t&8pt$9։NΉ98u1[^_]f[^_]ÍT$$D$  T$L$ $T$ $É$։$$D$ T$D$$@~tJ@*t\@%=$$$$ĜÍ&t$\$$@xPD$ D$\$$1uT$0t@t EpfǡD׍D$9|$v@,t$\$T$ED$DT$hD5DıtD$$t [^Ívı$D$[^Ðt$$fWVSt$ 4$t]¸:uVD$/4$1t>4$)Í8D$/$t$t݉$1[^_ÍUWVS,l$@EEEE E\$Dt0T$D fu+D$DT$DUEu ,1[^_]Í@$袏U҉T$D$E~H1t&T$D<;<$CCƒ ШCtM ;t$uD$T$D$ ЪD$ $T$,1[^_]ËT$DEUM&S\$ C$uC[ÐUWVS x,p8~19uo&9tc9uX(44$ۉ\$~.h4;Ut]|$]1|$ f݃;St>9u|$PyuO[&@< [^_]Ðt&|$U$fSP<<@, [^_]fPDf9})D$ ] D$D$c $?Í&St@>u T$ $[Ítԃ[ VS1ۃ@@@u#u[tFt[^Ív t$Ƌ\$X$tFPt؋t$\$ ÍS\$t$ sv,\$f;[t$ ։|$$ωl$(rsD$$5CS PSSD[f9s$[44$t$$D$:\$t$ |$$l$(,Í[,,$l$$D$d:d UWVSӃ,H(1G|D$$4CS PSSDN(9}wV49uع|1FTT$~D$$e4CS9l$ PSSDϋN(9|t&F >F,[^_] D$[D$f[ÍVSt$ $Há[[sCCCCCC C(C,C0fCDC$$胊C4C$$rC8C$$aC;D |$ Zt$~09}At$x49t$u|$w@> D$x09|t$\$,D$(O,|$$1T$ |$1T$39l$ ~ ftV8/PN09}YF@ 9;D$$u;l$t9tT$_V8nN09|F M^0FD$$*CSoPSSDT$FT$NDf1D$|$f-V889؋|$.V8D$D$vD$n,D$8~-N81;9Au&;x9uD$ e D$D$c $c O&|$ Et$y9~t&9D$$D$L$ x0\-5L$ ~u 9~ |D$D$\ؽT$T$Qع|~D$&T$D$.~,D$(~"V81;*Bu;vƒ;ht.9uD$ e D$D$c $c vtՃع\D$$'CSD$ PSSDF9D$@D$T$ TT$ $D$0~$l$$D$,F ڋL$s~+FFFF ډFV19T$VVFVyD$$&CS PSSD8N8|P9FFF19lߍt&|D$ ] FD$c $D$J/FD$lFFF<1[^_]ù\SMV0~2^<1 x9tFFFf9uӋFFFHN0F@D$$D$ 1D$ e D$0D$c $ d uD$ e D$/D$c $d QD$ e D$D$c $c -D$$D$ ,D$ e D$D$c $# D$ e D$D$c $# D$ e D$D$c $c D$ be D$D$c $d D$ be D$D$c $c dD$ e D$D$c $c @D$ e D$1D$c $d t&S\$$tz t3  {tC$D$  [ÐD$$ # u>t&غ  [D$ (e D$D$c $ nD$@WVS |$0D$D$D$t$D$tgD$D$uut$<$D$á@ D$ D$D$D$$ u@ $ D$D$uD$4$"D$u-t&4$# [^_ÐS(D$0D$D$D$t=\$\$$@ D$D$ D$D$D$$_$_#([Ív'S(D$0D$D$D$tCx\$tB\$$@ D$D$ D$D$D$$$"([Ít&&VS$\$0D$D$D$Kt$1D$D$Ctr@ $ D$ t$$@ D$D$ D$D$D$$,T$uD$4$ D$uh&4$"$[^Ðt&$1[^Ð&UWVS,l$@T$DT$T$BurZD$&D$ $tbx@ D$$D$ )؉D$^tc~u븉,$묍t&T$D$Z| wz@ T$D$ BBD$$)؉D$utP\$tP,$@ D$@ D$D,[^_]s@ D$ BD$D$B$,[^_]á@ $ D$3l$@,[^_]<\$,Ét$0։l$8͉|$4@<tIPT$T$<$T$ ut<$t|9r܋T$@B3t&x)Չ|$ @l$$D$ttċT$@)B1\$,t$0|$4l$8<Ðt&{Ӎt&'UWVS˃LD$,@ T$4|$dt$4D$<t$`8\xL$,A4Th T$4Ph t$$D$t$4؍P9sx>ЍP9rD$<vD$,T$,@<T$8D$+D$+JD$,ى<$^D$,@<D$+)9ЉT$$W9T$$t-L ɉL$01ɀ|_1 l$0u19T$$t&,1 1ɀ<_ 9tT9!B <_ u6t&9B <_ u9sVL$hD$+؋l$8)GD$h|$ D$D$t$,$蘹v1L$h D$D$e $f rv'L\$<Ét$@Ή|$D׉l$Hl$PNvD$$g ft&$(h |$Tt C\$u$L$T$\$$t$(,f4$T$L$ضt$$D$L$T$$L$T$$D$D$U \$$t$(,Ð$\$Ét$q$5Kt$D$ m)l$,9t$(D$0D$ D$$&{ wVT$0D$DL$(D$$T$61҅t(D$Dx L$Hxxljf T$$u9D$ t&ljͺ͐t&9M|$|$LD$5; D$ D$D$ <$!%tDQDD$ )$D$ D$ >,$/T$ ¬$D$ D$ LD$4BD$44#t&'UWVS,\$@T$9vN{9s{{ u&{ t9ul$DD$D;vu9r,[^_]ÍvD$DD$=D$D$$,[^_]ÉfUWVSD$0$e$1D$0T$PL$T;D$0t"'D$0D$0ǀ@d /L$T|$ $D$X1DlrD$0t&pPuXHuT$0$ BL D$X D$0D$DHhuCP@u<D$Dt.h D$Dtt&p iuD$Dtl$TD$8D$<D$HD$@v\$DL$@tL$0D$@;D$8D$0#T=T$,)T$4S$ $L$,t%$x$x9O>C<uD$4$DŽ$D$T$ $CD$l$$z$g XD$0L$T|$ $1uqD$XD$HD$@$1uGL$0iHu uD$؉|$,$aV;|$8rt$4|$Ll$\ ǀT$8L$T,$T$T$PD$DT$Pc1\D$0T$,L$T$T$T$PaT$P$pP @L$lT$ $D$D$0T$lT$PZXTT$P$$谧T$0¬$T$PD$0lD$0:^L$HD$5 D$ D$L$D$ $覫ڋ !%tDJDD$0)ډT$$\$$D$ D$`f T$P$T$0¬$T$PD$0D$0D$ D$mf $ب\$t$t$ |$|$(D$@$_xÉ<$`|$C 6 CC CD$$CF ^ t$\$Ít&'S\$ D$@$^T$$PT$(PT$,PT$0PT$4P SC[Í&'S(\$4$訥T$@\$T$T$t<'<\ ffÍv'$\$Ét$|$4w\D$|$$觟Ћ\$t$|$Ít&'WVSÃut&t &u4$袟u MftFD>ut41&t tw\9uՃ[^_Ít&[^_Ív'UWV1S|eD$l1$=$$Q=T=[uD$2$[D۸D؀?uL$$a$ɞD$$D$誆t$:D$2D$[4$f$um}1Bh 1]  =:T$le3ƀ\\|[^_]Á|\$|$$Xi Hk$ӝ$D$$D$(FT$(D$ D$ T$,Pƒ&t>,D$$|$$D$ D$ Pƒ&u‹T$$T$(T$w׋ƒ E‹T$, $L$T$D$qT$L$L$,T$$돍&D$$=ƀ$i Ęt 8'k$T$aT$=T$D$ D$$tVT$$Ɔ@D$ $h 2D$ )t$ t$$D$D$ T$D$4$誘T$$&1L$h qL$ SD$2t$,$Al$$h Ft&D$D$$考 Ht&D$$T$蕕T$t$$4i D$:GT$t$BT$ 4$T$2D$.4$4$貟$褚ƀ.@D$ D$.T$$視T$D$D$ )щL$$菂^f w $T$葔 Vf$i [uًl$D$$H|$ËD$$GC `C`&D$: u!D$t}D$$UFCt&j t8j  D$t8D$$FC l$fD$tD$$ECl$D\$,D$@j t$0|$4l$8<;\_\$L$t$Pt$d|$T|$xl$XD_D$_D$4$豎1҅u;__t,T$l t&Gl] >l OT$ D$D$l $r9uƉl$Wt'|$,$\D$l $D$~t$$xD$x%$D$"l $D$~@ {LD$$ ΆD$Xt.1CBtSDT$1҃{L$‰T$J{LpF,eD$PxCp$DD$PCDT$`D$LD$@D$lD$HT$t$D$XD$@D$ CL$]Sp҉T$,qT$,$詁T$h\$1t$$Dt/$cu#@ $ D$蒄D$ @ D$$m|[^_]Ðt&HH<-\$4D$`$D$`D$dT$h PT$dT$hDT$`$D$D$]n hD$8T$,D$D$`$T$LT$`$D$D$dT$h PT$dT$hD|$d|$D$l ${D$|$dv @ $T$?SAD$PD$D$lD$ D$DD$t$$&F$@ |$D$D$ D$h$f$ 輂&D$誻dt&F$VcB&CBD$ht&D$4\$<4T$0T$d9T$0< t1111ɉ\$4v1<@;T$0< tvt<@1<:ÉEō\$<&룍t&t$$3 &t$$31\$4`+ \$\$ t$|$`4$CJBu.CPtC@tQ4$h\$t$|$Ít&ǃ4$g1t$\$|$É$ tC@ t{LttWt34$T$Ћ@ D$T$ PT$@$}@ $ D$U/D$< $wfUWVSZ9}=3L$ ‹l$RL$H|$3|$$1 t;L$~9|$o 1<[^_]fjrT$Dm$- L$y$D$ C~dt$NItT$ 1|$, \$(vBB 9˅y݋qΉZ2Ӆ~'T$ 1BB 9uߋT$ Dmt$ FV AD$ QD$ 9 D$ l$$c[\$ s\$(|$,$n &'WVS5it4=i~fD$if9u<$]fi[^_ÐUWVSӃ<5 D$(D$TD5@ D$(… ˆT$/,D$eo D$ t&8DD$ D$po D$4$cCuыEtt$$ iE5U$T$$&S5ɺSo 9o Dх DD$ T$D$4$bǃI)CD$] T$ D$o D$D$4$LbT$$$)D܅D|$PuCuD$0o D$4$bNjCt5S€u- D$ D$ D$4$aǍSt>KC] 5o T$DD$ D$o D$4$aǃ;"SЃB@Cu1Ʌɺp Ho Dt$$ hD$Mf D$4$aSDž=kt$$ gC8D$ D$u D$4$`_vt$$ g|$/t*D$(@t t$ D$D$$`o f<[^_]fD$o D$4$@`D${o D$4$ `QD$(@t$ D$ D$$Yo ft&] 0o t&] 8E׉D$T$ D${ D$4$_CuˋEfɺNo Ao DS\$ L$u7D$u$o [Ív$o [Í&D$$o [Ív$Xt$t$ t@1$t$Ðt&Xt(~,X$JB1t$Í&Bu"BZL$ ڋt$$U fB 돐,|$(ljȃ\$ Ӊt$$t2Ot%CSo 4$\$ t$$|$(,fBu:u WtCu v$p  &$q CRo 4$u뙍v1҅K uS 1\$ t$$|$(,ÅC [ 1U3=5/7-'<$at$<$D$/$81&Ct GC ډ$D$\$<$St&1ɅS u  1XCet GVD$ډ$¸[D$D$D$$S9vtC S 1#t&tC S !1 vCt GD$ډ$¸D${ D$D$D$ $^T$1:CSo 4$cCt GC ډ$TC 1>D$D$vD$D$v1~fC S 1C S uC S 1t&UWVS,D$L$IL$9j\$1ۍr$f$< 9l> DڋuD$ tyT$B t&2 uL$t$ $HNjD$p>DD$pD$|$$S<$\,[^_]f\$1L${EL$AD$,[^_]`뽉'҉L$tT$$o U ÐD$$p @ ÍUWVST$0l$@|$D!19rtftD$4zBD$8D$8BD$$\$@t$D|$HL$Zt&D$$ ]뱍t&'D$ D$cp D$D$ $PD$(D$D$$$t&SD$$\$ tHT$$T$D$ $RT$$:uGuS 1[Í&` 9}fL$(D\ ΐ)(MvCSo $q[ÍSD$ X D$$D$$Ѹ1[Ð&SD$$\$ T$(t,D$D$$tx S 1[Ít&Ҹ uˋC fCSq D$ [t&L$ D$ɋP uxvt!~-1Ít&1Í&x1Ít&Ґɐ&<\$0\$DeD$,1|$8|$@t$4t{t$t$$u=4$ktIW $T$Zq1T$,e3uD\$0t$4|$8<Ív\$$hp ΍\$$p 붸TfD$|$ P 1Ív'WVS\$t$t#t!1 $8t9ىu[^_11ɐD$f$9ˉvދ8ҍ:xzxzx z xzxzxzxzx z 8u[1^_ÐUWVS|$<;>tk9une$Le3J\[^_]Ít&9tx u,1|9wt&\$<\$<$8)T$,T$LT$D$LD$ $ID$$YCS PSSDF>.u<.uF<.t1뗋C19D$$s=K|1L$,-|$,vLp-w ;D$$uT$D$$ōD$$O G4L$,+T$,W8D$D$$+D$,OG< +D$$TCS-PSSD[D$$1Pt&S(D$0D$D$D$t4T$4\$D$PX D$$T$ $([Í&iu鍶'$$\$$$߉$$P1$$ҋ$l$$D$(FD$|E,D$0t+T$T$t T$D$,T$us$\$ D$m 4$D$ 1ɉD$$D$0;E,t$y%$$$$ĜÍT$,$LD$0xvUWVS,t$\$Hl$L|$PD$P4$T$DD$3o 4$D$T$DD$$D$4,$&l$$D$TD$TL$T$$D$$CS PSSDD$X~T$TD$xs $T$薎t<$&|$$D$ڊ|$@t4$諆,[^_]Ív$D$pCS PSSD4$p,[^_]ËD$$D$8D$$D$D$D$`t&'UWVS,l$D|$Ht&u1ۍv< uE&D tuu|$@T$L<$DD$蚄D$Lt=T$LD$ T$GG$!D$LGtm9WG\$t$<$腉D$<$5GW PWWD1ۉE2,[^_]ÉD$D$<$D$tv- \$\$t$t$8tt$\$D$t$ Jv'UWVSl$$B,$D$XRT$@$D$\D$$xl$XD$,t D$,D$Xŋ$ET$0҃$T$(D$OuuT$@umȅD$@t^111t& Lօt3t1à LօuD$@T$\D$$T$8$R T$<$T$D$T$4t&1 t&D< uDD$X$\9K u0E룍vt$$$B$t0ҍ&@uk2T$$$襁$r$|$0ND$$$D$D$s $薆|$Dl$H$\$$($vD$D$p ,$XtЉ|$$^u뾍D$$f <f  u |$4l$X$l$\$$l$X\$t$RD$X|$0D$Xr$\$XrT$(\$T$ $T$$$$$I$D$$$|$OBыR PQQDt$9rf$B!D$,$Rl[^_]f$CPD$$T$8ED$ $s T$T$ TuD$%=@/DȄu6D$(%=@t!18$t$|$l$ Í&/8Ѹrϐ&$\$l$ l$$t$t$|$|$ 9NՉ9(uB9t>\$ u\$@/Dˋ\$ t&/tF)А$t$|$l$ Ðt&\$(@t/tƍ&/u뽍'l$ l$$\$ t$t$|$|$9ӉN9(u/9ڸ|&T$ 01ɸ09M$t$|$l$ Ít&UWV1SD$$x s9~ID$$(>DP(DD$D$,T$ D$D$($ t}9~ ߍvÍӃ[^_]Ív',\$\$0t$ t$4|$$l$(,<$|$0S1O( C 9։Ss")T$ōTT$,$\$t$ |$$l$(,Ív'UWVSl$1ۋ}ut/1 9J(tJ(u9uE ][^_]Í&'UWVS|$4\$0<$|$$D$i|$1ƋC$!;ss7,t&t$$9sv(|$D$ct׃1[^_]Í't$t$ \$|$|$$^(uC$W(uC$19t\$t$|$ÐDD9ۋ\$t$|$ÍS(\$0C(%=uC$SD$D$4D\$D$D$ $/([Ív'L$A.t/tu*1Ðt&Q/t~-guyit>ft/u빐t&ft.u։Q/tu1Àytuv⍴&'$@v DT$4BȉCD@0CD$$ol$<CD$jsK$C I 1D$0D$,l$(ouC$T$$^T$$HD$(uC4$5;{|$0GLs T$,L$4L$(t$,ȉAȉFAȉFA ȉF AȉFAȉFAȉFAȉFA ȉF A$ȉF$A@tQ>f' ‰V(Q@%=u$T$$JT$$NDT$ $D$T$04t$$S~V(@uC$T$$T$$Fl$($T$Jl$,*ˉ$ J J =CUERul$,\$,$T$(B;T$0v\$(l$;Gw9T$$D$$T$o(xg&@uC$`Hl$$ËȉGȉCGȉCG ȉC GȉCGȉCGȉCGȉCG ȉC G$ȉC$O,K(O0K,O4K0O8K4Wt`ffS>S@%=uC<$T$T$D$D$$D$ $ٍ$,$0$9t$1$B$TD$DŽ$TDŽ$XDŽ$\$$XEERT$$$A$X$\$$$}$MQ$B$TD$DŽ$TDŽ$XDŽ$\$W$XCUER$$$$X$\$$$q$P5ii$D$,$i$|$D$i$90l[^_]ÐuC$tFDŽ$HDIRC1l[^_]Í$Bu$tG$o(mt&$~it$l$$ $t$D$i$9$3Ol[^_]ÍD$,D$$$D$D$t1ۋ$BD$xBl[^_]Ct&UWVSt$0\$4~ u0n~<>1ҍ& A%=t6Ft/;Aw*C4$D$t/\$0[^_]W&9u\$0[^_]9\$0[^_]鸢&UW1VS,\$@$kk11f;C 4F(0tND $L$%$Ǎ@LD$赥L$|$L$PDʼn$T$ GE(FED$l$$T$u.|$T$$;CQ,[^_]ÐL$$v L$蜘,[^lj_]Ã\$\$(t$t$ |$|$$t 1|/)É\$|$4$1҅xЋ\$t$|$Ðt&в;Fs4F(%=uC$9úuD9럐L\$@t$DƉ|$HeD$<1D$$/4$\$D$ 4$?K t(T$NjD$xtD$E S;SGo}5L$Ѓx1ST$G)ڍDT$t$$>"t&D@0D$$蒙떐t&4 |$|$ \$t$tetrD$ T$4$D$x,4uΉ<$胏$x D$Cv\$t$|$Ít&D$$0 k,t$ t$4\$|$$|$0l$(^(0 tOGt^VDT$$QNj@tfn,W t.}aD}l:}l0}&t$$D$\$4$.D$,$D$H>@$4$[*,$C1\$&1ST$€cS$€MtHtSu |$|<$? ?  ƀuu|$ƀ4$o&VSt$ t.1ۀ>u /fÀ:t&D$ D$$T$ u݉4$EÃ[^ÍvD$ tJwD$ uf tD$ D$$WD$ u1É'UWVS,tlD$  [^_]ÍvPJЀ gp1ɉ҃ LJZЀ v9?T$ /VB< %^1ލ&҃DBJЀ v9T$ Vt&UWVSLT$`L$dZD$0‹I\$4\$(ʼnD$8D$lL$|$u7D$C\$,t$0|$4l$8<Ðt&$] uktl$ D$"l D$$clj\$,t$0|$4l$8<ÍvL$T$ D$"l D$$(L$wt&D$ U D$"l D$$n'UWVS\T$tD$r T$T$p$%\$tT$pt$tD$4D$UM E$Pk] څU$t kE D$E$>CE kE @뛍&<\$,á t$0։|$4|$Dl$8l$@  ,$L$΅l$$ D$$貅\$$ D$vL$t$D$ $ L$l<$v|$$ D$: \$,t$0|$4D$@l$8<鱈L$D$$  L$+D$ D$&D$ $ st&'UWVSe5$|1$D$@T$PƉ$\$`l$`D$|󦋕p|ۉ$(x X D\ E‹tD$tX \$pE‰D$x$D$@P D$|$XD$dD$T$XT$TD$hD$89T$Ts$D$T1ۉ1Ҁ8 ƒ9u\$8\$htD$T| t\$h\$8\$h\$8D$\$4$:x~$@D$$$XD$T$t3t@f@E‹t$@D$dF D@l$%m\$@D$C$L D$B"0 $<T$@\$ DŽ$<D$$\DŽ$@DŽ$DD$D$TD$B$ư2D$T$o$\D$$D$T$\$XL$@A$m D$T$@B$] D$@҃ⷁ D$D$ $$mD@ D$D$l$zkD$4"G&$+BuD$49|$4t'@ ]D$u$ uD$49|$4uًUEL$D)@ D$D$|$jxl$D$ $jlL$1Ҩ¨l\$0 kt$@؋$8 $$<΍t&$0D$TDŽ$D$ D$] T$T$,$^L$T $"3|$$T$(D$0T$DT$(D$ T$HT$ B$1;$T$$$f,uҡ,Ep4$kT$ ;Buz9uET$ L$H+L$D0\ S s XZXZX Z @BT$$L$ R4Q(@ A$t&T$ ҉T$ T$ Bۀ|$O$@ $$@@@ @ $@D$$o|$0tD$0؋$hu[^_]Ë\$0t"Ct$@؋$8}uދ$@@ $@D$$nq'UWVS,\$@$轂1҉Ƌ@$tf@u$1 v$t6t&>O:yzyzy z IJvuыT$Hl$$D$T$T$DT$ ,[^_]ÐUWVS$D$lD$pD$t%D$@0uED$@҉D$@E‰D$<$1ҍ,]s4ftl}|$04ft\@tNtF@t8t0KD$0L$DHT$,L$L$D $mT$,tvT$,$ E$ L$ll$ $Q$T$,9$F$fD$lD$p D$t$Č[^_]Ív8uJC6t|$0G6t[T$,D$$?T$,u؋]0`L$D19D$\<[^_]Ít&|$11D$~|$$ƋHT$FFT$D$$]D$~aO1L$,1ɉ\$(T$(X t1@D$D$,#D$ 9NTzuD$Zn;l$u\$($j^11D$f@x fL$ $T$t$At'Zt 9CË$t$Ívr1$t$Ít&'UWVS9rtP|$(u_|$,D&C9w܍&)L$$T$ T$ 륉=<$D$(3$[D$T$ D$D$$VC\$0t$4|$8<Ít&+t\$0t$4|$8<Ít&'$0\$|É$$f~4L$,6T$(4$t$ōD$TD$,$&sT$(f~4D$XT$(4$Zt$ǍD$\D$<$&t$TL$\T$(D$`<D$l1D4rT$dT$,D$hD$4$D$J D$8D$4D$D$lD$D$dD$ D$\D$D$T$t$ht D$T$Vt T$\$V\$|$$$ČÐt&s1D$TD$Xf~4t$T11D$\D$`1tD$LD$ CD$D$@$D$T:D$LD$ D$D$@$D$gT1҅‰UWVS\e$L1|$ D$BD$@T$D$DD$HD$<$UT$?1B8BD$j $1ۅd<$Q$UD$@D$D D$H$$Le3\[^_]Ð4$(9$~44$uًL$,$tōD$@t$$5뻍v$9~?$t ލL$؉,$Pۍ 1ۡ$u9$ X\$LD$ \$|$$W<$P\$$  UWVSLD$(l$`T$,D$$D$(P$X<11;uI&;D$8tbD$D$8D$ ~D$\$,$Qu D$<À;uD$($L[^_]ÃL1[^_]Ít&{t҃듐t&1u‰))ʍ0tD$,T$t$ $D$T$$UT$$uD$ ܓ D$D$ $ Q&'UW1VSӁ\,$e$L1TD$@D$DD$HD$؃D$$19~&fx4uxCfx49څ~"1ېt&$%;$|D$$QD$@D$D D$H$A&Sfz4t$$qvL$<$t$Le3c\[^_]Í&$1&SCfx4un$^;5$2fx4t΋Sfz4t<$<u‰<$L$L$D$C<$9D$u땍vL$<$tD$@\$$&s<$L$L$D$C<$9D$t&|$ D$l$<$P\$LD$ \$|$$$S<$L\$$“ t&D$ $LSv'D$P8u @$1҉$ټ$$߬$$ t$0f$٬$ۜ$٬$$fl$PD$jU )x\$pl$|$$'AD$tD$ R D$ \$$|$@D$l!D$ D$2$ D$=$T$pD$t$.\$ D$ $fD$PD$ \$ D$,$jD$ &D$,$@fD$P|t&D$,$[UWVS<|$Tt$P|$TbT$TD$@dvw 9rD$ d$ T$ T$,D$ $*AD$( l$ D$$l$;T$ D$$;\$l$(D$$\$Pr|v1  3 u9L$$St8UT$,M!ʋL$(ы9}) 9\$Pwt$$랍l$9\$PUv\$ tc1t&,@vKT$(D$@)l$@1ҍv4*م~!t&@IVڍTqsYu̓;|$ u$;\$ T$4S4$?T$P,L$,0PT$TH L$ P1tCl$$l$(1DTtt&X Z@u;t$ uӋl$$)L$ 9D$Tu\D$($V;<[^_]ø/D$<1[^_]D$,D$ D$($ ;1D$ D$$D$4 $D ":v':t&'T$1tfUWVS\\$xt$tME$D$K$ w |$KZD$0 L$0 $?>D$4|$p1ɸWv|$4t&ЃȀwAl$4T vуɀ wL$4|$pl$p\$@D$|$D}9މ|$<r11ҋl$4 &w,߃D  3 9t$@w9t$@L$T$8$$D$D$(#L$L&|$JF|$p 1\$,D$, É3 #G |D9T$@ʼnt$$)T$ 9}9_ut$^8\ euً\$L$(|$L$(|$(l$(L$ L$(|$$l$L$,l$4B)ȉLD$4$4D$4D$4\[^_]À|$KOD$8T$9$"D$KbL$8T$D$,D$$D$ D$iL$8T$ T$(l$ρT$$T$(T$,T$-L$(\$|$D$,D$$D$ D$L$(l$(|$NjD$(\$l$l$(%D$ D$(l$$%D$,D$4D$4\[^_]ÐWVSD$\$Ht'01҉1f;t9F׋Du[^_1vUWVS,D$HT$Hl$@89BsVD$H1ҋH;(t,9s2XuT$D(PD$H@,[1^_]Ã,[^_]Ðt&1뷋B\0\$$D$T$HBBtwD$|$D$l$ǐt&ot=D$H1ҋp;t"9w1ҍփxuT$HhBD$T$9T$ul$D$$1T$H:'UWVSD$08h1t011DtT$8$T$T$4x ƃ9u܉[^_]fS\$ C$U1CC[Ð1Í'WVS1ۃt&r 4$ 1t4uރf[^_É'\t$TƉ\$PeD$L1|$Xt t"T$Le3\$Pt$T|$X\Ð8 |$8|$ D$CD$C $[uSD$,$ʒ$^G0VT$D$D$ D$@D$I $JD$|$$薖D$,FFC3UWV1SÃL$T$4L$<1ۉD$0ttD$48CQD$8*,vE9D$0T$4|*/ f{T$4|$4lv*t&/ujKfx^$P$D$,D$H D$,@@SVSU9T$0wƋ\$0D$/)l$4\$,$~4 D$<D$l$\$ D$D$I 4$ØD$`D$4$D$ D$8L[^_]Í&D$4S8Px/S8Px/vi+T$49T$0Y8SM뻉ސD$ Z D$D$ $ -D$ Z D$D$ $ ,D$ x D$D$ $ , UWVSZu Dt&t$<$D4/uېt&{uߍC K$EDtۃ[^_]É]1[^_]Ít&'\$\$,t$t$ $t$衣u t$$a1\$t$Ív\$\$ t$t$,$Wu$X1\$t$Í&'\$\$(t$t$,|$$.|/tE;wMuD$$ډ$<1҅‰Ћ\$t$|$Ívf@D$ J D$D$ $ + WVSӃ$w]1Ʉۺt=t&YB/Z9uL?ȉD$$-[^_D$  D$"D$ $̜ r*v'VSD$ \$$04$,t$$D$虑$D$ICS PSSD1[^É'\\$Lt$P։|$TD$l$XD$,D$0D$418u\$Lt$P|$Tl$X\Í&D$8D$D$D$,$$$le3uN|[^_]1D$ D$D$ $ #$$, D$eh(UWVSكLD$(|$dT$,D$`L$3\$4u 9\$,D$$D$8؃@D$ D$3D${D$$$ry<[^_]fMt9s7GOD(맍T$L$D$<$xL$T$" $[ tÐбH DƒÐt&WVSp$eD$l1t$$D؋K9 DD$$@nCC1t4$C {CCuD$le3p[^_$uލ|$X|$4$6!uʍD$D$ D$DD$D$] <$D$DT$$ D$D$ D$0D$HD$$D$(D$,D$4D$LD$8D$PD$19rtft[tf뵍UtWVS,D$D$D$D$D$D$D$$ D$$ud, \\$LË@l$XՉt$P|$TtZd1t6Cu,CD$CC\$Lt$P|$Tl$X\fST$D$Hl$XD$Tl$D|$p$|$$l$$T$8L$$$D$ t$|$ L$$\$,$L$@T$8$$$T$ $L$$$|$$t$$l$\$<$t$T$L$ Ĭ[^_]Ë$\$<$T$H$:D$Ls$$t$0|$4$$t$@zl$D1ҋ|$p$$l$D1|$p$$$L$DP t9t$ 3DP t9넍t&|$ ;|$4}0QL$0t$ t$4v9DB &9ut$ 9f3DB t9u19[^_]Í&3D$ :T$ L$4ߋt$09‰Ǹ8[^_]D$@7T$0t$49} 8 u9|vUWVS,l$HL$@|$D1u69r19t < uL$@؉1,[^_]Ív9s tވT$ T$ L$l$L$\$Őt&DE #HD]  ЍP9w܋\$\$L$t|9tBL$&19uL$&D$D$1T$9vQP @\$&\$ Ʌhƍ&L$L$t$ 뫋\$t&'L$v"09v ҃vDÍ&'UWVSD$(D$`D$$tL$` $D$$D$dD$0tD$d$D$0K)l.D$D$ $T$D$<T$ō.$D$(l$. .KSD$D$ $Ń|$t*D$D$=D$.$Jl$. K.S D$D$4$jT$D$>T$ō.$L$$l$. h.1E‹T$ J`D$D$ $)L[^_]Ðt&`L$.D$|$L$|$0l$. .L$ Q0D$ L$alloc%sinfo/refshttp://https://Authentication failedHTTP request failed%s has invalid packet header# service=%s--include-tag--thin--dry-runRemote needed fetch git-upload-packfetch-pack--stateless-rpc--lock-pack-v--no-progress--depth=%luFetch failed.list for-pushgit-receive-packref parsing thread failed@%s %s push send-pack--helper-status--verbosehttp-pushgit-%s failedoption verbosityfalsedepthfollowtagserror invalid valuecapabilitiesoptionokunsupportedstrbuf_setlen%s:%shttp.sslverifyhttp.sslcerthttp.sslkeyhttp.sslcapathhttp.sslcainfohttp.sslcertpasswordprotectedhttp.minsessionshttp.maxrequestshttp.lowspeedlimithttp.lowspeedtimehttp.noepsvhttp.proxyhttp.postbufferhttp.useragentgit/1.7.5.4Pragma: no-cachePragma:GIT_HTTP_MAX_REQUESTSGIT_SSL_NO_VERIFYGIT_SSL_CERTGIT_SSL_KEYGIT_SSL_CAPATHGIT_SSL_CAINFOGIT_HTTP_USER_AGENTGIT_HTTP_LOW_SPEED_LIMITGIT_HTTP_LOW_SPEED_TIMEGIT_CURL_FTP_NO_EPSVCertificate Password: GIT_CURL_VERBOSERange: bytes=%ld-Username: objects/%.*s/%s while accessing %s ref: %%%02xobjects/info/packs pack-.pack Getting index for pack %s objects/pack/pack-%s.idx%s.tempUnable to open local file %sUnable to get pack index %s index-pack-oobjects/pack/pack-%s.pack%s.prevfd leakage in start: %dError creating curl multi handle. GIT_SSL_CERT_PASSWORD_PROTECTEDReceived DONE message for unknown request! Unknown CURL message received: %d Unable to start HTTP request for %sUnable to open local file %s for packResuming fetch of pack %s at byte %ld Couldn't create temporary file %s: %sCouldn't truncate temporary file %s: %sResuming fetch of object %s at byte %ld requested range invalid; we may already have all the data.strbuf_setlenGetting alternates list for %s %s/objects/info/http-alternatesCouldn't find request for %s in the queue%s (curl_result = %d, http_code = %ld, sha1 = %s)unable to write sha1 filename %sfd leakage in release: %dRequest for %s abortedFile %s (%s) corruptFile %s has bad hashGetting pack list for %s Getting pack %s which contains %s Unable to get pack file %s %sUnable to start requestUnable to find %s under %sgot %s %s/objects/info/alternates../Also look at %s bad config value for '%s' in %sbogus format in GIT_CONFIG_PARAMETERSkey does not contain a section: %skey does not contain variable name: %scould not lock config file %s: %scould not commit config file %sfailed to write new configuration file %sFailed to expand user dir in: '%s'core.autocrlf=input conflicts with core.eol=crlfInvalid mode for object creation: %sMust be one of nothing, matching, tracking or current.bad config value for '%s'%s has multiple valuestoo many matches for %syesoff[%.*s ""] [%.*s] %.*s = %s\n\tGIT_CONFIG_PARAMETERSbogus config parameter: %sbad config file line %d in %s/etc/gitconfigGIT_CONFIG_NOSYSTEMHOME%s/.gitconfiginvalid key: %sinvalid key (newline): %sopening %s: %sinvalid pattern: %sinvalid config file %sCannot handle files this bigcould not lock config file %srbMissing value for '%s'core.core.filemodecore.trustctimecore.quotepathcore.symlinkscore.ignorecasecore.barecore.ignorestatcore.prefersymlinkrefscore.logallrefupdatescore.warnambiguousrefscore.abbrevcore.loosecompressionbad zlib compression level %dcore.compressioncore.packedgitwindowsizecore.bigfilethresholdcore.packedgitlimitcore.deltabasecachelimitcore.autocrlfinputcore.safecrlfwarncore.eolnativecore.notesrefcore.pagercore.editorcore.askpasscore.excludesfilecore.whitespacecore.fsyncobjectfilescore.preloadindexcore.createobjectrenamecore.sparsecheckoutuser.user.nameuser.emaili18n.i18n.commitencodingi18n.logoutputencodingbranch.branch.autosetupmergebranch.autosetuprebaseneverlocalMalformed value for %spush.push.defaultnothingmatchingupstreamtrackingcurrentMalformed value for %s: %smailmap.mailmap.fileadvice.pager.colorcolor.pagerstrbuf_setlencore.gitproxy for nonerefs/ERR remote error: %s.have-P-pgit+sshssh+gitI don't handle protocol '%s'GIT_PROXY_COMMAND9418cannot start proxy %sLooking up %s ... %s[%d: %s]: errno=%s done. %s %s%chost=%s%ccommand line too longGIT_SSHtortoiseplink-batchunable to forkGIT_ASKPASSSSH_ASKPASSCould not read passwordprotocol error: expected sha/ref, got '%s'No path specified. See 'man git-pull' for valid url syntaxUnable to look up %s (port %s) (%s)done. Connecting to %s (port %s) ... unable to connect a socket (%s)failed to read password from %s strbuf_setlenGIT_DIRGIT_OBJECT_DIRECTORY%s/objectsGIT_INDEX_FILE%s/indexGIT_GRAFT_FILEinfo/graftsGIT_NO_REPLACE_OBJECTS%s/%s%s/pack/pack-%s.keepCould not set GIT_DIR to '%s'UTF-8GIT_CONFIGGIT_WORK_TREEinternal error: work tree has already been set Current worktree: %s New worktree: %sGIT_ALTERNATE_OBJECT_DIRECTORIES |        & /usrGIT_EXEC_PATH/usr/lib/git-core/usr/bin:/bintrace: exec:trace: exec failed: %s too many args to run %s  0123456789abcdefUnable to create '%s.lock': %s. If no other git process is currently running, this probably means a git process crashed in this repository earlier. Make sure no other git process is running and remove the file manually to continue.Unable to create '%s.lock': %scannot fix permission bits on %s%s: symlink too longcannot open '%s' for copying.mailmap# repo-abbrev:packfile %s index not opened%s SHA1 checksum mismatchpacked %s from %s is corruptPackfile index for %s SHA1 mismatch%s SHA1 does not match its indexinternal error pack-check nth-packed-objectindex CRC mismatch for object %s from %s at offset %llucannot unpack %s from %s at offset %lluref:.git/.gitstrbuf_setleny pz qz ] read errorpacket: %12s%c PACKPACK ...\%o0123456789abcdefwrite error (disk full?)write errorThe remote end hung up unexpectedlyprotocol error: impossibly long lineprotocol error: bad line length character: %.4sprotocol error: bad line length %dGIT_TRACE_PACKET0123456789abcdef'\Too many or long arguments\f\r\vIOOOOIʐabtnvfr"\strbuf_setlenDuplicated ref, and SHA1s don't match: %s%s does not point to a valid object!'%s' exists; cannot create '%s'cannot delete '%s' from packed refsthere are still refs under '%s'unable to resolve reference %s: %sunable to create directory for %sRef %s is at %s but expected %sThere are still logs under '%s'Trying to write ref %s with nonexistant object %sTrying to write non-commit object %s to branch %srefname %s is a symbolic ref, renaming it is not supportedunable to save current sha1 in %sunable to move logfile logs/%s to logs/refs/.tmp-renamed-log: %sunable to move logfile logs/refs/.tmp-renamed-log to logs/%s: %sunable to write current sha1 into %sunable to lock %s for rollbackunable to restore logfile %s from %s: %sunable to restore logfile %s from logs/refs/.tmp-renamed-log: %sno symlink - falling back to symbolic ref Unable to fix permissions on %sLog %s unexpectedly ended on %s.invalid rule in ref_rev_parse_rules: %sDuplicated ref: %s peeled packed-refstoo long a refname '%s'bad ref for %srefs/tags/refs/heads/refs/remotes/refs/replace/Can't verify ref %srefs/%srefs/notes/Unable to append to %s: %s%s %s %s Unable to append to %sCouldn't write %sCouldn't set %sreflog for %s is a symlinkrefname %s not foundunable to lock %slogs/refs/.tmp-renamed-logunable to delete old %sDirectory not empty: %sunable to delete existing %sDirectory not empty: logs/%sunable to lock %s for updateref: %s refname too long: %s%s.lockUnable to open %s for writingUnable to write to %sUnable to create %sUnable to read log '%s'Log %s is empty.Log %s is corrupt.Log %s has gap after %s.Cannot lock the ref '%s'.Cannot update the ref '%s'.refs/%.*srefs/heads/%.*srefs/tags/%.*srefs/remotes/%.*srefs/remotes/%.*s/HEAD# pack-refs with:RENAMED-REFKey '%s' of pattern had no '*'Value '%s' of pattern has no '*'Config remote shorthand cannot begin with '/': %smore than one receivepack given, using the firstmore than one uploadpack given, using the firstfind_tracking: need either src or dstsrc refspec %s does not match any.src refspec %s matches more than one.%s cannot be resolved to branch.unable to push to unqualified destination: %s The destination refspec neither matches an existing ref on the remote nor begins with refs/, and we are unable to guess a prefix based on the source ref.dst refspec %s matches more than one.dst ref %s receives from more than one src.Didn't think it matches any more* Ignoring funny ref '%s' locallyYour branch is ahead of '%s' by %d commit%s. Your branch is behind '%s' by %d commit%s, and can be fast-forwarded. Your branch and '%s' have diverged, and have %d and %d different commit(s) each, respectively. .remote.mergeurl..insteadof.pushinsteadofremote..mirror.skipdefaultupdate.skipfetchall.url.pushurl.push.fetch.receivepack.uploadpack.tagopt--no-tags--tags.vcsInvalid refspec '%s'originURL:Push:Pull:branches/%.*s:refs/heads/%sHEAD::refs/heads/masterremotes/%s%s tracks both %s and %s(delete)Couldn't find remote ref %s--left-rightrefs/tags/*strbuf_setlen--all--branches--remotes--reflog--not--no-walk--do-walk--bisectmax-countskip-n requires an argument-nmax-agesinceaftermin-agebeforeuntil--first-parent--ancestry-path--walk-reflogs--defaultbad --default argument--merge--topo-order--simplify-merges--simplify-by-decoration--date-order--early-output--parents--dense--sparse--show-all--remove-empty--merges--no-merges--min-parents=--no-min-parents--max-parents=--no-max-parents--boundary--left-only--right-only--cherry--count--cherry-mark--cherry-pick--objects--objects-edge--unpacked--unpacked=--cc--pretty--pretty=--format=--show-notes--show-notes=--no-notes--standard-notes--no-standard-notes--oneline--graph--root--no-commit-id--always--no-abbrev--abbrev--abbrev=--abbrev-commit--full-diff--full-history--relative-date--log-sizeauthorcommittergrepcommand line--extended-regexp--regexp-ignore-case--fixed-strings--all-match--reverse--childrenbad object %sbad tree %sInvalid revision range %s..%s^@^!unknown option `%s'refs/bisect/badrefs/bisect/goodglob--branches=--tags=--remotes=--stdin--stdin given twice?bad revision '%s'--merge without HEAD?MERGE_HEAD--merge without MERGE_HEAD?bad default revision '%s'diff_setup_done failedbad tagunable to parse commit %s%s is unknown object^--left-only is incompatible with --right-only or --cherry--right-only is incompatible with --left-only--cherry is incompatible with --left-only--cherry-mark is incompatible with --cherry-pick--cherry-pick is incompatible with --cherry-mark--unpacked= no longer supported.cannot simplify commit %s (because of %s)cannot simplify commit %s (invalid %s)bad tree compare for commit %sreflog of '%s' references pruned commitsInvalid symmetric difference expression %s...%soptions not supported in --stdin modecannot combine --reverse with --walk-reflogscannot combine --parents and --childrencannot combine --reverse with --graphcannot combine --walk-reflogs with --graph--ancestry-path given but there are no bottom commitsFailed to traverse parents of commit %sFailed to simplify parents of commit %sfatal: waitpid is confused (%s)%s died of signal %dcannot run %s: %swaitpid for %s failed: %scannot create pipe for %s: %strace: run_command:exec '%s': cd to '%s' failed|&;<>()$`\"' *?[#~=%-c%s "$@"cannot exec '%s'cannot fork() for %s: %sBUG: shell command is emptycannot create pipe: %scannot create thread: %spthread_join failedhooks/%sGIT_INDEX_FILE=%sToo long path: %.*s%s/configPlease upgrade Gitfailed to stat '%s%s%s''%s' is outside repositoryfailed to stat '%s'Error opening '%s'Error reading %sgitdir: Invalid gitfile format: %sNo path in gitfile: %sNot a git repository: %s'$%s' too bigNot a git repository: '%s'Could not chdir to '%s'Could not get directory '%s'Could not come back to cwdGIT_CEILING_DIRECTORIESCannot come back to cwdCannot change to '%s/..'umaskgroupworldeverybodycore.repositoryformatversioncore.sharedrepositorycore.worktreeExpected git repo version <= %d, found %dbad flag '%s' used after filenameambiguous argument '%s': unknown revision or path not in the working tree. Use '--' to separate paths from revisionsambiguous argument '%s': both revision and filename Use '--' to separate filenames from revisionsThis operation must be run in a work treecore.bare and core.worktree do not make senseUnable to read current working directoryGIT_DISCOVERY_ACROSS_FILESYSTEMNot a git repository (or any of the parent directories): %sNot a git repository (or any parent up to mount parent %s) Stopping at filesystem boundary (GIT_DISCOVERY_ACROSS_FILESYSTEM not set).Problem with core.sharedRepository filemode value (0%.3o). The owner of files must always have read and write permissions.%s/pack/pack-1234567890123456789012345678901234567890.%sinsanely long object directory %spack_report: getpagesize() = %10llu pack_report: core.packedGitWindowSize = %10llu pack_report: core.packedGitLimit = %10llu pack_report: pack_used_ctr = %10u pack_report: pack_mmap_calls = %10u pack_report: pack_open_windows = %10u / %10u pack_report: pack_mapped = %10llu / %10llu index file %s is version %u and is not supported by this binary (try upgrading GIT to a newer version)wrong index v1 file size in %swrong index v2 file size in %spackfile %s not a regular filecannot determine file descriptor flagsfile %s is far too short to be a packfilepackfile %s is version %u and not supported (try upgrading GIT to a newer version)packfile %s claims to have %u objects while index indicates %u objectsend of packfile %s is unavailablepackfile %s signature is unavailablepackfile %s does not match index%s: ignoring alternate object stores, nesting too deep.%s: ignoring relative alternate object store %sobject directory %s does not exist; check .git/objects/info/alternates.could not close alternates filepack '%s' still has open windows to itpackfile %s cannot be accessedoffset beyond end of packfile (truncated pack?)packfile %s cannot be mapped: %sunable to open object pack directory: %s: %sgarbage at end of loose object '%s'delta data unpack-initial failed%02x%02x%02x... lo %u hi %u nr %u failed to validate delta base reference at offset %llu from %sfailed to read delta base object %s at offset %llu from %sfailed to unpack compressed delta at offset %llu from %sunknown object type %i at offset %llu in %sfailed to read object %s at offset %llu from %spack %s contains unknown object type %dpack %s contains bad delta base reference of type %sreplacement %s not found for %sloose object %s (stored in %s) is corruptpacked object %s (stored in %s) is corruptunable to write sha1 filename %s: %s unable to set permission to '%s'insufficient permission for adding an object to repository database %s unable to create temporary sha1 filename %s: %s unable to deflate new object %s (%d)deflateEnd on object %s failed (%d)confused by unstable object source data for %s%s: failed to insert into database%s %luOut of memory? mmap failedindex file %s is too smallnon-monotonic index %spackfile %s index unavailablecannot get RLIMIT_NOFILEpackfile %s size changedcannot set FD_CLOEXECfile %s is not a GIT packfile%s/objects %s/packbad object headercorrupt loose object '%s'GIT_DEBUG_LOOKUPGIT_USE_LOOKUPlo %u hi %u rg %u mi %u I am totally screwedbad packed object CRC for %sfailed to apply deltaunable to find %sunable to unpack %s headerunable to parse %s headerfailed to read object %stree object file write error (%s)unable to write sha1 fileerror when closing sha1 filefailed utime() on %s: %scannot read sha1_file for %scorrupt commitcorrupt tagshort read %sopen("%s"): %sreadlink("%s"): %s%s: unsupported file type%s is not a valid object%s is not a valid '%s' object0123456789abcdef0123456789abcdefInvalid search pattern: %s%.2s%.2s/short SHA1 %.*s is ambiguous.checkout: moving from @{upstream}@{u}ignoring dangling symref %s.refname '%.*s' is ambiguous.Invalid object name '%s'.BUG: startup_info struct is not initialized.relative path syntax can't be used outside working tree.No upstream branch found for '%s'Log for '%.*s' only goes back to %s.Log for '%.*s' only has %d entries.%.*s: expected %s type, but the object dereferences to %s typePath '%s' is in the index, but not at stage %d. Did you mean ':%d:%s'?Path '%s' is in the index, but not '%s'. Did you mean ':%d:%s' aka ':%d:./%s'?Path '%s' exists on disk, but not in the index.Path '%s' does not exist (neither on disk nor in the index).Path '%s' exists on disk, but not in '%s'.Path '%s' exists, but not '%s'. Did you mean '%s:%s' aka '%s:./%s'?Path '%s' does not exist in '%s'strbuf_setlenBUG: signal out of range: %dyou want to use way too much memory`pos' is too far after the end of the buffer`pos + len' is too far after the end of the bufferBUG: your vsnprintf is broken (returned %d)BUG: your vsnprintf is broken (insatiable)strbuf_setlen%s:%p missing object referenced by '%.*s'Object %s is a %s, not a tagtype Unknown type %stag tagger Could not read %sObject %s not a tag-----BEGIN PGP SIGNATURE----------BEGIN PGP MESSAGE-----What does '%s' for %s mean? GIT_TRACE(null)GIT_TRACE_SETUPsetup: git_dir: %s setup: worktree: %s setup: cwd: %s setup: prefix: %s Could not open '%s' for tracing: %s Defaulting to tracing on stderr... If you want to trace into a file, then please set %s to an absolute pathname (starting with /). Unable to get current working directoryCould not trace into fd given by GIT_TRACE environment variablecorrupt tree sha %sunable to read root tree (%s)unable to read source tree (%s)unable to read destination tree (%s)unable to set up diff options to follow renamesstrbuf_setlenObject %s is a %s, not a treeObject %s not a treeCommit %s in submodule path %s not foundInvalid commit %s in submodule path %scorrupt tree fileunable to read tree %sstrbuf_setlen&=&warning: error: usage: fetch (unknown)Can't lock ref %sCannot obtain needed %s %s while processing commit %s. walk %s fetch from %sUnable to determine requirements of type %s for %sCould not interpret response from server '%s' as something to pullunable to %s %s: %sOut of memory, strdup failedOut of memory, realloc failedOut of memory, calloc failedOut of memory? fdopen failed/tmpTMPDIRXXXXXXunlinkrmdirOut of memory, malloc failed (tried to allocate %lu bytes)Data too large to fit into virtual memory space.Unable to create temporary file '%s'abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789GIT_FLUSHwrite failure on '%s'fsync error on '%s'%s: write error (%s) , tabwidth=tabwidth %.*s out of rangetrailing whitespacenew blank line at EOFspace before tab in indentindent with spacestrailing-spacespace-before-tabindent-with-non-tabcr-at-eolblank-at-eolblank-at-eoftab-in-indentcannot enforce both tab-in-indent and indent-with-non-tabC @C C C C @C C wrong versionno messageinflateInit: %s (%s)inflateEnd: %sneeds dictionarydata stream errorstream consistency errorunknown errorinflate: out of memoryinflate: %s (%s)wwwwywwwwCould not switch to '%s'Too long path name: '%s/%s'Invalid symlink '%s'symbolic link too long: %sCould not change back to '%s'PWDCould not get current working directoryCannot determine the current working directorypushnonfastforwardstatushintscommitbeforemergeresolveconflictimplicitidentitydetachedhead'%s' is not possible because you have unmerged files. Please, fix them up in the work tree, and then use 'git add/rm ' as appropriate to mark resolution and make a commit, or use 'git commit -a'.'%s' is not possible because you have unmerged files.F h F d F ` F \ F X F T %10s: %8u (%llu kB) [attr]%s not allowed: %s:%d core.attributesfile/etc/gitattributesGIT_ATTR_NOSYSTEM[builtin].gitattributesinfo/attributes[attr]binary -diff -text%.*s is not a valid attribute name: %s:%d BUG: non-INDEX attr direction in a bare repo(builtin)false(builtin)true(builtin)unknown strbuf_setlenObject %s is a %s, not a blob%c%d %d %o %.*s%ccache-tree: internal error%s: unmerged (%s) %s: not added yet You have both %s and %s fatal - unsorted cache subtreecache-tree.c: '%.*s' in '%s' not foundinvalid object %06o %s for '%.*s'Object %s is a %s, not a commitbad graft data: %sduplicate graft data: %sshallow %sbogus commit object %sbad tree pointer in commit %sbad parents in commit %sparent Object %s not a commitnot yettree %s parent %s author %s committer %s encoding %s Warning: commit message does not conform to UTF-8. You may want to amend it after fixing the message, or set the config variable i18n.commitencoding to the encoding your project uses. strbuf_setlenidentIdautofilter.smudgecleanexternal filter %s failedexternal filter %s failed %dId: $ Id:read from external filter %s failedcannot fork to run external filter %scannot feed the input to external filter %sCRLF will be replaced by LF in %s. The file will have its original line endings in your working directory.CRLF would be replaced by LF in %s.LF will be replaced by CRLF in %s. The file will have its original line endings in your working directory.LF would be replaced by CRLF in %scopy-fd: read returned %scopy-fd: write returned 0copy-fd: write returned %s%s: close error: %s%lu %c%02d%02dyesterdaysecondslastmonthsyearsin the future%lu seconds ago%lu minutes ago%lu hours ago%lu days ago%lu weeks ago%lu months ago%lu year%s, %lu month%s ago%lu years ago%lu %+05d%04d-%02d-%02dPMAMiso8601rfc2822shortunknown date format %sJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberSundaysMondaysTuesdaysWednesdaysThursdaysFridaysSaturdaysIDLWCATHSTHDTYSTYDTPSTPDTMSTMDTCSTCDTEDTWATGMTUTCWETBSTCETMETMEWTMESTCESTMESZFWTFSTEETEESTWASTWADTCCTJSTEASTEADTGSTNZTNZSTNZDTIDLEnoonmidnightteanowminuteshoursweekszerotwothreefourfivesixseveneightnineten%04d-%02d-%02d %02d:%02d:%02d %+05d%.3s, %d %.3s %d %02d:%02d:%02d %+05d%.3s %.3s %d %02d:%02d:%02d %d%c%+05dO O P  P P P P !P (P 2P :P CP LP TP \P eP pP zP P ;Zx0NP ' P P P P P P P P P P P P P Q Q P P P P P P P P P P P P P P P P Q Q  Q Q  Q  Q  Q  "Q  &Q  +Q  0Q  N 5Q :Q pCQ 0O 0O  `GQ N KQ <SQ }P QYQ : _Q k dQ hQ nQ sQ xQ |Q Q Q Q %s%4d.%01d%% %.*s diff.cmsg%s%s:%d: %s. invalid diff0,01,%dOption '%c' requires a value %s mode %06o %s mode change %06o => %06o%ccannot hash %s%sdelta %lu %sliteral %lu @@ -XXXXXX_unable to create temp-fileunable to write temp-file => %s %s (%d%%) %s%s--- %s%s%s %s%s+++ %s%s%s ~ diff.renamelimitdiff.color.color.diff.plainmetafragnewfuncdiff.suppressblankemptydiff.suppress-blank-emptysubmodule.diff.colorcolor.diffdiff.renamescopydiff.autorefreshindexdiff.mnemonicprefixdiff.noprefixdiff.externaldiff.wordregexdiff.ignoresubmodulestextconv/%s-dirtySubproject commit %s%s unable to read %sstat(%s)readlink(%s)cannot read data blob for %sunable to read files to diffa/b/--patchunified--raw--patch-with-raw--numstat--shortstatdirstat--cumulativedirstat-by-file--check--summary--patch-with-stat--name-only--name-status--stat-name-width-B--break-rewrites=--break-rewritesinvalid argument to -B: %s-M--find-renames=--find-renamesinvalid argument to -M: %s-C--find-copies=--find-copiesinvalid argument to -C: %s--no-renames--relative--relative=--ignore-all-space--ignore-space-change--ignore-space-at-eol--patience--binary--full-index--text--find-copies-harder--follow--color--color=--no-color--color-words--color-words=--word-diff--word-diff=bad --word-diff argument: %sword-diff-regex--exit-code--quiet--ext-diff--no-ext-diff--textconv--no-textconv--ignore-submodules--ignore-submodules=--submodule--submodule=--pickaxe-all--pickaxe-regexdiff-filtersrc-prefixdst-prefix--no-prefixinter-hunk-contextCould not open '%s'%s%.*s%s...internal diff status error%s%ssimilarity index %d%%%s %s%scopy from %s %s%scopy to %s %s%srename from %s %s%srename to %s%sindex %s..%s%sdiff --git %s %s%s %s%snew file mode %06o%s %s%sdeleted file mode %06o%s %s%sold mode %06o%s %s%snew mode %06o%s + @@%s %sGIT binary patch GIT_DIFF_OPTS--unified=-u* Unmerged path %s GIT_EXTERNAL_DIFF:%06o %06o %s %c%03d%c%c%c- - %llu %llu %s%-*s | Bin %s%llu%s -> Unmerged %5llu%sdeletecreate%s rewrite Could not open /dev/null{++}[--]%s%s:%d: leftover conflict marker internal error in diff-resolve-rename-copyinternal error: asking to populate invalid file.error while reading from stdin %sBUG: diff is failing to clean up its tempfiles--name-only, --name-status, --check and -s are mutually exclusiveOption '--%s' requires a valueOption '--stat-width' requires a valueOption '--stat-name-width' requires a valueoption `color' expects "always", "auto", or "never"diff--gita/%.*sb/%.*snewfilemode%06o---/dev/null+++b/%.*sdiff--gita/%.*sb/%.*sdeletedfilemode%06o---a/%.*s+++/dev/nulldiff--gita/%.*sb/%.*s---a/%.*s+++b/%.*sfeeding unmodified %s to diffcoreerror reading from textconv command '%s'%s%sdissimilarity index %d%%%s external diff died, stopping at %s. %s%s--- %s%s%s %s%s+++ %s%s%s %s%s@@ -%sBinary files %s and %s differ Invalid regular expression: %s %d files changed, %d insertions(+), %d deletions(-) ------------only found copies from modified paths due to too many files.inexact rename detection was skipped due to too many files.you may want to set your %s variable to at least %d and retry the command.emit_line_0strbuf_setlen@@diff_words_showfn_out_diff_words_aux`jG*?[{\oops in prep_exclude.gitignoreinfo/excludecannot use %s as an exclude filecan't find the current directorystrbuf_setlen%*sgraph.cgraph->num_parents >= 3graph->revs->boundarypar_columntarget * 2 <= igraph->new_mapping[i] == -1graph->new_mapping[i - 2] < 00 <= graph->expansion_row && graph->expansion_row < num_expansion_rowsgraph->new_mapping[i - 1] > targetgraph->new_mapping[i - 3] == targetBsdiff_output_prefix_callbackstrbuf_setlengraph_next_linegraph_output_pre_commit_linegraph_output_commit_chargraph_output_post_merge_linegraph_output_collapsing_linegrep.cregexp returned nonsenseNot a valid grep expressionunmatched parenthesisnot a pattern expression %sIn '%s' at %d, %s, %s'%s': %sBinary file matches bug: unknown header field %dbug: malformed header exprauthor committer p->field < (sizeof(header_field)/sizeof(header_field[0]))Unexpected node type (internal error) %d--not not followed by pattern expression--not followed by non pattern expression--and not followed by pattern expressionbug: unknown binary handling modebug: a non-header pattern in grep header list.incomplete pattern expression: %s@match_one_patternf f  You don't exist. Go away!Your sysadmin must hate you!/etc/mailname(none)invalid date format: %s <GIT_AUTHOR_DATEGIT_AUTHOR_EMAILGIT_AUTHOR_NAMEGIT_COMMITTER_NAMEGIT_COMMITTER_EMAILGIT_COMMITTER_DATEunable to read /etc/mailname: %s empty ident %s <%s> not allowedImpossibly long personal identifierYour parents must have hated you! *** Please tell me who you are. Run git config --global user.email "you@example.com" git config --global user.name "Your Name" to set your account's default identity. Omit --global to set the identity only in this repository. ll-merge.coptsAmerge.defaultmerge.%s: lacks valuedriverrecursiveconflict-marker-sizebuilt-in binary mergebuilt-in 3-way text mergeunionbuilt-in union mergecustom merge driver %s lacks command line.Cannot merge binary files: %s (%s vs. %s) ll_union_mergell_xdl_mergell_binary_mergell_ext_mergerefs/headsrefs/remotesrefs/tagsrefs/stashremoteBranch ( %stag: %04d-%fSubject: References: attachmentinlineSubject: [%s %0*d/%d] Subject: [%s] Message-Id: <%s> In-Reply-To: <%s> %s<%s> commit (from %s)log size %i stdoutobject namesFrom %s Mon Sep 17 00:00:00 2001 %sMIME-Version: 1.0 Content-Type: multipart/mixed; boundary="%s%s" This is a multi-part message in MIME format. --%s%s Content-Type: text/plain; charset=UTF-8; format=fixed Content-Transfer-Encoding: 8bit --%s%s Content-Type: text/x-patch; name="%s" Content-Transfer-Encoding: 8bit Content-Disposition: %s; filename="%s" strbuf_setlenSigned-off-by: refs/notes/%supdate notes cacheinvalid object type "%s"sha1 mismatch %s object %s has unknown type id %d QK s? I i< internal error: pack revindex fubarbad offset for revindex no-[=<%s>][<%s>] <%s>[%s][=%s]cat <<\EOF usage: %s or: %s -%c--%s%s-NUM%*s%s switch `%c' %soption `no-%s' %soption `%s' %stakes no valueisn't availableexpects a numerical valueBUG: option '%s' %sBUG: switch '%c' %sshould not accept an argumenthelp-allhelpunknown switch `%c'%s malformed object name %sno such commit %sshould not happen, someone must be hit on the foreheadSTOP_AT_NON_OPTION and KEEP_UNKNOWN don't go togetheruses incompatible flags LASTARG_DEFAULT and OPTARGuses feature not supported for dashless optionsdid you mean `--%s` (with two dashes ?)Ambiguous option: %s (could be --%s%s or --%s%s)expects "always", "auto", or "never"XC @C B A A xB pC B B B unexpected delta opcode 0delta replay has gone wildpretty.tformat:?= =?%s?q?=%02X?=mediumfullerfullinvalid --pretty format: %sFrom: %s: %.*s%.*s Date: %s %sDate: %s encoding --pretty formatredgreenblueresetbad parent line in commitMerge:AuthorCommitinvalid --pretty format: '%s' references an alias which points to itselfMIME-Version: 1.0 Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit uu =o =o =o =o =o u =o At =o =o =o 8v =o =o =o =o =o =o =o =o =o =o =o =o =o =o =o t =o =o u s =o =o =o =o Ns =o =o r =o =o =o s UTF-8strbuf_setleninternal error: ce_mode is %oInvalid path '%s'unable to index file %sunable to add %s to indexadd '%s' unable to stat '%s'M %s U %s %s: needs update %s: needs merge index file open failedcannot stat the open indexunable to map index filebad signaturebad index versionbad index file sha1 signatureignoring %.4s extension index file corrupt%s: cannot drop to stage #0'%s' appears as both a file and as a directory%s: can only add regular files, symbolic links or git-directoriescannot create an empty blob in the object databaseWill not add file alias '%s' ('%s' already exists in index)index file smaller than expectedUnknown index entry format %08xindex uses %.4s extension, which we do not understand⛲CK)wZSCannot walk reflogs for %sNo current branch%s@{Reflog: %s (%s) Reflog message: %sbad replace ref name: %sduplicate replace ref: %sreplace depth too high for object %s%o%ccannot unmerge '%s'Index records invalid resolve-undo informationBUG: assertion failed in binary searchcannot happen -- lo and hi are identicalofs %u lov %x, hiv %x, kyv %x assertion failure lo %u mi %u hi %u %ssha1-lookup.clov < hivlo %u hi %u rg %u mi %u sha1_entry_posshallowbad shallow line: %sinvalid commit %h: %m %srev-list^%srevision walk setup failed%s/.git/objects//.gitmodulesuntrackedon-demandbad %s argument: %s.path.fetchrecursesubmodules.ignorefetch.recursesubmodules(submodule deleted)(not checked out)(new submodule)(commits not present)(revision walker failed) (rewind)Submodule %s %s..%s: --recurse-submodules-default--submodule-prefix%s%s/Fetching submodule %s%s --porcelain-unogit status --porcelain failednot checked outcommits not presentnot fast-forwardmultiple merges foundbad --ignore-submodules argument: %sInvalid parameter "%s" for config option "submodule.%s.ignore"Submodule %s contains untracked content Submodule %s contains modified content Could not run git status --porcelainFailed to merge submodule %s (%s)commits don't follow merge-basemerge following commits not foundFound a possible merge resolution for the submodule: If this is correct simply add it to the index for example by using: git update-index --cacheinfo 160000 %s "%s" which will accept this suggestion. strbuf_setlen %m %sxfuncnamecommandcachetextconvfortranhtml^[ ]*(<[Hh][1-6][ ].*>.*)$javaobjcpascalperlphppython^[ ]*((class|def)[ ].*)$rubybibtexcppcsharpdiff=true!diff!^([C*]|[ ]*!) !^[ ]*MODULE[ ]+PROCEDURE[ ] ^[ ]*((END[ ]+)?(PROGRAM|MODULE|BLOCK[ ]+DATA|([^'" ]+[ ]+)*(SUBROUTINE|FUNCTION))[ ]+[A-Z].*)$[a-zA-Z][a-zA-Z0-9_]*|\.([Ee][Qq]|[Nn][Ee]|[Gg][TtEe]|[Ll][TtEe]|[Tt][Rr][Uu][Ee]|[Ff][Aa][Ll][Ss][Ee]|[Aa][Nn][Dd]|[Oo][Rr]|[Nn]?[Ee][Qq][Vv]|[Nn][Oo][Tt])\.|[-+]?[0-9.]+([AaIiDdEeFfLlTtXx][Ss]?[-+]?[0-9.]*)?(_[a-zA-Z0-9][a-zA-Z0-9_]*)?|//|\*\*|::|[/<>=]=|[^[:space:]]|[-][-]+[^<>= ]+|[^[:space:]]|[-][-]+!^[ ]*(catch|do|for|if|instanceof|new|return|switch|throw|while) ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>>?=?|&&|\|\||[^[:space:]]|[-][-]+!^[ ]*(do|for|if|else|return|switch|while) ^[ ]*([-+][ ]*\([ ]*[A-Za-z_][A-Za-z_0-9* ]*\)[ ]*[A-Za-z_].*)$ ^[ ]*(([A-Za-z_][A-Za-z_0-9]*[ ]+)+[A-Za-z_][A-Za-z_0-9]*[ ]*\([^;]*)$ ^(@(implementation|interface|protocol)[ ].*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[fFlL]?|0[xXbB]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|--|\+\+|<<=?|>>=?|&&|\|\||::|->|[^[:space:]]|[-][-]+^(((class[ ]+)?(procedure|function)|constructor|destructor|interface|implementation|initialization|finalization)[ ]*.*)$ ^(.*=[ ]*(class|record).*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|<>|<=|>=|:=|\.\.|[^[:space:]]|[-][-]+^[ ]*package .*; ^[ ]*sub .* \{ ^[A-Z]+ \{ ^=head[0-9] [[:alpha:]_'][[:alnum:]_']*|0[xb]?[0-9a-fA-F_]*|[0-9a-fA-F_]+(\.[0-9a-fA-F_]+)?([eE][-+]?[0-9_]+)?|=>|-[rwxoRWXOezsfdlpSugkbctTBMAC>]|~~|::|&&=|\|\|=|//=|\*\*=|&&|\|\||//|\+\+|--|\*\*|\.\.\.?|[-+*/%.^&<>=!|]=|=~|!~|<<|<>|<=>|>>|[^[:space:]]|[-][-]+^[ ]*(((public|protected|private|static)[ ]+)*function.*)$ ^[ ]*(class.*)$[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|[-+*/<>%&^|=!.]=|--|\+\+|<<=?|>>=?|===|&&|\|\||::|->|[^[:space:]]|[-][-]+[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+[jJlL]?|0[xX]?[0-9a-fA-F]+[lL]?|[-+*/<>%&^|=!]=|//=?|<<=?|>>=?|\*\*=?|[^[:space:]]|[-][-]+^[ ]*((class|module|def)[ ].*)$(@|@@|\$)?[a-zA-Z_][a-zA-Z0-9_]*|[-+0-9.e]+|0[xXbB]?[0-9a-fA-F]+|\?(\\C-)?(\\M-)?.|//=?|[-+*/<>%&^|=!]=|<<=?|>>=?|===|\.{1,3}|::|[!=]~|[^[:space:]]|[-][-]+(@[a-zA-Z]{1,}[ ]*\{{0,1}[ ]*[^ "@',\#}{~%]*).*$[={}"]|[^={}" ]+|[^[:space:]]|[-][-]+^(\\((sub)*section|chapter|part)\*{0,1}\{.*)$\\[a-zA-Z@]+|\\.|[a-zA-Z0-9-]+|[^[:space:]]|[-][-]+!^[ ]*[A-Za-z_][A-Za-z_0-9]*:.*$ ^([A-Za-z_][A-Za-z_0-9]*([ ]+[A-Za-z_][A-Za-z_0-9]*([ ]*::[ ]*[^[:space:]]+)?){1,}[ ]*\([^;]*)$ ^((struct|class|enum)[^;]*)$!^[ ]*(do|while|for|if|else|instanceof|new|return|switch|case|throw|catch|using) ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[<>@._[:alnum:]]+[ ]*\(.*\))[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|virtual|sealed|override|unsafe)[ ]+)*[][<>@.~_[:alnum:]]+[ ]+[@._[:alnum:]]+)[ ]*$ ^[ ]*(((static|public|internal|private|protected|new|unsafe|sealed|abstract|partial)[ ]+)*(class|enum|interface|struct)[ ]+.*)$ ^[ ]*(namespace[ ]+.*)$utf-8utf8W]oKXpp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY`24RSrs   "'(229;  * . ` c j o *0/000 #gis strbuf_setlenmalformed diff output: %s @@Could not stat %sCould not open %sunable to read blob object %smerge.conflictstyle'%s' is not a booleandiff3Last expression must not be negated: %sInvalid regexp to look for hunk header: %sunknown style '%s' given for '%s'strbuf_setleninvalid base85 alphabet %cinvalid base85 sequence %.5s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!#$%&()*+-;<=>?@^_`{|}~38;5;%d48;5;%dTERMdumbcolor.uinormalblackyellowmagentacyanwhitebolddimulblinkbad color value '%.*s' for variable '%s'8 ? r r E r L T Y _ d h k  %.*s%s%s %s%06oSubproject commit %s object '%s' is not a blob!diff --cc diff --combined ,readlink(%s): %sread error '%s'early EOF '%s'%sindex ..%s%s %snew file mode %06o--- %sdeleted file mode ..%06o+++ -%lu,%lu +%lu,%lu %s%s %s%s::::::::::::::::::::::::::::::::strbuf_setleninternal error in merge #1internal error in merge #2internal error in merge #3internal error in merge #4invalid log-grep regex: %sdiffcore-pickaxe.cdata[sz] == '\0'invalid pickaxe regex: %scontainsinternal error: dst already matched.Performing inexact rename detectiondiff-delta.cpacked_entry - (struct index_entry *)mem == entriesѴYiVsg?Df7P*~ {'ZYA n\uT*NN'CMcqH$(~Qڿ80B i6:I_DV<1y UHg=[72waN.ʂ=SGܖ 6k.o; 㐵 mdIP)-_^˵i9/q`ˬymx%!tsC G#cu0׭PycͯE5#egwz3#zo;9 kbѷi>eM? ] {SRЦ-w:ᆑ4}@4m3+]ހ.(uw,܌A!]OJqj&'ȒE R)TZ,m"2TkKةҊs^>*pWGLXY40J}oC9L|Ja%FW$}=ds@`[qFl/:_!j5FH9<`[`=x6(T!fZlG03%Htl߇"Vwra .$b6xޣoӭ~.|܅p ~KP8(zN]{ Lq[(t ?0Q"iQ܃hڬfWfVĻ媍E\P/9YC7?k^f+IvB~'2LO%AA!?CVYRX| e%1_Dž =DdUx-O#[X+j hRd8ޓ 4nomţ2rxud,64JbEvݝE& )p@Hz N#v;'R;*&bU;|b5,]\zcreate_delta_index ~3VԆ(G]>J}y Q/|pENOXHn&B wq_3!uULbׁJڡ4[(VreMA3υ0lY;DT:ՒزkfCF==895GGo>t>ry@ChcJP7p;I}ap 0-N:f76$ %)[k8sK c5"n\6t %w+UaD}lxI,XR&zz+ps}P %c[7t:n }"]]\n}N,5+8U3zrǔ,!RloaU/9uG+"h&ܗ>(@`a;)S7$IF^ffnm0cNH>JE4$bc)MC3ėɷeƄkDˤ: pXPlUC=J-fG kTKVYk[(h~Q6e/VyX'&%p_!VX [x*w1L<<'2dvAK{a5*cB[/Vm-ikP I.Xxj4UWg)f^ h'$ev)Y鮜'/z"Zq `u S#"]N^rC _m$ZL{lL/-AS"|1 *ŤTi,w?WARާn_*8 !F9gPP1]cOd`Dn6]HAw?LA3_W=)LvmgD Ejd;notes.c!tws->nextnote_path_len <= 40 + 19fanout < 20notesubtreeprefix_len * 2 >= npath_len < 40 + 19tree && parent!*pnotes ref %s is invalidnotes.displayrefrefs/notes/commitsGIT_NOTES_REF!t->initialized!display_notes_treesGIT_NOTES_DISPLAY_REF Notes: Notes (%s): tws->path[0] == '\0' && tws->path[1] == '\0'memchr(path + 3 * n, '/', path_len - (3 * n)) == ((void *)0)Could not read %s for notes-indexFailed to load %s %s into notes tree from %s((uintptr_t) (entry) & 3) == 0i == n && parent_stack[i] == tree((void *) ((uintptr_t) (parent->a[index]) & ~3)) == tree((uintptr_t) (*p) & 3) == 2 || ((uintptr_t) (*p) & 3) == 3Failed to read notes tree referenced by %s (%s)strbuf_setleninit_notesload_subtreenote_tree_insertnote_tree_removenote_tree_consolidateinit_display_notesadd_noteremove_noteget_notefor_each_notefor_each_note_helperconstruct_path_with_fanoutwrite_notes_treewrite_each_notetree_write_stack_init_subtreewrite_each_note_helperprune_notesutf-8format_display_notesGIT_PAGERLESSGIT_PAGER_IN_USELESS=FRSX, %u.%2.2u GiB, %u.%2.2u MiB, %u.%2.2u KiB, %u bytes | %u.%2.2u MiB/s | %u KiB/s %s: %3u%% (%u/%u)%s%s%s: %u%s%s%s... , %s. done \ No newline at end of file 0123456789;x(8)_28LHX~ p, ܌S z  p+ l  t& tM h x )(8(h()8 () H) l)8))- *.`*(/*/*/*x3+30+3D+4X+:+;+X<+<,8=4,=`,>,>,?,A$-Dd-D-hE-E-(F-XF.G\.(L.L.M/8PP/V/V/X/X0X00XYl0Z0[0[ 1H\T1\1X]1a 2bP2hg2Xh3h03j\3hk3(l3l3m3xn84Xpx4q4s5s@58tX5htt5t5Hu5xu5Hz 6xz@6zh6z6|6|6~07؄\7t7H7h7ȉ7(88h89h(98T9xt99H9Ȝ :ȥd:إx:(:::;$;ةD;hp;x;;h;(<H$<hD<p<ج<<h<ȭ<(=X4=P=h=د=H==,>XP>ȱt>>>?0?(P?Hd?????ȷ @ط @HL@l@@@@ؽ0A8TAXlAHAABDBBBBHCx(CPCHtC8CCH Dx8DDDD$EhdE(EEE8FxX> Y?0Y?TY@Y(B0ZCZHJZ8MZxN0[NX[Ox[P[P[Q\Q \Q4\HRp\W\hX]YD](Z]Z]([@^X\^h\^\^H]_]0_]P_xd_e_e_e`XfH`h`(i`Hj`k>>?0@T@xxABCHF8HhHHhILIxxJKxKL(xLHLh(NQhR0\t\\8]]`paXabhb0bTxci8iijD(jXjxklnD(o`phqHstHu(uPvwxXxyX{X~ȆL؉t؏h<PȐdx8ؒ LxhؕHxHTH `XPp( h,@xh|XX0(DȰ8HXT8tXh80X4XtdX@d(h(HxxhTxh8<xh($L($xX(l h (8dH8h88h 4!`!"#$48%T&X'(<h,,-/P(0h235D(6h6H77:;HHAXABxF(HLL(M(XPPPQXQQ@QTR(TUUxV4Wd[h[[8__H_h`8bb88cXde8gxghHii 8j8kxklmPXn8or (s,(tTt(uXuuu(wDwpyz|}4x(((lTxhH8th P8d(<|h,p(`(x$ D X   h H | h   ( T x   X      8D H x 8 Ht8X,8dx<T8tHX hH`X8hH` h$D($|( H h  0 D X!lH!x!!"X""@H%&8'(Dh(hH**H++4(0x1H11 (2,x6lhABB<(I|I(K8LzR|  \<AE b AG @x/AC gC(`yAA C y  CAF IAE0AAHC HHt 8fC [ B P H m@;AF ACHT CA AAC 8'C (LlCpJFd^ C ,xAB OE AAA A <AA ACF  AA AAD 3AC mA,AA E0n  AAA 8AE QA<XC0ZJ J f B c E `MC HHy$<AA AAC@ AA AAF ( HAA C  AA(L,WAC0r AA XFx`HC D(AA C }  AAA (mAC [ AH CA0@AA AC0A AA8AC0rA<< AA ACF AA AA,|AA C0v  CAA <AC ACE`G CA AAF </C Z C (PC LHH{ F b 4UAC0OA(X^C JHH` C Y$0AC hC<4AA AAC`k CA AAH <%AA AAC AA AAF $`AC VATH\AA AAC AA AAD K FA AAA 4MAA AC` A AAA @ BAA AAFA= AA AAE &,40'UAA AC C AAE ,h0(AA C   AAH ( AC VA8(RAA AAC0FAA AA@(AA AAE4 AA AAG D80*AA AC ~ A AAE MA AA*D*AC C Q  AAF Q  AAA S AA,*C FS| H Z F R( \+aAE B AG JFl8 +AA AAC` CA AAD 1 AA AAC c CA AAG , /C HJ A z F l 0|AA AACp AA AAA  AA AAA N AA AAA 8H 4AA AAC0CA AA [1C  @5wC0FQ\( 5C0MHQL C $ t7C JIy A y 7C HI$, |8C FIFa G (T 8MAA E0A CA< 9fAA CAEP1 CA AAF < 8:AA ACE` CA AAA ( ;AA C0 AAl, l`AE0P CG |C >=C y >,C0_ A $ >fC HF\ C u($ 4?aCGHH_ G \P x?+C0d<h ?AA AAC@ AA AAH  D%C L A T$ 0DFC HH_ F M XD#C \4pDC@MHHH[ E  F @EMC OzT`FAA AAC@ AA AAA B CA AAA (`G6FS][ G tM+C g@M:AA AAFa AA AAA @QC W(XQ\C HL_ B O E (Q5AC ] CD GAlQ C@HHS C c E o I ? E ) E _ E O E $ X]jC FFFp C 8H]C@QMHs D c E 'C ^aC0](8_C@KFJo C _4C HH\_+C gP`AA AAC@| AA AAA CCA AA<h``zAA AAC`U AA AAA @bAA AAF CA AAF \kXkGC HFuD kAA ACPr A AAE  A AAF hmC0 C nnnCL A M(nC Vk D j A n nCL A M,,nC0HHHT A T,\oC0LHGc G kpCL A MpCL A M(pEAC h CA SA@p  Lp, HpAA E0R  AAE PpZAC0TA,tp\AA C M  CAB q(C dq3C L A ,@qAA C0  AAG (qlAF C _ AA 4$rcAC XF(XprpAKI AB VA,rPAC } AF FA rPHA EA seAC _ALs"AC XA,\sAA E0^  AAA <LsAA FAH | AA AAG (t-C0IFFD F u5AC jFu C uHC HH\ A ,vC HHLV C r F @v$TvF Nd A |w+C gw (weAC K CF GAw1AC kA<xAC AAE@ AA AAC 4x"AC XATx9AC oA@tyAA AAK AA AAB |RCLHLn|C [@|AA AAF" AA AAH (8~gC T[ F ] C 8d~AA AAC`AD AA(xFNg D @LAA AAF5 AA AAE +AF bA04CPFJP B U$hЅC0LHB G a8%AC ]C$H\AK I AA kAC0cC$̆C@P@ E ($`CPHJlg H @PȉAA AAF  AA AAF (4&C@Ho E T8AA AAC0 CA AAE  CA AAE (YF^Rg C <D$AA AAC0 CA AAG $AA l AA <ܐ_AA AAF  AA AAA DAA AC  A AAJ CC AA,4tAr E I A F A Od$x`AC e AF ;AE [ AA T4AC ACEPS AA AAD  AA AAH |AC0 CA @C T(XtC0HHHHr C T7C s|7C s,C h,C h$ԕC0MXFX B ( |C@HMHt D h8 AA AAC | CA AAG C AA AAA [ AA AAA ,wAD | AF mAc'C TAA AAE@y CA AAH  CA AAH <@ HpAC CAEP\CA AA< x~AA AAC@ AA AAL 4 AA AC  A AAH < @AA AAC0w AA AAA 8! PL!AC AAC@ CA AAA KFC AA!"<!C0HHHHs J c E  !t^C HLc F ("C@HLHJI F D"cAC0]A,h"СAA C0  AAE T"pAA AAC@ AA AAE s AA AAA 0"أAA AC qA AA4$#$AA AC Y A AAF 4\#AA AC z A AAE #%AC _A#$WCS<#lAA AACP AA AAA  $,GC FGv(,$\C@HNJFp G 0X$C0HHPHg F iP$LAA ACE@ AA AAC [CA AA$aC0HFO$%C@MFH@(%CAC AAF  AA AAG ,l%C HN} B G A @%47XAA C {  CAL C CA<7[AA AACP' CA AAD D8(lAC AC T A AAA CF AA(X8PC@NKB B <8D JAA AAC@ AA AAH @8T "AA AAF  AA AAB H9@ AA C@i  CAF [  HAD o  HAH T9 /C0kTl9 AA AACPv AA AAG _ AA AAE (9 AA C@ AA90:4,:@eAA AH  AAC $H:iC HHF{ D (p:vAC E j AA:/C k:43C IF`(:TNC`FMH A $;x%CpFHN (;@&JC FFj A $L;l&hC JJc F $t;&C@FPC D <;'AA AAC@ CA AAA ;<(CC LHgD;l()AA AC@W A AAH  A AAH (D<T)XAA C P AA<p<)AC CACP AA AAG <8-,<D-C KFIS H E C <-%AC]C8=-WAC ACE0EAA AAP=-AC HHm<p=(.AC CCCP AA AAB =.wC@HHx E D=D/PAF AC  A AAB W A AAF @>L0AAA AAC? AA AAF `>X3`AC r AA @>3 AA AAF AA AAH @>@v AA AAF} AA AAE ( ?KuC0HFHO  C (8?pLCPHHOa E 8d?TMAA E y  CAD e  CAA P?M2AA AAEP! AA AAB AA AA4?OAA C@u  AAD K AA,@,Pz@@PKC \ A f(`@PCGIFF A @|Q4AC nA@QrAC h@R-AA ACEPj CA AAE a AA AAC d AA AAA 4AR$C `LARAA F TlA|S AA CACp CA AAA ] CA AAE A](A]-AC S AH GAB]$ACP^A$B$]4ACPnA(DBD]CPHO A pB_:C0v@B`AA CAF!t AA AAA ,B\a-AA H   AAC ,B\bAC F   AAB ,CbiCFJk A (PCHcdC@HHPS B |CdaC HHM8CdAA CW  CAH C  FAA C0eCPHHy A <CeAA AAC0g AA AAF  AA AAG 0`Oh^AA CC RA AADOAA AC w A AAH CA AA(OܓmC HHi D U C $P TAm B I O IT0PXAA AAC`G CC AAB  AA AAF <PЖAC AACP AA AAD TP0;AA ACC`g EA AAH  IA AAA @ QrAA AACS CA AAH (dQTCPFIn| D (QCFFXDQ D (Q̟CPFFFD| C <Q`AA AAC` AA AAE ((R 6AA E j CA(TR4FN]PM B (RC`FJFaD B (R\C@HLGH B <RRAA AAC` AA AAH 4SC OHFo A k E k@PS^AA AAF" AA AAF SOCPF A ,SjAA C@]  AAA $S(C`HRFk B T6Co T(5C@i A AA AC tA AA@l(AA AAF{ AA AAG 4m"AC QATm"$hm"[C0FNCm" m"LAC S AH m#C HG_ G m|#-AC [ AA n#)AC cA0n#HC HHp$Pn#C HHKc G $xnP$C HHKX B $n$\C0HHHOq$n %\C0HHHOq8nX%KAA CAC0{CA AAP,ol%jAA CAC0~ CA AAC SCA AAo%#C S A o%+C [ A (o%F NKlC A ,oD&C0HHHY L _hp&AA AACPf AA AAG G FA AAH NFA AAp(#C _p)#C _0p()C@HHHHa L c(p)F NKlN A $qX*JC HGX F Y$8q*JC HGX F Y`q*%$tq* ACo AD q++C S A q+LC c B q+C0j C B C q`,pC0j C }<r,AA AAC`) AA AAD <Xr0AA AAC@ AA AAF r1AC0Z CG ,r2AA C0  AAC r4EC HGn sL47C s $st4LA@ G C<Hs4AA AAC`N AA AAG s9oAC _ AD sL96AC pA sl9C LKB D <s9AA AACxAA AA0tL5PDtLAC AAC@Y AA AAB [AA AA$t0MC@HP}$tMbC0HLHBtMAC}@u(NAF AAF  AA AAH ,DuPAA F  FAB @tuRzAF FC | C AAG \C AAuR-C u S8C0t,u4SAA C   AAF ,vSAA C   AAF ,Dv4TAA C x  CAG ,tvTAA C x  CAG ,v4UAA C x  CAG vUiCX v VLAD C C8w8VAC AAC0tAA AAPLwVIAC AAC@ CA AAB CA AAXwWDAA AAE AA AAA  AA AAE hw|[AA AAC` CA AAG o CC AAA QCA AA<hx\AC AAF AA AAA <xP]AA AAC0Z AA AAC $x^C FK_ E O(yh^[CZIP B ^ AA AAF TAE J AG ( CFSV F 8 vAA AAC0jAA AA<HAA AAEp AA AAB 4QAC AE0 A AAD TcAA ACE` AA AAH W AA AAA ,C@FJ] H X H a$HPCPFIFLXpAF FAC3 AA AAH  AA AAE D̓C@QMH H ? E w E [<C@MQH B  I k E Th) |C0JKn B (C0HO E $̔AA  AD (FNN[} F , FMIIK D $PlC KF\ H s,xAC O AD X AG @`AC d AG ̕|'AC aA(JCKJFs G (5AC T AG OA0DAF  AF O AH 4xuAC AC  C AAH (C@HFHH\ C PܖlAF ACE(r AA AAB MAA AA00{J_AC AC0SA AA$dCPPOn H |PAC ` AC PC HSq(ЗC0HHHV E (<rC@HHHH C (*AC `A,HC0HHIb B S E $xPC@JN F @AA AAF AA AAE @LAF AC p A AAB CF AA((oAA C g AA(TvC LHS F q G X-C i<pAA AAC`  AA AAD $ؙ C HHU H i(H _AA C W AA(,| @CKKP, C pXAA CAF AA AAC  AA AAE  AA AAH (̚ (CpIFH  E T*AA AAFD AA AAF L AA AAH P8E%AE ZDpHE TELC FMuHEZAC CC@ A AAC AF AAE1C m F'C ( EhFIIeK H LF%`G-t$G,0GHAF w AA FA<PGAA AACP> AA AAG h0I$AA AACPh AA AAE O AA AAE OAA AATdJAA AAC@ AA AAH V AA AAF (,LKAA C C AAlPLqAA AAF CA AAH h CA AAB P CA AAB X`NTAC0~ AA T|NAA AACP AA AAB  AA AAE TԞdPeAA AAC`5 CA AAA C FA AAA (,|RC0LHWv D <XSUAC AAEpX AA AAA @ V1AA CAH  AA AAF @ܟW~AA AAH  AA AAA T XY`AA AAC0a AA AAD  AA AAA <x`ZAA FAE0 CA AAA [.CgTР[AA C ^  AAC T  AAA C  DAA K  CAA (p[XF L A (D[_AC C q  CAD @p[OAA AAF AA AAA 8]~AA C M  AAD T  AAB 08^AA AC zA AAT$^AA AAC@b CA AAA  CA AAA |\_AC YAT\_AA AAC  AA AAF a AA AAC =@'C _)C e( _AAE _ DG OA(L_=AC Eo CA$x`MCFI_ G P(8`C0FPFFl G 8̣`AA ACE@AA AAa,aAA C   AAF hL|bwAA AACP? AA AAF R AA AAB JAA AAd< AA AACP^ CA AAA  CA AAA p AA AAA H CA AAA ,@HpAC | FB w FA pp0pAA AC0A AA `qfAC0`A ܥqyAC0f AE 4rAA C0  FAF C CAh8reAA AAC@ AA AAE f AA AAA \AA AA(sC@FFFJ F TЦXtAA AAE`v AA AAE Z CA AAA ((wCPHFFHL E Tdx,C h0l|x]AE \ AE S AD [A0xC FFx A R F f A (ԧyC FJS J  A (xy}C FD^ E @ A ,,yC FHS D Q A (\,ziAC@u AF gA$pzC0HFl C ^z`C IFMШ({MC0e H \(X{]FI_\A A @|AA ACE/ AA AAB T`AC ACC@] AA AAD e AA AAA @0 AA AAFA AA AAA uC LH] RAC LAD$AAC0{A8dTAA AAC@CA AATAA AACP( AA AAE j AA AAA @@VAA AC } A AAB FA AA<\2PPAA AAC0~ CA AAE ZCA AAF 0UC IJ~DܫlAA CE  C AAE CH AA@$ԎAA ACCR AA AAA h +C g8WC OD(xyAA C q AA̬̔ ȔuC0HFcT(AA ACC0S CA AAF k HA AAB ,XjAA E T  AAA @AA AAF AA AAE ̭|XC p A (C`KHHHs G $CP} A 00C@QMNn C {(ddgC`PHHR E C s B p H $yC@MFHZ<خpAA AAC0k CA AAH (0FAC E z AA,DTC HHP[ B ctBC ~PL}AA FAC0f AA AAB AA AA(x&C`HHHH G < |EAA AACp< AA AAA TLAAA FAC AA AAA  AA AAF ,C HNz E o A <԰tAA AACP CA AAA <BAC CAC@ AA AAA T.Ae B AxAA FAC@a CA AAE ^ AC AAD } CA AAE jCA AA,,CPWKgE G (,ܳCpHULB B XMC0I$pC@XHH[ A (P4AC Eh AAIJdز` \(hHAA H y CA8,jAC AAC(\AA AA<h%AA AAC@ AA AAG (>AC S AH \A(ԳĶkC@HLHPO B ,AA CP  AAA 0&AC `APȸ2 dlC HJV@+C g8XAA AAC@AA AA(ܴ;AC Ii CA(gC T[ F ] C <4DBAA AACP  AA AAC 0tTLAA AC BA AA<pAC AAEP FA AAC 0P]AC g AD O AH SA0|C FHY F h H a G ,PkC0FKFk C w A T7AA AAC@ CA AAC b AF AAE ض4C [ B S< uAA AAH0+ AA AAA X8` AA AAC AA AAA   AA AAE >AC xA4-C $ȷPCPLHH A <C (4AC y CH JA0(AC `C(PlAC t CE fA|X$HC@HTHM D 8̸AF Ap  AAA Z CAT@kAA AACP AA AAG  AA AAA `X (tT CPFVP B 88AF C L  CAF K  AAK ܹ?AC wC$JAH@2(T$8CpFIFL G 8NC FKFs('C TPAA AACP\ CA AAG  CA AAE PAF AAE@U CA AAG YAA AATd4@AA CAEP AA AAA S AA AAA <AA AAH AA AAE T)AA AAFt AA AAF  AA AAE TBhAA AACp AA AAG  AA AAF  AA AAB z AA AAB <|AC AAC` CA AAF T,AF AAC@B CA AAD B CA AAH @T AC AAC AA AAG ȽcAC0K AH (FWINS G TuAA AAC@ AA AAD s AA AAA <p8:AF AAC@ AA AAA 86CHH^XоX`AA AAC AA AAC n AA AAA ,,\cAC C@T  AAA (\CFky C PpAC AAC@ AA AAG [CA AA ܿ ^C0HLe D $HC IZ H ((SAC E0G AATh4hPC HHHHB C Y G ~C LHWO(DFILIR D (COHKJa H (CGHHHp F $H0CHGHHi8pvAA ACC$fCA AA$C0HHQa4DRAA AAJA AA8 lAA AAC0uCA AA(HC HL_ B ^ t4VAC0PAp0\C@LH_ E d L ( ^CpHHHLS F @ LAA AAC AA AAA PlCKHE A 8t AA AAC@AA AA@AA AAC% AA AAH <dAA AAFO AA AAC 4 C XL # `!cAC ]A d!GA} B F!AA AAFF CA AAB V HA AAG  CA AAA D CA AAA d0&AA AAC0Y AA AAL N AA AAF GAA AAP'AA CAC@ CA AAB WAA EA$'C HHHw F $T(_CPJ_N F (<)C0HHHP F hP*!C ]<h*AA AAC` AA AAG dH-AA AAC0| AA AAA S AA AAA JAA AA((--C0PHO A T.HAC BA,x.AA C@  AAF `/ (\/{C0H[U E $0C NLv E (H1C0HLTb C <<1AA AAC0 AA AAB <|2NAA AACP AA AAE 3HC HGu<3sAA AACP AA AAE 85AA AAC@AA AAhX5|AA AAC@ AA AAH C CA AAG C FA AAD l6AA AAC` AA AAA N AA ACA C CA AAA (49hAA C ` AA4`9AA AFr A AAB <:AA CCCP AA AAA P<AEPxA'C @<8AA AAH  AA AAA 4T>iAA AC0 C AAD <?AA AAC AA AAA LAAC0~A(AC0HHX` E (LBUAC A AJ CA(HB{C0HHOz D (tBCPHHf C ,hEC0HHSn D s@E$AF AAK  AA AAH K @(KAA AAF [ AA AAA @lLAA AAF AA AAB THPAA AAC CA AAC ] CA AAE (RCpMPr F T4dUAA ACEa CA AAF W CA AAA UVAE NAlU#AA ACHK CA AAA V AA AAF  AA AAA  X6C0o8X#C _PXNC0@ E Ep(Y7C0p<PYAF AAC@k AA AAE Y8YAC ACC@AA AA(ZuC@FFWf D $Dd[C MHFD F l\AC OE,\AA C0b  CAE ,<]AC E @  AAE (] C$XJ A (aMAA C C CADaWC j C f<dadAA AACP AA AAE (eUAA C0K CAHeTC HIPeAA ACCP CA AAF UCA AA<D4f<AA AAC`  CA AAF 84gcAA CCE0QAA AA8hgAA AAC@wCA AA'C TgAA AAC0e CA AAF y CA AAA ThphAA AAC0 AA AAF c DC AAD <i$AA AAC`  AA AAA (jAA CP CA ,j\AC@VA(P8k=FKR]q G (|LlC@MHMM F l9C r<l\AA AAC@0 AA AAA 8n`AA AAC0TAA AA0<Ptd AA AAC0x AA AAA GAD AAl MAA AAC0 AA AAA  AA AAH E AA AAA <8AA AAH@D AA AAD x2<,AA AACP AA AAF ZAA VA@AA AAF4 AA AAF 4XC0FIF|<XAA AAC0m CA AAF 0LAA HA@\AA AAF AA AAB (C@FR A (,l/AC E a CA8XpAA AAC@CA AA?C HGl<AAC CAC` AA ACF @ AA AFF CA AAC h8'6AA AAEP AA AAB p AA AAD M AA AAG (AAC0{A<(0AC AAFR AA AAF $.C@HHHH^$, /fC0HTV C $TT0C PHHz C @|<1uC HPL` A w A q G  F Z H , o    oXoo֕  Ξޞ.>N^n~Οޟ.>N^n~Πޠ.>N^n~Ρޡ.>N^n~΢ޢ.>N^n~Σޣ.>N^n~Τޤ.>N^n~Υޥ.>N^n~Φަ.>N^n~Χާ.>N^n~Ψި.>N^n~ /bad-path/ % 5 ? % 5 O ? ^ p  W   K]Bn`K֒I] $ $ i< s? N( Z` aH I QK (] fp jV fp 3o fp V ^ ^  ^ #^ ] ] fp ] ] ] ] ] ] fp *d 0d 6d   F No֕[oXX0j  s  |HH0wxxP Щ)\F, ,p` `p8  !|( J > ? ?  ? ? ? B@   Lp  L